Priming by Rhizobacterium Protects Tomato Plants from Biotrophic and Necrotrophic Pathogen Infections through Multiple Defense Mechanisms

Science.gov (United States)

Ahn, Il-Pyung; Lee, Sang-Woo; Kim, Min Gab; Park, Sang-Ryeol; Hwang, Duk-Ju; Bae, Shin-Chul

2011-01-01

A selected strain of rhizobacterium, Pseudomonas putida strain LSW17S (LSW17S), protects tomato plants (Lycopersicon esculentum L. cv. Seokwang) from bacterial speck by biotrophic Pseudomonas syringae pv. tomato strain DC3000 (DC3000) and bacterial wilt by necrotrophic Ralstonia solanacearum KACC 10703 (Rs10703). To investigate defense mechanisms induced by LSW17S in tomato plants, transcription patterns of pathogenesis-related (PR) genes and H2O2 production were analyzed in plants treated with LSW17S and subsequent pathogen inoculation. LSW17S alone did not induce transcriptions of employed PR genes in leaves and roots. DC3000 challenge following LSW17S triggered rapid transcriptions of PR genes and H2O2 production in leaves and roots. Catalase infiltration with DC3000 attenuated defense-related responses and resistance against DC3000 infection. Despite depriving H2O2 production and PR1b transcription by the same treatment, resistance against Rs10703 infection was not deterred significantly. H2O2 is indispensable for defense signaling and/or mechanisms primed by LSW17S and inhibition of bacterial speck, however, it is not involved in resistance against bacterial wilt. PMID:21710203

Differential secretome analysis of Pseudomonas syringae pv tomato using gel-free MS proteomics

Directory of Open Access Journals (Sweden)

Jörg eSchumacher

2014-07-01

Full Text Available The plant pathogen Pseudomonas syringae pv. tomato (DC3000 causes virulence by delivering effector proteins into host plant cells through its type three secretion system (T3SS. In response to the plant environment DC3000 expresses hypersensitive response and pathogenicity genes (hrp. Pathogenesis depends on the ability of the pathogen to manipulate the plant metabolism and to inhibit plant immunity, which depends to a large degree on the plant’s capacity to recognise both pathogen and microbial determinants (PAMP/MAMP-triggered immunity. We have developed and employed MS-based shotgun and targeted proteomics to (i elucidate the extracellular and secretome composition of DC3000 and (ii evaluate temporal features of the assembly of the T3SS and the secretion process together with its dependence of pH. The proteomic screen, under hrp inducing in vitro conditions, of extracellular and cytoplasmatic fractions indicated the segregated presence of not only T3SS implicated proteins such as HopK1, HrpK1, HrpA1 and Avrpto1, but also of proteins not usually associated with the T3SS or with pathogenicity. Using multiple reaction monitoring MS (MRM-MS to quantify HrpA1 and Avrpto1, we found that HrpA1 is rapidly expressed, at a strict pH-dependent rate and is post-translationally processed extracellularly. These features appear to not interfere with rapid Avrpto1 expression and secretion but may suggest some temporal post-translational regulatory mechanism of the T3SS assembly. The high specificity and sensitivity of the MRM-MS approach should provide a powerful tool to measure secretion and translocation in infected tissues.

40 CFR 180.1261 - Xanthomonas campestris pv. vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages.

Science.gov (United States)

2010-07-01

... and Pseudomonas syringae pv. tomato specific Bacteriophages. 180.1261 Section 180.1261 Protection of.... vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages. An exemption from the requirement of... syringae pv. tomato specific bacteriophages in or on pepper and tomato. [74 FR 26536, June 3, 2009] ...

Genome Sequences of Two Pseudomonas syringae pv. tomato Race 1 Strains, Isolated from Tomato Fields in California

OpenAIRE

Thapa, Shree P.; Coaker, Gitta

2016-01-01

Pseudomonas syringae pv. tomato race 1 strains have evolved to overcome genetic resistance in tomato. Here, we present the draft genome sequences of two race 1 P.?syringae pv. tomato strains, A9 and 407, isolated from diseased tomato plants in California.

Jasmonate ZIM-domain (JAZ protein regulates host and nonhost pathogen-induced cell death in tomato and Nicotiana benthamiana.

Directory of Open Access Journals (Sweden)

Yasuhiro Ishiga

Full Text Available The nonhost-specific phytotoxin coronatine (COR produced by several pathovars of Pseudomonas syringae functions as a jasmonic acid-isoleucine (JA-Ile mimic and contributes to disease development by suppressing plant defense responses and inducing reactive oxygen species in chloroplast. It has been shown that the F-box protein CORONATINE INSENSITIVE 1 (COI1 is the receptor for COR and JA-Ile. JASMONATE ZIM DOMAIN (JAZ proteins act as negative regulators for JA signaling in Arabidopsis. However, the physiological significance of JAZ proteins in P. syringae disease development and nonhost pathogen-induced hypersensitive response (HR cell death is not completely understood. In this study, we identified JAZ genes from tomato, a host plant for P. syringae pv. tomato DC3000 (Pst DC3000, and examined their expression profiles in response to COR and pathogens. Most JAZ genes were induced by COR treatment or inoculation with COR-producing Pst DC3000, but not by the COR-defective mutant DB29. Tomato SlJAZ2, SlJAZ6 and SlJAZ7 interacted with SlCOI1 in a COR-dependent manner. Using virus-induced gene silencing (VIGS, we demonstrated that SlJAZ2, SlJAZ6 and SlJAZ7 have no effect on COR-induced chlorosis in tomato and Nicotiana benthamiana. However, SlJAZ2-, SlJAZ6- and SlJAZ7-silenced tomato plants showed enhanced disease-associated cell death to Pst DC3000. Furthermore, we found delayed HR cell death in response to the nonhost pathogen Pst T1 or a pathogen-associated molecular pattern (PAMP, INF1, in SlJAZ2- and SlJAZ6-silenced N. benthamiana. These results suggest that tomato JAZ proteins regulate the progression of cell death during host and nonhost interactions.

The Ca2+ induced two-component system, CvsSR regulates the Type III secretion system and the extracytoplasmic function sigma-factor AlgU in Pseudomonas syringae pv. tomato DC3000.

Science.gov (United States)

Fishman, Maxwell R; Zhang, Johnson; Bronstein, Philip A; Stodghill, Paul; Filiatrault, Melanie J

2017-12-20

Two-component systems (TCSs) of bacteria regulate many different aspects of the bacterial life cycle including pathogenesis. Most TCSs remain uncharacterized with no information about the signal(s) or regulatory targets and/or role in bacterial pathogenesis. Here, we characterized a TCS in the plant-pathogenic bacterium Pseudomonas syringae pv. tomato DC3000 ( Pto ) composed of the histidine kinase, CvsS, and the response regulator, CvsR. CvsSR is necessary for virulence of Pto , since ΔcvsS and ΔcvsR strains produced fewer symptoms and demonstrated reduced growth on multiple hosts as compared to WT. We discovered that expression of cvsSR is induced by Ca 2+ concentrations found in leaf apoplastic fluid. Thus, Ca 2+ can be added to the list of signals that promote pathogenesis of Pto during host colonization. Through chromatin immunoprecipitation followed by next generation sequencing (ChIP-seq) and global transcriptome analysis (RNA-seq) we discerned the CvsR regulon. CvsR directly activated expression of the type III secretion system regulators, hrpR and hrpS , that regulates Pto virulence in a type III secretion system dependent manner. CvsR also indirectly repressed transcription of the extracytoplasmic sigma factor algU and production of alginate. Phenotypic analysis determined that CvsSR inversely regulated biofilm formation, swarming motility, and cellulose production in a Ca 2+ -dependent manner. Overall, our results show that CvsSR is a key regulatory hub critical for interaction with host plants. Importance Pathogenic bacteria must be able to react and respond to the surrounding environment, make use of available resources, and avert or counter host immune responses. Often, these abilities rely on two-component systems (TCSs) composed of interacting proteins that modulate gene expression. We identified a TCS in the plant-pathogenic bacterium Pseudomonas syringae that responds to the presence of calcium, which is an important signal during the plant

Molecular characterization of Pseudomonas syringae pv. tomato isolates from Tanzania

DEFF Research Database (Denmark)

Shenge, K.C.; Stephan, D.; Mabagala, R. B.

2008-01-01

Bacterial speck caused by Pseudomonas syringae pv. tomato is an emerging disease of tomato in Tanzania. Following reports of outbreaks of the disease in many locations in Tanzania, 56 isolates of P. syringae pv. tomato were collected from four tomato- producing areas and characterized using...

Multi-level cascaded DC/DC converters for PV applications

Directory of Open Access Journals (Sweden)

Ahmed A.A. Hafez

2015-12-01

Full Text Available A robust multi-level cascaded DC/DC system for Photovoltaic (PV application is advised in this article. There are three PV generators, each is coupled to a half-bridge buck cell. Each PV-generator–buck-converter channel is controlled such that maximum power is captured independently under different irradiation and temperature levels. The system operation under normal and abnormal conditions was comprehensively investigated. Internal Model Control (IMC technique was adopted for tuning the controllers. An elaborate switching modulation strategy was used to reduce the current ripple and inductor size, while maintaining high efficiency. Annotative, simple and robust remedial strategies were proposed to mitigate different anticipated faults. Comprehensive simulation results in Matlab environment were illustrated for corroborating the performance of the advised cascaded DC/DC system under normal/abnormal conditions. The proposed system enjoys the merits of independency, reduced volumetric dimensions and improved efficiency. Furthermore, the system is inherently fault-tolerant.

High-Voltage DC-DC Converter Topology for PV Energy Utilization - Investigation and Implementation

DEFF Research Database (Denmark)

Sanjeevikumar, Padmanaban; Blaabjerg, Frede; Wheeler, Patrick

2017-01-01

This paper exploited the utilization of photovoltaic (PV) energy system with high-voltage (HV) output DC-DC converter. Classical boost converters are used for both renewable energy integration and HV applications, but limited by reducing output/efficiency in performance. Moreover, as parasitic...... elements suppress the power transfer ratio, converter needs to maximize the PV energy utilization. This investigation study focused to include additional parasitic elements (voltage-lift technique) to a standard DC-DC buck converter and to overcome all the above drawbacks to maximize the PV power...

Tomato NAC transcription factor SlSRN1 positively regulates defense response against biotic stress but negatively regulates abiotic stress response.

Directory of Open Access Journals (Sweden)

Bo Liu

Full Text Available Biotic and abiotic stresses are major unfavorable factors that affect crop productivity worldwide. NAC proteins comprise a large family of transcription factors that play important roles in plant growth and development as well as in responses to biotic and abiotic stresses. In a virus-induced gene silencing-based screening to identify genes that are involved in defense response against Botrytis cinerea, we identified a tomato NAC gene SlSRN1 (Solanum lycopersicum Stress-related NAC1. SlSRN1 is a plasma membrane-localized protein with transactivation activity in yeast. Expression of SlSRN1 was significantly induced by infection with B. cinerea or Pseudomonas syringae pv. tomato (Pst DC3000, leading to 6-8 folds higher than that in the mock-inoculated plants. Expression of SlSRN1 was also induced by salicylic acid, jasmonic acid and 1-amino cyclopropane-1-carboxylic acid and by drought stress. Silencing of SlSRN1 resulted in increased severity of diseases caused by B. cinerea and Pst DC3000. However, silencing of SlSRN1 resulted in increased tolerance against oxidative and drought stresses. Furthermore, silencing of SlSRN1 accelerated accumulation of reactive oxygen species but attenuated expression of defense genes after infection by B. cinerea. Our results demonstrate that SlSRN1 is a positive regulator of defense response against B. cinerea and Pst DC3000 but is a negative regulator for oxidative and drought stress response in tomato.

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Pseudomonas syringae pv. tomato str. DC3000] ... Length = 157 ... Query: 238 GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSN...IGALELIRCDHERIAQLLSNLVS 297 ... GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSN...IGALELIRCDHERIAQLLSNLVS Sbjct: 1 ... GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSNIGALELIRCDHERIAQLLSNLV

Assessment of strains of Pseudomonas syringae pv. tomato from Tanzania for resistance to copper and streptomycin

DEFF Research Database (Denmark)

Shenge, K.C.; Wydra, K.; Mabagala, M.B.

2008-01-01

Fifty-six strains of Pseudomonas syringae pv. tomato (P.s. pv. tomato) were collected from tomato-producing areas in Tanzania and assessed for resistance to copper and antibiotics. The collection was done from three tomato-producing regions (Morogoro, Arusha and Iringa), representing three...... different ecological conditions in the country. After isolation and identification, the P. s. pv. tomato strains were grown on King's medium B (KB) amended with 20% copper sulphate (w/v). The strains were also assessed for resistance to antibiotics. Results indicated that there was widespread resistance...... strains of the pathogen were moderately resistant to copper sulphate, such that 54.0% of them were able to grow on the KB medium amended with 20% (w/v) of the copper compound....

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s syringae ... pv. tomato str. DC3000] ... Length = 151 ... Query: 151 ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA 210 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA Sbjct: 1 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEITASDFASDCCFGVTSVRGTKVPA 60 ... Qu

Comparative genomic analysis of two-component regulatory proteins in Pseudomonas syringae

DEFF Research Database (Denmark)

Lavin, J.L.; Kiil, Kristoffer; Resano, O.

2007-01-01

Background: Pseudomonas syringae is a widespread bacterial plant pathogen, and strains of P. syringae may be assigned to different pathovars based on host specificity among different plant species. The genomes of P. syringae pv. syringae (Psy) B728a, pv. tomato (Pto) DC3000 and pv. phaseolicola...

Extracytoplasmic function sigma factors in Pseudomonas syringae

DEFF Research Database (Denmark)

Kiil, Kristoffer; Oguiza, J.A.; Ussery, D.W.

2005-01-01

Genome analyses of the plant pathogens Pseudomonas syringae pv. tomato DC3000, pv. syringae B728a and pv. phaseolicola 1448A reveal fewer extracytoplasmic function (ECF) sigma factors than in related Pseudomonads with different lifestyles. We highlight the presence of a P. syringae-specific ECF...

First report of bacterial speck of tomato caused by Pseudomonas syringae pv. tomato race 1 in Portugal

OpenAIRE

Cruz, L.; Cruz, J.; Eloy, M.; Oliveira, Helena; Vaz, H.; Tenreiro, R.

2010-01-01

Protected and open field tomato crops are economically important for Portuguese agriculture. In 1983, Pseudomonas syringae pv. tomato (Okabe, 1933) Young, Dye & Wilkie, 1978 was first reported affecting protected crops (3) and then later under open field conditions (1). In the 2009 spring/summer season, several outbreaks of bacterial speck of tomato showing an unusual degree of severity were observed in open fields from the Tagus Valley Region

Natural variation for responsiveness to flg22, flgII-28, and csp22 and Pseudomonas syringae pv. tomato in heirloom tomatoes.

Directory of Open Access Journals (Sweden)

Selvakumar Veluchamy

Full Text Available Tomato (Solanum lycopersicum L. is susceptible to many diseases including bacterial speck caused by Pseudomonas syringae pv. tomato. Bacterial speck disease is a serious problem worldwide in tomato production areas where moist conditions and cool temperatures occur. To enhance breeding of speck resistant fresh-market tomato cultivars we identified a race 0 field isolate, NC-C3, of P. s. pv. tomato in North Carolina and used it to screen a collection of heirloom tomato lines for speck resistance in the field. We observed statistically significant variation among the heirloom tomatoes for their response to P. s. pv. tomato NC-C3 with two lines showing resistance approaching a cultivar that expresses the Pto resistance gene, although none of the heirloom lines have Pto. Using an assay that measures microbe-associated molecular pattern (MAMP-induced production of reactive oxygen species (ROS, we investigated whether the heirloom lines showed differential responsiveness to three bacterial-derived peptide MAMPs: flg22 and flgII-28 (from flagellin and csp22 (from cold shock protein. Significant differences were observed for MAMP responsiveness among the lines, although these differences did not correlate strongly with resistance or susceptibility to bacterial speck disease. The identification of natural variation for MAMP responsiveness opens up the possibility of using a genetic approach to identify the underlying loci and to facilitate breeding of cultivars with enhanced disease resistance. Towards this goal, we discovered that responsiveness to csp22 segregates as a single locus in an F2 population of tomato.

Performance power evaluation of DC fan cooling system for PV panel by using ANSYS CFX

Science.gov (United States)

Syafiqah, Z.; Amin, N. A. M.; Irwan, Y. M.; Irwanto, M.; Leow, W. Z.; Amelia, A. R.

2017-09-01

A research has been conducted to find the optimum combination for DC fan air cooling system of photovoltaic (PV) panel. During normal operation of PV panel, it is estimated that only 15 % of solar radiation is converted into electrical energy. Meanwhile, the rest of the solar radiation is converted into heat energy which affects the performance of the PV panel. Therefore, the aim of this research is to investigate the performance power evaluation of DC fan cooling system for PV panel by using ANSYS CFX. The effect of airflow configuration of DC fan has been investigated. This is to analyze whether the airflow circulation of DC fan cause a change towards the maximum temperature of PV panel. Besides, the impact of varying number of DC fans attached at the back of PV panel is evaluated. The result of airflow circulation of DC fan has been discussed. Meanwhile, with the increment number of DC fans, the PV panel temperature drops significantly. As a conclusion, the optimum number of DC fans is two with the combination of inlet airflow.

Integrated Three-Port DC-DC Converter for Photovoltaic (PV) Battery Stand-alone Systems

DEFF Research Database (Denmark)

Ouyang, Ziwei; Andersen, Michael A. E.

2016-01-01

of solar energy. Moreover, a novel transformer configuration enables variable turns ratio controlled by the phase between the two current excitations subjected to the primary windings, allowing a wider input/output range. 1 kW experimental prototype has been built to demonstrate a wellmanaged power flow......Several power sources such as PV solar arrays and battery are often used to manage the power flow for a photovoltaic (PV) based stand-alone power system due to the fluctuation nature of solar energy resource, and deliver a continuous power to the users in an appropriate form. Traditionally, three...... different single-input single-output (SISO) dc/dc converters would have been used. To reduce the cost and improve the power density of the system, an integrated three-port isolated dc/dc converter is proposed in this paper. It can realize all functions of the energy delivery due to the fluctuation nature...

Design And Simulation Of A PV System With Battery Storage Using Bidirectional DC-DC Converter Using Matlab Simulink

Directory of Open Access Journals (Sweden)

Mirza Mursalin Iqbal

2017-07-01

Full Text Available PV Photovoltaic systems are one of the most renowned renewable green and clean sources of energy where power is generated from sunlight converting into electricity by the use of PV solar cells. Unlike fossil fuels solar energy has great environmental advantages as they have no harmful emissions during power generation. In this paper a PV system with battery storage using bidirectional DC-DC converter has been designed and simulated on MATLAB Simulink. The simulation outcomes verify the PV systems performance under standard testing conditions.

Immunocytochemical localization of HrpA and HrpZ supports a role for the Hrp pilus in the transfer of effector proteins from Pseudomonas syringae pv. tomato across the host plant cell wall.

Science.gov (United States)

Brown, I R; Mansfield, J W; Taira, S; Roine, E; Romantschuk, M

2001-03-01

The Hrp pilus, composed of HrpA subunits, is an essential component of the type III secretion system in Pseudomonas syringae. We used electron microscopy (EM) and immunocytochemistry to examine production of the pilus in vitro from P. syringae pv. tomato strain DC3000 grown under hrp-inducing conditions on EM grids. Pili, when labeled with antibodies to HrpA, developed rapidly in a nonpolar manner shortly after the detection of the hrpA transcript and extended up to 5 microm into surrounding media. Structures at the base of the pilus were clearly differentiated from the basal bodies of flagella. The HrpZ protein, also secreted via the type III system, was found by immunogold labeling to be associated with the pilus in vitro. Accumulation and secretion of HrpA and HrpZ were also examined quantitatively after the inoculation of wild-type DC3000 and hrpA and hrpZ mutants into leaves of Arabidopsis thaliana. The functional pilus crossed the plant cell wall to generate tracks of immunogold labeling for HrpA and HrpZ. Mutants that produced HrpA but did not assemble pili were nonpathogenic, did not secrete HrpA protein, and were compromised for the accumulation of HrpZ. A model is proposed in which the rapidly elongating Hrp pilus acts as a moving conveyor, facilitating transfer of effector proteins from bacteria to the plant cytoplasm across the formidable barrier of the plant cell wall.

Virulence of Pseudomonas syringae pv. tomato DC3000 Is Influenced by the Catabolite Repression Control Protein Crc.

Science.gov (United States)

Chakravarthy, Suma; Butcher, Bronwyn G; Liu, Yingyu; D'Amico, Katherine; Coster, Matthew; Filiatrault, Melanie J

2017-04-01

Pseudomonas syringae infects diverse plant species and is widely used as a model system in the study of effector function and the molecular basis of plant diseases. Although the relationship between bacterial metabolism, nutrient acquisition, and virulence has attracted increasing attention in bacterial pathology, it is largely unexplored in P. syringae. The Crc (catabolite repression control) protein is a putative RNA-binding protein that regulates carbon metabolism as well as a number of other factors in the pseudomonads. Here, we show that deletion of crc increased bacterial swarming motility and biofilm formation. The crc mutant showed reduced growth and symptoms in Arabidopsis and tomato when compared with the wild-type strain. We have evidence that the crc mutant shows delayed hypersensitive response (HR) when infiltrated into Nicotiana benthamiana and tobacco. Interestingly, the crc mutant was more susceptible to hydrogen peroxide, suggesting that, in planta, the mutant may be sensitive to reactive oxygen species generated during pathogen-associated molecular pattern-triggered immunity (PTI). Indeed, HR was further delayed when PTI-induced tissues were challenged with the crc mutant. The crc mutant did not elicit an altered PTI response in plants compared with the wild-type strain. We conclude that Crc plays an important role in growth and survival during infection.

Open- and Short-Circuit Fault Identification for a Boost dc/dc Converter in PV MPPT Systems

Directory of Open Access Journals (Sweden)

Diego R. Espinoza Trejo

2018-03-01

Full Text Available This paper proposes a fault identification system for short and open-circuit switch faults (SOCSF for a dc/dc converter acting as a Maximum Power Point Tracker (MPPT in Photovoltaic (PV systems. A closed-loop operation is assumed for the boost dc/dc converter. A linearizing control plus a Proportional-Derivative (PD controller is suggested for PV voltage regulation at the maximum power point (MPP. In this study, the SOCSF are modeled by using an additive fault representation and the fault identification (FI system is synthesized departing from a Luenberger observer. Hence, an FI signal is obtained, which is insensitive to irradiance and load current changes, but affected by the SOCSF. For FI purposes, only the sensors used in the control system are needed. Finally, an experimental evaluation is presented by using a solar array simulator dc power supply and a boost dc/dc converter of 175 W in order to validate the ideas this study exposes.

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

Modeling and Control of DC/DC Boost Converter using K-Factor Control for MPPT of Solar PV System

DEFF Research Database (Denmark)

Vangari, Adithya; Haribabu, Divyanagalakshmi; Sakamuri, Jayachandra N.

2015-01-01

This paper is focused on the design of a controller for the DC/DC boost converter using K factor control, which is based on modified PI control method, for maximum power point tracking (MPPT) of solar PV system. A mathematical model for boost converter based on small signal averaging approach...... is presented. Design of the passive elements of the boost converter as per the system specifications is also illustrated. The performance of the proposed K factor control method is verified with the simulations for MPPT on solar PV system at different atmospheric conditions. A new circuit based model for solar...... PV array, which includes the effect of solar insolation and temperature on PV array output, for the application in power system transient simulations, is also presented. The performance of the PV array model is verified with simulations at different atmospheric conditions. A 160W PV module from BP...

Pseudomonas syringae evades host immunity by degrading flagellin monomers with alkaline protease AprA.

Science.gov (United States)

Pel, Michiel J C; van Dijken, Anja J H; Bardoel, Bart W; Seidl, Michael F; van der Ent, Sjoerd; van Strijp, Jos A G; Pieterse, Corné M J

2014-07-01

Bacterial flagellin molecules are strong inducers of innate immune responses in both mammals and plants. The opportunistic pathogen Pseudomonas aeruginosa secretes an alkaline protease called AprA that degrades flagellin monomers. Here, we show that AprA is widespread among a wide variety of bacterial species. In addition, we investigated the role of AprA in virulence of the bacterial plant pathogen P. syringae pv. tomato DC3000. The AprA-deficient DC3000 ΔaprA knockout mutant was significantly less virulent on both tomato and Arabidopsis thaliana. Moreover, infiltration of A. thaliana Col-0 leaves with DC3000 ΔaprA evoked a significantly higher level of expression of the defense-related genes FRK1 and PR-1 than did wild-type DC3000. In the flagellin receptor mutant fls2, pathogen virulence and defense-related gene activation did not differ between DC3000 and DC3000 ΔaprA. Together, these results suggest that AprA of DC3000 is important for evasion of recognition by the FLS2 receptor, allowing wild-type DC3000 to be more virulent on its host plant than AprA-deficient DC3000 ΔaprA. To provide further evidence for the role of DC3000 AprA in host immune evasion, we overexpressed the AprA inhibitory peptide AprI of DC3000 in A. thaliana to counteract the immune evasive capacity of DC3000 AprA. Ectopic expression of aprI in A. thaliana resulted in an enhanced level of resistance against wild-type DC3000, while the already elevated level of resistance against DC3000 ΔaprA remained unchanged. Together, these results indicate that evasion of host immunity by the alkaline protease AprA is important for full virulence of strain DC3000 and likely acts by preventing flagellin monomers from being recognized by its cognate immune receptor.

Pseudomonas syringae evades host Immunity by degrading flagellin monomers with alkaline protease AprA

OpenAIRE

Pel, M.J.C.; Van Dijken, A.J.H.; Bardoel, B.W.; Seidl, M.F; Van der Ent, S.; Van Strijp, J.A.G.

2014-01-01

Bacterial flagellin molecules are strong inducers of innate immune responses in both mammals and plants. The opportunistic pathogen Pseudomonas aeruginosa secretes an alkaline protease called AprA that degrades flagellin monomers. Here, we show that AprA is widespread among a wide variety of bacterial species. In addition, we investigated the role of AprA in virulence of the bacterial plant athogen P. syringae pv. tomato DC3000. The AprA-deficient DC3000 ΔaprA knockout mutant was significantl...

New topology of multiple-input single-output PV system for DC load applications

Directory of Open Access Journals (Sweden)

Mohsen M. ELhagry

2016-12-01

Full Text Available Improving PV system structure and maximizing the output power of a PV system has drawn many researchers attention nowadays. A proposed multi-input single-output PV system is proposed in this paper. The system consists of multiple PV modules; each module feeds a DC–DC converter. The outputs of the converters are tied together to form a DC voltage source. In order to minimize the output ripples of the converters, the control signal of each converter is time shifted from each other by a certain time interval depending on the number of converters used in the topology. In this study a battery is used as the main load, the load current used as the control variable. A fuzzy logic controller designed to modulate the operating point of the system to get the maximum power. The results show that the proposed system has very good response for various operating conditions of the PV system. In addition the output filter is minimized with excellent quality of the DC output voltage.

A rapid seedling resistance assay identifies wild tomato lines that are resistant to Psuedomonas syringe pv. tomato race 1

Science.gov (United States)

Bacterial speck caused by Pseudomonas syringae has historically been controlled by the Pto/Prf gene cluster. Emerging strains like P. syringae pv. tomato race 1 overcome resistance conferred by Pto/Prf, and can cause serious crop loss under appropriate environmental conditions. We developed a rapid ...

Atmospheric CO2 Alters Resistance of Arabidopsis to Pseudomonas syringae by Affecting Abscisic Acid Accumulation and Stomatal Responsiveness to Coronatine

NARCIS (Netherlands)

Zhou, Y.; Vroegop-Vos, I.; Schuurink, R.C.; Pieterse, C.M.J.; Van Wees, S.C.M.

Atmospheric CO2 influences plant growth and stomatal aperture. Effects of high or low CO2 levels on plant disease resistance are less well understood. Here, resistance of Arabidopsis thaliana against the foliar pathogen Pseudomonas syringae pv. tomato DC3000 (Pst) was investigated at three different

Intelligent voltage control in a DC micro-grid containing PV generation and energy storage

OpenAIRE

Rouzbehi, Kumars; Miranian, Arash; Candela García, José Ignacio; Luna Alloza, Álvaro; Rodríguez Cortés, Pedro

2014-01-01

This paper proposes an intelligent control scheme for DC voltage regulationin a DC micro-grid integrating photovoltaic (PV) generation, energy storage and electric loads. The maximum power generation of the PV panel is followed using the incremental conductance (IC) maximum power point tracking (MPPT) algorithm while a high-performance local linear controller (LLC)is developed for the DC voltage control in the micro-grid.The LLC, as a data-driven control strategy, controls the bidirectional c...

Synchronized Pulsed dc - dc Converter as Maximum Power Position Tracker with Wide Load and Insolation Variation for Stand Alone PV System

International Nuclear Information System (INIS)

Hardik, P. Desai; Ranjan Maheshwari

2011-01-01

This paper investigates the interest focused on employing parallel connected dc-dc converter with high tracking effectiveness under wide variation in environmental conditions (Insolation) and wide load variation. dc-dc converter is an essential part of the stand alone PV system. Paper also presents an approach on how duty cycle for maximum power position (MPP) is adjusted by taking care of varying load conditions and without iterative steps. Synchronized PWM pulses are employed for the converter. High tracking efficiency is achieved with continuous input and inductor current. In this approach, the converter can he utilized in buck as well in boost mode. The PV system simulation was verified and experimental results were in agreement to the presented scheme. (authors)

LPV model for PV cell and fractional control of DC/DC converter for photovoltaic systems

OpenAIRE

Martínez González, Rubén; Bolea Monte, Yolanda; Grau Saldes, Antoni; Martínez García, Herminio

2011-01-01

This paper deals with the fractional modelling of a DC-DC converter, suitable in solar-powered electrical generation systems, and the design of a fractional controller for the aforementioned switching converter. A new model for PV cells is proposed in order to obtain a linear equation for V-I characteristic via scheduling dependence of temperature and irradiance. Due to the fractional nature of the ultracapacitors this kind of controller gives a suitable and good performance. Peer Reviewed

LPV model for PV cells and fractional control of DC/DC converter for photovoltaic systems

OpenAIRE

Martínez González, Rubén; Bolea Monte, Yolanda; Grau Saldes, Antoni; Martínez García, Herminio

2011-01-01

This paper deals with the fractional modelling of a DC-DC converter, suitable in solar-powered electrical generation systems, and the design of a fractional controller for the aforementioned switching converter. A new model for PV cells is proposed in order to obtain a linear equation for VI characteristic via scheduling dependence of temperature and irradiance. Due to the fractional nature of the ultracapacitors this kind of controller gives a suitable and good performance. Peer Rev...

Distribution System Augmented by DC Links for Increasing the Hosting Capacity of PV Generation

DEFF Research Database (Denmark)

Chaudhary, Sanjay; Demirok, Erhan; Teodorescu, Remus

2012-01-01

This paper presents a concept of enhancing the photovoltaic (PV) power generation hosting capacity of distribution networks. Distribution network serving electrical energy to farm settlements was selected as an example for their large roof area available for PV installation. Further, they are cha......This paper presents a concept of enhancing the photovoltaic (PV) power generation hosting capacity of distribution networks. Distribution network serving electrical energy to farm settlements was selected as an example for their large roof area available for PV installation. Further......, they are characterized by long radial feeders. Such feeders suffer from voltage rise and transformer overloading problems as the total number and capacity of the PV installations increase. The distribution network can be augmented by dc distribution links with power electronic converter interfaces to the traditional ac...... distribution systems. It is shown here that the dc links can be used to interconnect the different radial feeders and the excess power thus could be transferred to the nearby industrial load-center....

Gaseous 3-pentanol primes plant immunity against a bacterial speck pathogen, Pseudomonas syringae pv. tomato via salicylic acid and jasmonic acid-dependent signaling pathways in Arabidopsis.

Science.gov (United States)

Song, Geun C; Choi, Hye K; Ryu, Choong-Min

2015-01-01

3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. A previous study reported that drench application of 3-pentanol elicited plant immunity against microbial pathogens and an insect pest in crop plants. Here, we evaluated whether 3-pentanol and the derivatives 1-pentanol and 2-pentanol induced plant systemic resistance using the in vitro I-plate system. Exposure of Arabidopsis seedlings to 10 μM and 100 nM 3-pentanol evaporate elicited an immune response to Pseudomonas syringae pv. tomato DC3000. We performed quantitative real-time PCR to investigate the 3-pentanol-mediated Arabidopsis immune responses by determining Pathogenesis-Related (PR) gene expression levels associated with defense signaling through salicylic acid (SA), jasmonic acid (JA), and ethylene signaling pathways. The results show that exposure to 3-pentanol and subsequent pathogen challenge upregulated PDF1.2 and PR1 expression. Selected Arabidopsis mutants confirmed that the 3-pentanol-mediated immune response involved SA and JA signaling pathways and the NPR1 gene. Taken together, this study indicates that gaseous 3-pentanol triggers induced resistance in Arabidopsis by priming SA and JA signaling pathways. To our knowledge, this is the first report that a volatile compound of an insect sex pheromone triggers plant systemic resistance against a bacterial pathogen.

Gaseous 3-pentanol primes plant immunity against a bacterial speck pathogen, Pseudomonas syringae pv. tomato via salicylic acid and jasmonic acid-dependent signaling pathways in Arabidopsis

Directory of Open Access Journals (Sweden)

Geun Cheol eSong

2015-10-01

Full Text Available 3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. A previous study reported that drench application of 3-pentanol elicited plant immunity against microbial pathogens and an insect pest in crop plants. Here, we evaluated whether 3-pentanol and the derivatives 1-pentanol and 2-pentanol induced plant systemic resistance using the in vitro I-plate system. Exposure of Arabidopsis seedlings to 10 M and 100 nM 3-pentanol evaporate elicited an immune response to Pseudomonas syringae pv. tomato DC3000. We performed quantitative real-time PCR to investigate the 3-pentanol-mediated Arabidopsis immune responses by determining Pathogenesis-Related (PR gene expression levels associated with defense signaling through SA, JA, and ethylene signaling pathways. The results show that exposure to 3-pentanol and subsequent pathogen challenge upregulated PDF1.2 and PR1 expression. Selected Arabidopsis mutants confirmed that the 3-pentanol-mediated immune response involved salicylic acid (SA and jasmonic acid (JA signaling pathways and the NPR1 gene. Taken together, this study indicates that gaseous 3-pentanol triggers induced resistance in Arabidopsis by priming SA and JA signaling pathways. To our knowledge, this is the first report that a volatile compound of an insect sex pheromone triggers plant systemic resistance against a bacterial pathogen.

A bacterial cysteine protease effector protein interferes with photosynthesis to suppress plant innate immune responses.

Science.gov (United States)

Rodríguez-Herva, José J; González-Melendi, Pablo; Cuartas-Lanza, Raquel; Antúnez-Lamas, María; Río-Alvarez, Isabel; Li, Ziduo; López-Torrejón, Gema; Díaz, Isabel; Del Pozo, Juan C; Chakravarthy, Suma; Collmer, Alan; Rodríguez-Palenzuela, Pablo; López-Solanilla, Emilia

2012-05-01

The bacterial pathogen Pseudomonas syringae pv tomato DC3000 suppresses plant innate immunity with effector proteins injected by a type III secretion system (T3SS). The cysteine protease effector HopN1, which reduces the ability of DC3000 to elicit programmed cell death in non-host tobacco, was found to also suppress the production of defence-associated reactive oxygen species (ROS) and callose when delivered by Pseudomonas fluorescens heterologously expressing a P. syringae T3SS. Purified His(6) -tagged HopN1 was used to identify tomato PsbQ, a member of the oxygen evolving complex of photosystem II (PSII), as an interacting protein. HopN1 localized to chloroplasts and both degraded PsbQ and inhibited PSII activity in chloroplast preparations, whereas a HopN1(D299A) non-catalytic mutant lost these abilities. Gene silencing of NtPsbQ in tobacco compromised ROS production and programmed cell death by DC3000. Our data reveal PsbQ as a contributor to plant immunity responses and a target for pathogen suppression. © 2012 Blackwell Publishing Ltd.

A High Efficiency DC-DC Converter Topology Suitable for Distributed Large Commercial and Utility Scale PV Systems

Energy Technology Data Exchange (ETDEWEB)

Agamy, Mohammed S; Harfman-Todorovic, Maja; Elasser, Ahmed; Steigerwald, Robert L; Sabate, Juan A; Chi, Song; McCann, Adam J; Zhang, Li; Mueller, Frank

2012-09-01

In this paper a DC-DC power converter for distributed photovoltaic plant architectures is presented. The proposed converter has the advantages of simplicity, high efficiency, and low cost. High efficiency is achieved by having a portion of the input PV power directly fed forward to the output without being processed by the converter. The operation of this converter also allows for a simplified maximum power point tracker design using fewer measurements

Determination of PV Generator I-V/P-V Characteristic Curves Using a DC-DC Converter Controlled by a Virtual Instrument

Directory of Open Access Journals (Sweden)

E. Durán

2012-01-01

Full Text Available A versatile measurement system for systematic testing and measurement of the evolution of the I-V characteristic curves of photovoltaic panels or arrays (PV generators is proposed in this paper. The measurement system uses a circuit solution based on DC-DC converters that involves several advantages relative to traditional methods: simple structure, scalability, fast response, and low cost. The measurement of the desired characteristics of PV generators includes high speed of response and high fidelity. The prototype system built is governed by a microcontroller, and experimental results prove the proposed measurement system useful. A virtual instrument (VI was developed for full system control from a computer. The developed system enables monitoring the suitable operation of a PV generator in real time, since it allows comparing its actual curves with those provided by the manufacturer.

Inducible Expression of the De-Novo Designed Antimicrobial Peptide SP1-1 in Tomato Confers Resistance to Xanthomonas campestris pv. vesicatoria.

Directory of Open Access Journals (Sweden)

Areli Herrera Diaz

Full Text Available Antimicrobial peptides (AMPs are small peptides with less than 50 amino acids and are part of the innate immune response in almost all organisms, including bacteria, vertebrates, invertebrates and plants. AMPs are active against a broad-spectrum of pathogens. The inducible expression of AMPs in plants is a promising approach to combat plant pathogens with minimal negative side effects, such as phytotoxicity or infertility. In this study, inducible expression of the de-novo designed AMP SP1-1 in Micro Tom tomato protected tomato fruits against bacterial spot disease caused by Xanthomonas campestris pv. vesicatoria. The peptide SP1-1 was targeted to the apoplast which is the primary infection site for plant pathogens, by fusing SP1-1 peptide to the signal peptide RsAFP1 of radish (Raphanus sativus. The pathogen inducibility of the expression was enabled by using an optimized inducible 4XW2/4XS promoter. As a result, the tomato fruits of independently generated SP1-1 transgenic lines were significantly more resistant to X. campestris pv. vesicatoria than WT tomato fruits. In transgenic lines, bacterial infection was reduced up to 65% in comparison to the infection of WT plants. Our study demonstrates that the combination of the 4XW2/4XS cis-element from parsley with the synthetic antimicrobial peptide SP1-1 is a good alternative to protect tomato fruits against infections with X. campestris pv. vesicatoria.

An Emulated PV Source Based on an Unilluminated Solar Panel and DC Power Supply

Directory of Open Access Journals (Sweden)

Zhongfu Zhou

2017-12-01

Full Text Available This paper provides a review on various PV simulator technologies as well as presents a novel equivalent photovoltaic (PV source that was constructed by using un-illuminated solar panels and a DC power supply that operates in current source mode. The constructed PV source was used for testing photovoltaic converters and various maximum power point tracking (MPPT algorithms required for capturing the maximum possible output power. The mathematical model and electrical characteristics of the constructed PV source were defined and analyzed in detail in the paper. The constructed PV source has the advantages of high bandwidth over the switching circuit based PV simulators. The constructed PV source has been used for testing various power electronics converters and various control techniques effectively in laboratory environments for researchers and university students.

Estudio de la respuesta de pseudomonas syringae pv. tomato DC3000 a flavonoides

OpenAIRE

Vargas Gallego, Paola Andrea

2013-01-01

Esta tesis doctoral ha sido realizada en el Grupo Interacciones Planta-Bacteria perteneciente al Departamento de Microbiología del Suelo y Sistemas Simbióticos de la Estación Experimental del Zaidín, gracias a una beca del Programa "Junta para la Ampliación de Estudios" JAE Predoc del Consejo Superior de Investigaciones Científicas (CSIC) cofinanciada por FEDER y a una beca Marie Curie Training Site for Marine Microbiology (MARMIC EST), financiada por la Comunidad Europea. La investigación ha...

A control strategy for DC-link voltage control containing PV generation and energy storage — An intelligent approach

OpenAIRE

Rouzbehi, Kumars; Miranian, Arash; Candela García, José Ignacio; Luna Alloza, Álvaro; Rodríguez Cortés, Pedro

2014-01-01

In this paper, DC-link voltage control in DC microgrids with photovoltaic (PV) generation and battery, is addressed based on an intelligent approach. The proposed strategy is based on the modeling of the power interface, i.e. power electronic converter, located between the PV array, battery and DC bus, by use of measurement data. For this purpose, a local model network (LMN) is developed to model the converter and then a local linear control (LLC) strategy is designed based on the LMN. Simula...

Hybrid PV/wind system with quinary asymmetric inverter without increasing DC-link number

Directory of Open Access Journals (Sweden)

Aida Baghbany Oskouei

2016-06-01

Full Text Available This paper suggests quinary asymmetric inverter with coupled inductors and transformer, and uses it in hybrid system including photovoltaic (PV and wind. This inverter produces twenty-five-level voltage in addition to merits of multilevel inverter, has only one DC source. Then, it is adequate for hybrid systems, which prevents increasing DC-link and makes control of system easy. Proposed structure also provides isolation in the system and the switch numbers are reduced in this topology compared with other multilevel structures. In this system, battery is used as backup, where PV and wind have complementary nature. The performance of proposed inverter and hybrid system is validated with simulation results using MATLAB/SIMULINK software and experimental results based PCI-1716 data acquisition system.

Hexanoic acid is a resistance inducer that protects tomato plants against Pseudomonas syringae by priming the jasmonic acid and salicylic acid pathways.

Science.gov (United States)

Scalschi, Loredana; Vicedo, Begonya; Camañes, Gemma; Fernandez-Crespo, Emma; Lapeña, Leonor; González-Bosch, Carmen; García-Agustín, Pilar

2013-05-01

Hexanoic acid-induced resistance (Hx-IR) is effective against several pathogens in tomato plants. Our study of the mechanisms implicated in Hx-IR against Pseudomonas syringae pv. tomato DC3000 suggests that hexanoic acid (Hx) treatment counteracts the negative effect of coronatine (COR) and jasmonyl-isoleucine (JA-Ile) on the salicylic acid (SA) pathway. In Hx-treated plants, an increase in the expression of jasmonic acid carboxyl methyltransferase (JMT) and the SA marker genes PR1 and PR5 indicates a boost in this signalling pathway at the expense of a decrease in JA-Ile. Moreover, Hx treatment potentiates 12-oxo-phytodienoic acid accumulation, which suggests that this molecule might play a role per se in Hx-IR. These results support a positive relationship between the SA and JA pathways in Hx-primed plants. Furthermore, one of the mechanisms of virulence mediated by COR is stomatal re-opening on infection with P. syringae. In this work, we observed that Hx seems to inhibit stomatal opening in planta in the presence of COR, which suggests that, on infection in tomato, this treatment suppresses effector action to prevent bacterial entry into the mesophyll. © 2012 BSPP AND BLACKWELL PUBLISHING LTD.

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

Directory of Open Access Journals (Sweden)

María Pilar Castañeda-Ojeda

2017-05-01

Full Text Available The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts.

Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

Science.gov (United States)

Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

2017-01-01

The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

Performance evaluation of a high power DC-DC boost converter for PV applications using SiC power devices

Science.gov (United States)

Almasoudi, Fahad M.; Alatawi, Khaled S.; Matin, Mohammad

2016-09-01

The development of Wide band gap (WBG) power devices has been attracted by many commercial companies to be available in the market because of their enormous advantages over the traditional Si power devices. An example of WBG material is SiC, which offers a number of advantages over Si material. For example, SiC has the ability of blocking higher voltages, reducing switching and conduction losses and supports high switching frequency. Consequently, SiC power devices have become the affordable choice for high frequency and power application. The goal of this paper is to study the performance of 4.5 kW, 200 kHz, 600V DC-DC boost converter operating in continuous conduction mode (CCM) for PV applications. The switching behavior and turn on and turn off losses of different switching power devices such as SiC MOSFET, SiC normally ON JFET and Si MOSFET are investigated and analyzed. Moreover, a detailed comparison is provided to show the overall efficiency of the DC-DC boost converter with different switching power devices. It is found that the efficiency of SiC power switching devices are higher than the efficiency of Si-based switching devices due to low switching and conduction losses when operating at high frequencies. According to the result, the performance of SiC switching power devices dominate the conventional Si power devices in terms of low losses, high efficiency and high power density. Accordingly, SiC power switching devices are more appropriate for PV applications where a converter of smaller size with high efficiency, and cost effective is required.

A Novel Protein Elicitor BAR11 From Saccharothrix yanglingensis Hhs.015 Improves Plant Resistance to Pathogens and Interacts With Catalases as Targets

OpenAIRE

Yanan Zhang; Yanan Zhang; Xia Yan; Xia Yan; Hongmei Guo; Hongmei Guo; Feiyang Zhao; Feiyang Zhao; Lili Huang; Lili Huang

2018-01-01

Previously, we reported the biocontrol effects of Saccharothrix yanglingensis strain Hhs.015 on Valsa mali. Here, we report a novel protein elicitor BAR11 from the biocontrol strain Hhs.015 and its functions in plant defense responses. Functional analysis showed that the elicitor BAR11 significantly stimulated plant systemic resistance in Arabidopsis thaliana to Pseudomonas syringae pv. tomato DC3000. In addition, systemic tissues accumulated reactive oxygen species and deposited callose in a...

Pseudomonas syringae Catalases Are Collectively Required for Plant Pathogenesis

Science.gov (United States)

Guo, Ming; Block, Anna; Bryan, Crystal D.; Becker, Donald F.

2012-01-01

The bacterial pathogen Pseudomonas syringae pv. tomato DC3000 must detoxify plant-produced hydrogen peroxide (H2O2) in order to survive in its host plant. Candidate enzymes for this detoxification include the monofunctional catalases KatB and KatE and the bifunctional catalase-peroxidase KatG of DC3000. This study shows that KatG is the major housekeeping catalase of DC3000 and provides protection against menadione-generated endogenous H2O2. In contrast, KatB rapidly and substantially accumulates in response to exogenous H2O2. Furthermore, KatB and KatG have nonredundant roles in detoxifying exogenous H2O2 and are required for full virulence of DC3000 in Arabidopsis thaliana. Therefore, the nonredundant ability of KatB and KatG to detoxify plant-produced H2O2 is essential for the bacteria to survive in plants. Indeed, a DC3000 catalase triple mutant is severely compromised in its ability to grow in planta, and its growth can be partially rescued by the expression of katB, katE, or katG. Interestingly, our data demonstrate that although KatB and KatG are the major catalases involved in the virulence of DC3000, KatE can also provide some protection in planta. Thus, our results indicate that these catalases are virulence factors for DC3000 and are collectively required for pathogenesis. PMID:22797762

Intelligent Energy Management System for PV-Battery-based Microgrids in Future DC Homes

Science.gov (United States)

Chauhan, R. K.; Rajpurohit, B. S.; Gonzalez-Longatt, F. M.; Singh, S. N.

2016-06-01

This paper presents a novel intelligent energy management system (IEMS) for a DC microgrid connected to the public utility (PU), photovoltaic (PV) and multi-battery bank (BB). The control objectives of the proposed IEMS system are: (i) to ensure the load sharing (according to the source capacity) among sources, (ii) to reduce the power loss (high efficient) in the system, and (iii) to enhance the system reliability and power quality. The proposed IEMS is novel because it follows the ideal characteristics of the battery (with some assumptions) for the power sharing and the selection of the closest source to minimize the power losses. The IEMS allows continuous and accurate monitoring with intelligent control of distribution system operations such as battery bank energy storage (BBES) system, PV system and customer utilization of electric power. The proposed IEMS gives the better operational performance for operating conditions in terms of load sharing, loss minimization, and reliability enhancement of the DC microgrid.

Push-pull with recovery stage high-voltage DC converter for PV solar generator

Science.gov (United States)

Nguyen, The Vinh; Aillerie, Michel; Petit, Pierre; Pham, Hong Thang; Vo, Thành Vinh

2017-02-01

A lot of systems are basically developed on DC-DC or DC-AC converters including electronic switches such as MOS or bipolar transistors. The limits of efficiency are quickly reached when high output voltages and high input currents are needed. This work presents a new high-efficiency-high-step-up based on push-pull DC-DC converter integrating recovery stages dedicated to smart HVDC distributed architecture in PV solar energy production systems. Appropriate duty cycle ratio assumes that the recovery stage work with parallel charge and discharge to achieve high step-up voltage gain. Besides, the voltage stress on the main switch is reduced with a passive clamp circuit and thus, low on-state resistance Rdson of the main switch can be adopted to reduce conduction losses. Thus, the efficiency of a basic DC-HVDC converter dedicated to renewable energy production can be further improved with such topology. A prototype converter is developed, and experimentally tested for validation.

Comparison of solar panel cooling system by using dc brushless fan and dc water

International Nuclear Information System (INIS)

Irwan, Y M; Leow, W Z; Irwanto, M; M, Fareq; Hassan, S I S; Amelia, A R; Safwati, I

2015-01-01

The purpose of this article is to discuss comparison of solar panel cooling system by using DC brushless fan and DC water pump. Solar photovoltaic (PV) power generation is an interesting technique to reduce non-renewable energy consumption and as a renewable energy. The temperature of PV modules increases when it absorbs solar radiation, causing a decrease in efficiency. A solar cooling system is design, construct and experimentally researched within this work. To make an effort to cool the PV module, Direct Current (DC) brushless fan and DC water pump with inlet/outlet manifold are designed for constant air movement and water flow circulation at the back side and front side of PV module representatively. Temperature sensors were installed on the PV module to detect temperature of PV. PIC microcontroller was used to control the DC brushless fan and water pump for switch ON or OFF depend on the temperature of PV module automatically. The performance with and without cooling system are shown in this experiment. The PV module with DC water pump cooling system increase 3.52%, 36.27%, 38.98%in term of output voltage, output current, output power respectively. It decrease 6.36 °C compare than to PV module without DC water pump cooling system. While DC brushless fan cooling system increase 3.47%, 29.55%, 32.23%in term of output voltage, output current, and output power respectively. It decrease 6.1 °C compare than to PV module without DC brushless fan cooling system. The efficiency of PV module with cooling system was increasing compared to PV module without cooling system; this is because the ambient temperature dropped significantly. The higher efficiency of PV cell, the payback period of the system can be shorted and the lifespan of PV module can also be longer. (paper)

Host-plant-mediated effects of Nadefensin on herbivore and pathogen resistance in Nicotiana attenuata

Directory of Open Access Journals (Sweden)

Baldwin Ian T

2008-10-01

Full Text Available Abstract Background The adage from Shakespeare, "troubles, not as single spies, but in battalions come," holds true for Nicotiana attenuata, which is commonly attacked by both pathogens (Pseudomonas spp. and herbivores (Manduca sexta in its native habitats. Defense responses targeted against the pathogens can directly or indirectly influence the responses against the herbivores. Nadefensin is an effective induced defense gene against the bacterial pathogen Pseudomonas syringae pv tomato (PST DC3000, which is also elicited by attack from M. sexta larvae, but whether this defense protein influences M. sexta's growth and whether M. sexta-induced Nadefensin directly or indirectly influences PST DC3000 resistance are unknown. Results M. sexta larvae consumed less on WT and on Nadefensin-silenced N. attenuata plants that had previously been infected with PST DC3000 than on uninfected plants. WT plants infected with PST DC3000 showed enhanced resistance to PST DC3000 and decreased leaf consumption by M. sexta larvae, but larval mass gain was unaffected. PST DC3000-infected Nadefensin-silenced plants were less resistant to subsequent PST DC3000 challenge, and on these plants, M. sexta larvae consumed less and gained less mass. WT and Nadefensin-silenced plants previously damaged by M. sexta larvae were better able to resist subsequent PST DC3000 challenges than were undamaged plants. Conclusion These results demonstrate that Na-defensin directly mediates defense against PST DC3000 and indirectly against M. sexta in N. attenuata. In plants that were previously infected with PST DC3000, the altered leaf chemistry in PST DC3000-resistant WT plants and PST DC3000-susceptible Nadefensin-silenced plants differentially reduced M. sexta's leaf consumption and mass gain. In plants that were previously damaged by M. sexta, the combined effect of the altered host plant chemistry and a broad spectrum of anti-herbivore induced metabolomic responses was more

SlBIR3 Negatively Regulates PAMP Responses and Cell Death in Tomato

Directory of Open Access Journals (Sweden)

Shuhua Huang

2017-09-01

Full Text Available Bri1-associated kinase 1 (BAK1-interacting receptor-like kinase (BIR proteins have been shown to play important roles in regulating growth and development, pathogen associated molecular pattern (PAMP-triggered immunity (PTI responses, and cell death in the model plant, Arabidopsis thaliana. We identified four BIR family members in tomato (Solanum lycopersicum, including SlBIR3, an ortholog of AtBIR3 from A. thaliana. SlBIR3 is predicted to encode a membrane localized non-arginine-aspartate (non-RD kinase that, based on protein sequence, does not have autophosphorylation activity but that can be phosphorylated in vivo. We established that SlBIR3 interacts with SlBAK1 and AtBAK1 using yeast two-hybrid assays and co-immunoprecipitation and maltose-binding protein pull down assays. We observed that SlBIR3 overexpression in tomato (cv. micro-tom and A. thaliana has weak effect on growth and development through brassinosteroid (BR signaling. SlBIR3 overexpression in A. thaliana suppressed flg22-induced defense responses, but did not affect infection with the bacterial pathogen Pseudomonas syringae (PstDC3000. This result was confirmed using virus-induced gene silencing (VIGS in tomato in conjunction with PstDC3000 infection. Overexpression of SlBIR3 in tomato (cv. micro-tom and A. thaliana resulted in enhanced susceptibility to the necrotrophic fungus Botrytis cinerea. In addition, co-silencing SlBIR3 with SlSERK3A or SlSERK3B using VIGS and the tobacco rattle virus (TRV-RNA2 vector containing fragments of both the SlSERK3 and SlBIR3 genes induced spontaneous cell death, indicating a cooperation between the two proteins in this process. In conclusion, our study revealed that SlBIR3 is the ortholog of AtBIR3 and that it participates in BR, PTI, and cell death signaling pathways.

E-2-hexenal promotes susceptibility to Pseudomonas syringae by activating jasmonic acid pathways in Arabidopsis

Directory of Open Access Journals (Sweden)

Alessandra eScala

2013-04-01

Full Text Available Green Leaf Volatiles (GLVs are C6-molecules - alcohols, aldehydes and esters - produced by plants upon herbivory or during pathogen infection. Exposure to this blend of volatiles induces defence-related responses in neighboring undamaged plants, thus assigning a role to GLVs in regulating plant defences. Here we compared Arabidopsis thaliana ecotype Ler with a hydroperoxide lyase line, hpl1, unable to synthesize GLVs, for susceptibility to Pseudomonas syringae pv. tomato (DC3000. We found that the growth of DC3000 was significantly reduced in the hpl1 mutant. This phenomenon correlated with lower jasmonic acid (JA levels and higher salicylic acid (SA levels in the hpl1 mutant. Furthermore, upon infection, the JA-responsive genes VSP2 and LEC were only slightly or not induced, respectively, in hpl1. This suggests that the reduced growth of DC3000 in hpl1 plants is due to the constraint of JA-dependent responses. Treatment of hpl1 plants with E-2-hexenal, one of the more reactive GLVs, prior to infection with DC3000, resulted in increased growth of DC3000 in hpl1, thus complementing this mutant. Interestingly, the growth of DC3000 also increased in Ler plants treated with E-2-hexenal. This stronger growth was not dependent on the JA-signaling component MYC2, but on ORA59, an integrator of JA and ethylene signaling pathways, and on the production of coronatine by DC3000. GLVs may have multiple effects on plant-pathogen interactions, in this case reducing resistance to P. syringae via JA and ORA59.

Switching coordination of distributed dc-dc converters for highly efficient photovoltaic power plants

Science.gov (United States)

Agamy, Mohammed; Elasser, Ahmed; Sabate, Juan Antonio; Galbraith, Anthony William; Harfman Todorovic, Maja

2014-09-09

A distributed photovoltaic (PV) power plant includes a plurality of distributed dc-dc converters. The dc-dc converters are configured to switch in coordination with one another such that at least one dc-dc converter transfers power to a common dc-bus based upon the total system power available from one or more corresponding strings of PV modules. Due to the coordinated switching of the dc-dc converters, each dc-dc converter transferring power to the common dc-bus continues to operate within its optimal efficiency range as well as to optimize the maximum power point tracking in order to increase the energy yield of the PV power plant.

The plant pathogen Pseudomonas syringae pv. tomato is genetically monomorphic and under strong selection to evade tomato immunity.

Directory of Open Access Journals (Sweden)

Rongman Cai

2011-08-01

Full Text Available Recently, genome sequencing of many isolates of genetically monomorphic bacterial human pathogens has given new insights into pathogen microevolution and phylogeography. Here, we report a genome-based micro-evolutionary study of a bacterial plant pathogen, Pseudomonas syringae pv. tomato. Only 267 mutations were identified between five sequenced isolates in 3,543,009 nt of analyzed genome sequence, which suggests a recent evolutionary origin of this pathogen. Further analysis with genome-derived markers of 89 world-wide isolates showed that several genotypes exist in North America and in Europe indicating frequent pathogen movement between these world regions. Genome-derived markers and molecular analyses of key pathogen loci important for virulence and motility both suggest ongoing adaptation to the tomato host. A mutational hotspot was found in the type III-secreted effector gene hopM1. These mutations abolish the cell death triggering activity of the full-length protein indicating strong selection for loss of function of this effector, which was previously considered a virulence factor. Two non-synonymous mutations in the flagellin-encoding gene fliC allowed identifying a new microbe associated molecular pattern (MAMP in a region distinct from the known MAMP flg22. Interestingly, the ancestral allele of this MAMP induces a stronger tomato immune response than the derived alleles. The ancestral allele has largely disappeared from today's Pto populations suggesting that flagellin-triggered immunity limits pathogen fitness even in highly virulent pathogens. An additional non-synonymous mutation was identified in flg22 in South American isolates. Therefore, MAMPs are more variable than expected differing even between otherwise almost identical isolates of the same pathogen strain.

Characterisation of the mgo operon in Pseudomonas syringae pv. syringae UMAF0158 that is required for mangotoxin production

Science.gov (United States)

2012-01-01

Background Mangotoxin is an antimetabolite toxin that is produced by strains of Pseudomonas syringae pv. syringae; mangotoxin-producing strains are primarily isolated from mango tissues with symptoms of bacterial apical necrosis. The toxin is an oligopeptide that inhibits ornithine N-acetyl transferase (OAT), a key enzyme in the biosynthetic pathway of the essential amino acids ornithine and arginine. The involvement of a putative nonribosomal peptide synthetase gene (mgoA) in mangotoxin production and virulence has been reported. Results In the present study, we performed a RT-PCR analysis, insertional inactivation mutagenesis, a promoter expression analysis and terminator localisation to study the gene cluster containing the mgoA gene. Additionally, we evaluated the importance of mgoC, mgoA and mgoD in mangotoxin production. A sequence analysis revealed an operon-like organisation. A promoter sequence was located upstream of the mgoB gene and was found to drive lacZ transcription. Two terminators were located downstream of the mgoD gene. RT-PCR experiments indicated that the four genes (mgoBCAD) constitute a transcriptional unit. This operon is similar in genetic organisation to those in the three other P. syringae pathovars for which complete genomes are available (P. syringae pv. syringae B728a, P. syringae pv. tomato DC3000 and P. syringae pv. phaseolicola 1448A). Interestingly, none of these three reference strains is capable of producing mangotoxin. Additionally, extract complementation resulted in a recovery of mangotoxin production when the defective mutant was complemented with wild-type extracts. Conclusions The results of this study confirm that mgoB, mgoC, mgoA and mgoD function as a transcriptional unit and operon. While this operon is composed of four genes, only the last three are directly involved in mangotoxin production. PMID:22251433

NH4+ protects tomato plants against Pseudomonas syringae by activation of systemic acquired acclimation.

Science.gov (United States)

Fernández-Crespo, Emma; Scalschi, Loredana; Llorens, Eugenio; García-Agustín, Pilar; Camañes, Gemma

2015-11-01

NH4 (+) nutrition provokes mild toxicity by enhancing H2O2 accumulation, which acts as a signal activating systemic acquired acclimation (SAA). Until now, induced resistance mechanisms in response to an abiotic stimulus and related to SAA were only reported for exposure to a subsequent abiotic stress. Herein, the first evidence is provided that this acclimation to an abiotic stimulus induces resistance to later pathogen infection, since NH4 (+) nutrition (N-NH4 (+))-induced resistance (NH4 (+)-IR) against Pseudomonas syringae pv tomato DC3000 (Pst) in tomato plants was demonstrated. N-NH4 (+) plants displayed basal H2O2, abscisic acid (ABA), and putrescine (Put) accumulation. H2O2 accumulation acted as a signal to induce ABA-dependent signalling pathways required to prevent NH4 (+) toxicity. This acclimatory event provoked an increase in resistance against later pathogen infection. N-NH4 (+) plants displayed basal stomatal closure produced by H2O2 derived from enhanced CuAO and rboh1 activity that may reduce the entry of bacteria into the mesophyll, diminishing the disease symptoms as well as strongly inducing the oxidative burst upon Pst infection, favouring NH4 (+)-IR. Experiments with inhibitors of Put accumulation and the ABA-deficient mutant flacca demonstrated that Put and ABA downstream signalling pathways are required to complete NH4 (+)-IR. The metabolic profile revealed that infected N-NH4 (+) plants showed greater ferulic acid accumulation compared with control plants. Although classical salicylic acid (SA)-dependent responses against biotrophic pathogens were not found, the important role of Put in the resistance of tomato against Pst was demonstrated. Moreover, this work revealed the cross-talk between abiotic stress acclimation (NH4 (+) nutrition) and resistance to subsequent Pst infection. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Interplay of Pathogen-Induced Defense Responses and Symbiotic Establishment in Medicago truncatula

Directory of Open Access Journals (Sweden)

Tao Chen

2017-05-01

Full Text Available Suppression of host innate immunity appears to be required for the establishment of symbiosis between rhizobia and host plants. In this study, we established a system that included a host plant, a bacterial pathogen and a symbiotic rhizobium to study the role of innate immunity during symbiotic interactions. A pathogenic bacterium, Pseudomonas syringae pv. tomato strain DC3000 (Pst DC3000, was shown to cause chlorosis in Medicago truncatula A17. Sinorhizobium meliloti strain Sm2011 (Sm2011 and Pst DC3000 strain alone induced similar defense responses in M. truncatula. However, when co-inoculated, Sm2011 specifically suppressed the defense responses induced by Pst DC3000, such as MAPK activation and ROS production. Inoculation with Sm2011 suppressed the transcription of defense-related genes triggered by Pst DC3000 infection, including the receptor of bacterial flagellin (FLS2, pathogenesis-related protein 10 (PR10, and the transcription factor WRKY33. Interestingly, inoculation with Pst DC3000 specifically inhibited the expression of the symbiosis marker genes nodule inception and nodulation pectate lyase and reduced the numbers of infection threads and nodules on M. truncatula A17 roots, indicating that Pst DC3000 inhibits the establishment of symbiosis in M. truncatula. In addition, defense-related genes, such as MAPK3/6, RbohC, and WRKY33, exhibited a transient increase in their expression in the early stage of symbiosis with Sm2011, but the expression dropped down to normal levels at later symbiotic stages. Our results suggest that plant innate immunity plays an antagonistic role in symbiosis by directly reducing the numbers of infection threads and nodules.

Modeling, Analysis and Control of Different DC-DC Converter Topologies for Photo Voltaic Emulator

Directory of Open Access Journals (Sweden)

Mohammad Tauquir Iqbal

2016-05-01

Full Text Available This paper presents the modeling, analysis and control of different DC-DC converter topologies to emulate the photovoltaic (PV system. A PV emulator is basically a DC-DC converter having same electrical characteristics that of solar PV panel.  The emulator helps to achieve real characteristics of PV system in a better way in an environment where using actual PV systems can produce inconsistent results due to variation in weather conditions. The paper describes different types of DC-DC converters like buck, Resonant and Quasi Resonant Converter. The complete system is modelled in MATLAB® Simulink SimPowerSystem software package. The Simulation results obtained from the MATLAB® Simulink SimPowerSystem software package for different topologies under steady and dynamic conditions are analyzed and presented. An evaluation table is also presented at the end of the paper, presenting the effectiveness of each topology.

AtMIN7 mediated disease resistance to Pseudomonas syringae in Arabidopsis

Science.gov (United States)

He, Sheng Yang [Okemos, MI; Nomura, Kinya [East Lansing, MI

2011-07-26

The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein AtMIN7 mediated protection is enhanced and/or there is a decrease in activity of an AtMIN7 associated virulence protein such as a Pseudomonas syringae pv. tomato DC3000 HopM1. Reagents of the present invention provide a means of studying cellular trafficking while formulations of the present inventions provide increased pathogen resistance in plants.

Association mapping of main tomato fruit sugars and organic acids

Directory of Open Access Journals (Sweden)

Jiantao Zhao

2016-08-01

Full Text Available Association mapping has been widely used to map the significant associated loci responsible for natural variation in complex traits and are valuable for crop improvement. Sugars and organic acids are the most important metabolites in tomato fruits. We used a collection of 174 tomato accessions composed of S. lycopersicum (123 accessions and S. lycopersicum var cerasiforme (51 accessions to detect significantly associated loci controlling the variation of main sugars and organic acids. The accessions were genotyped with 182 SSRs spreading over the tomato genome. Association mapping was conducted on the main sugars and organic acids detected by gas chromatography-mass spectrometer (GC-MS over two years using the mixed linear model (MLM. We detected a total of 58 significantly associated loci (P<0.001 for the 17 sugars and organic acids, including fructose, glucose, sucrose, citric acid, malic acid. These results not only co-localized with several reported QTLs, including fru9.1/PV, suc9.1/PV, ca2.1/HS, ca3.1/PV, ca4.1/PV and ca8.1/PV, but also provided a list of candidate significantly associated loci to be functionally validated. These significantly associated loci could be used for deciphering the genetic architecture of tomato fruit sugars and organic acids and for tomato quality breeding.

A compact seven switches topology and reduced DC-link capacitor size for single-phase stand-alone PV system with hybrid energy storages

DEFF Research Database (Denmark)

Liu, Xiong; Wang, Peng; Loh, Poh Chiang

2011-01-01

Single-phase stand-alone PV system is suitable for household applications in remote area. Hybrid battery/ultra-capacitor energy storage can reduce charge and discharge cycles and avoid deep discharges of battery. This paper proposes a compact seven switches structure for stand-alone PV system......, which otherwise needs nine switches configuration, inclusive of one switch for boost converter, four switches for single-phase inverter and four switches for two DC/DC converters of battery and ultra-capacitor. It is well-known that a bulky DC-link capacitor is always required to absorb second......-order harmonic current caused by single-phase inverter. In the proposed compact topology, a small size DC-link capacitor can achieve the same function through charging/discharging control of ultra-capacitor to mitigate second-order ripple current. Simulation results are provided to validate the effectiveness...

Integrating DC/DC Conversion with Possible Reconfiguration within Submodule Solar Photovoltaic Systems

Science.gov (United States)

Huang, Peter Jen-Hung

This research first proposes a method to merge photovoltaic (PV) cells or PV panels within the internal components DC-DC converters. The purpose of this merged structure is to reconfigure the PV modules between series and parallel connections using high switching frequencies (hundreds of kHz). This leads to multi-levels of voltages and currents that become applied to the output filter of the converter. Further, this research introduces a concept of a switching cell that utilizes the reconfiguration of series and parallel connections in DC-DC converters. The switching occurs at high switching frequency and the switches can be integrated to be within the solar panels or in between the solar cells. The concept is generalized and applied to basic buck and boost topologies. As examples of the new types of converters: reconfigurable PV-buck and PV-boost converter topologies are presented. It is also possible to create other reconfigurable power converters: non-isolated and isolated topologies. Analysis, simulation and experimental verification for the reconfigurable PV-buck and PV-boost converters are presented extensively to illustrate proof of concept. Benefits and drawbacks of the new approach are discussed. The second part of this research proposes to utilize the internal solar cell capacitance and internal solar module wire parasitic inductances to replace the input capacitor and filter inductor in boost derived DC-DC converters for energy harvesting applications. High switching frequency (MHz) hard switched and resonant boost converters are proposed. Their analysis, simulation and experimental prototypes are presented. A specific proof-of-concept application is especially tested for foldable PV panels, which are known for their high internal wire inductance. The experimental converters successfully boost solar module voltage without adding any external input capacitance or filter inductor. Benefits and drawbacks of new proposed PV submodule integrated boost

Application of Distributed DC/DC Electronics in Photovoltaic Systems

Science.gov (United States)

Kabala, Michael

In a typical residential, commercial or utility grade photovoltaic (PV) system, PV modules are connected in series and in parallel to form an array that is connected to a standard DC/AC inverter, which is then connected directly to the grid. This type of standard installation; however, does very little to maximize the energy output of the solar array if certain conditions exist. These conditions could include age, temperature, irradiance and other factors that can cause mismatch between PV modules in an array that severely cripple the output power of the system. Since PV modules are typically connected in series to form a string, the output of the entire string is limited by the efficiency of the weakest module. With PV module efficiencies already relatively low, it is critical to extract the maximum power out of each module in order to make solar energy an economically viable competitor to oil and gas. Module level DC/DC electronics with maximum power point (MPP) tracking solves this issue by decoupling each module from the string in order for the module to operate independently of the geometry and complexity of the surrounding system. This allows each PV module to work at its maximum power point by transferring the maximum power the module is able to deliver directly to the load by either boosting (stepping up) the voltage or bucking (stepping down) the voltage. The goal of this thesis is to discuss the development of a per-module DC/DC converter in order to maximize the energy output of a PV module and reduce the overall cost of the system by increasing the energy harvest.

HOPM1 mediated disease resistance to Pseudomonas syringae in Arabidopsis

Science.gov (United States)

He, Sheng Yang [Okemos, MI; Nomura, Kinya [East Lansing, MI

2011-11-15

The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein HopM1.sub.1-300 mediated protection is enhanced, such as increased protection to Pseudomonas syringae pv. tomato DC3000 HopM1 and/or there is an increase in activity of an ATMIN associated plant protection protein, such as ATMIN7. Reagents of the present invention further provide a means of studying cellular trafficking while formulations of the present inventions provide increased pathogen resistance in plants.

The role of autophagy in chloroplast degradation and chlorophagy in immune defenses during Pst DC3000 (AvrRps4 infection.

Directory of Open Access Journals (Sweden)

Junjian Dong

Full Text Available BACKGROUND: Chlorosis of leaf tissue normally observed during pathogen infection may result from the degradation of chloroplasts. There is a growing evidence to suggest that the chloroplast plays a significant role during pathogen infection. Although most degradation of the organelles and cellular structures in plants is mediated by autophagy, its role in chloroplast catabolism during pathogen infection is largely unknown. RESULTS: In this study, we investigated the function of autophagy in chloroplast degradation during avirulent Pst DC3000 (AvrRps4 infection. We examined the expression of defensive marker genes and suppression of bacterial growth using the electrolyte leakage assay in normal light (N and low light (L growing environments of wild-type and atg5-1 plants during pathogen treatment. Stroma-targeted GFP proteins (CT-GFP were observed with LysoTracker Red (LTR staining of autophagosome-like structures in the vacuole. The results showed that Arabidopsis expressed a significant number of small GFP-labeled bodies when infected with avirulent Pst DC3000 (AvrRps4. While barely detectable, there were small GFP-labeled bodies in plants with the CT-GFP expressing atg5-1 mutation. The results showed that chloroplast degradation depends on autophagy and this may play an important role in inhibiting pathogen growth. CONCLUSION: Autophagy plays a role in chloroplast degradation in Arabidopsis during avirulent Pst DC3000 (AvrRps4 infection. Autophagy dependent chloroplast degradation may be the primary source of reactive oxygen species (ROS as well as the pathogen-response signaling molecules that induce the defense response.

The Epl1 and Sm1 proteins from Trichoderma atroviride and Trichoderma virens differentially modulate systemic disease resistance against different life style pathogens in Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Miguel Angel eSalas-Marina

2015-02-01

Full Text Available Fungi belonging to the genus Trichoderma, commonly found in soil or colonizing plant roots, exert beneficial effects on plants, including the promotion of growth and the induction of resistance to disease. T. virens and T. atroviride secrete the proteins Sm1 and Epl1, respectively, which elicit local and systemic disease resistance in plants. In this work, we show that these fungi promote growth in tomato (Solanum lycopersicum plants. T. virens was more effective than T. atroviride in promoting biomass gain, and both fungi were capable of inducing systemic protection in tomato against Alternaria solani, Botrytis cinerea, and Pseudomonas syringae pv. tomato (Pst DC3000. Deletion (KO of epl1 in T. atroviride resulted in diminished systemic protection against A. solani and B. cinerea, whereas the T. virens sm1 KO strain was less effective in protecting tomato against Pst DC3000 and B. cinerea. Importantly, over-expression (OE of epl1 and sm1 led to an increase in disease resistance against all tested pathogens. Although the Trichoderma WT strains induced both systemic acquired resistance (SAR- and induced systemic resistance (ISR-related genes in tomato, inoculation of plants with OE and KO strains revealed that Epl1 and Sm1 play a minor role in the induction of these genes. However, we found that Epl1 and Sm1 induce the expression of a peroxidase and an α-dioxygenase encoding genes, respectively, which could be important for tomato protection by Trichoderma spp. Altogether, these observations indicate that colonization by beneficial and/or infection by pathogenic microorganisms dictates many of the outcomes in plants, which are more complex than previously thought.

Solar Photovoltaic DC Systems: Basics and Safety: Preprint

Energy Technology Data Exchange (ETDEWEB)

McNutt, Peter F [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sekulic, William R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Dreifuerst, Gary [Lawrence Livermore National Laboratory - retired

2018-04-02

Solar Photovoltaic (PV) systems are common and growing with 42.4 GW installed capacity in U.S. (almost 15 GW added in 2016). This paper will help electrical workers, and emergency responders understand the basic operating principles and hazards of PV DC arrays. We briefly discuss the following aspects of solar photovoltaic (PV) DC systems: the effects of solar radiation and temperature on output power; PV module testing standards; common system configurations; a simple PV array sizing example; NEC guidelines and other safety features; DC array commissioning, periodic maintenance and testing; arc-flash hazard potential; how electrical workers and emergency responders can and do work safely around PV arrays; do moonlight and artificial lighting pose a real danger; typical safe operating procedures; and other potential DC-system hazards to be aware of. We also present some statistics on PV DC array electrical incidents and injuries. Safe PV array operation is possible with a good understanding of PV DC arrays basics and having good safe operating procedures in place.

-3000 V dc bias Ti oxidation by inductively coupled plasma

International Nuclear Information System (INIS)

Valencia-Alvarado, R; Lopez-Callejas, R; Barocio, S R; Mercado-Cabrera, A; Pena-Eguiluz, R; Munoz-Castro, A E; De la Piedad-Beneitez, A; De la Rosa-Vazquez, J

2008-01-01

Broadening the outer oxidized layer of titanium by means of plasmas commands considerable interest in the biomedical research area due to its potential in human biocompatibility enhancement. Some early results of titanium substrate superficial oxidation experiments which have been conducted in a cylindrical vessel inductively coupled to a 13.56 MHz RF generator with a 500 W output are presented. The oxidation process was carried out in a 20 % oxygen and 80 % argon mixture at work pressures in the 5x10 -3 -1 mbar range, while the samples were dc biased down to -3000 V. The substrate temperature appears to be directly dependent on this voltage, reaching 685 deg. C at the maximum bias when a diffusive oxidation process gives rise to the TiO 2 and α-TiO rutile phases. These were characterized by means of x-ray diffraction and scanning electron microscopy revealing atomic percentage concentrations of oxygen, with respect to those of titanium, between 68 and 13 at.%. The optimum modified layer depth reached 5 μm at a 5x10 -2 mbar work pressure.

Riboflavin-Induced Disease Resistance Requires the Mitogen-Activated Protein Kinases 3 and 6 in Arabidopsis thaliana.

Science.gov (United States)

Nie, Shengjun; Xu, Huilian

2016-01-01

As a resistance elicitor, riboflavin (vitamin B2) protects plants against a wide range of pathogens. At molecular biological levels, it is important to elucidate the signaling pathways underlying the disease resistance induced by riboflavin. Here, riboflavin was tested to induce resistance against virulent Pseudomonas syringae pv. Tomato DC3000 (Pst DC3000) in Arabidopsis. Results showed that riboflavin induced disease resistance based on MAPK-dependent priming for the expression of PR1 gene. Riboflavin induced transient expression of PR1 gene. However, following Pst DC3000 inoculation, riboflavin potentiated stronger PR1 gene transcription. Further was suggested that the transcript levels of mitogen-activated protein kinases, MPK3 and MPK6, were primed under riboflavin. Upon infection by Pst DC3000, these two enzymes were more strongly activated. The elevated activation of both MPK3 and MPK6 was responsible for enhanced defense gene expression and resistance after riboflavin treatment. Moreover, riboflavin significantly reduced the transcript levels of MPK3 and MPK6 by application of AsA and BAPTA, an H2O2 scavenger and a calcium (Ca2+) scavenger, respectively. In conclusion, MPK3 and MPK6 were responsible for riboflavin-induced resistance, and played an important role in H2O2- and Ca2+-related signaling pathways, and this study could provide a new insight into the mechanistic study of riboflavin-induced defense responses.

Defence responses of arabidopsis thaliana to infection by pseudomonas syringae are regulated by the circadian clock

KAUST Repository

Bhardwaj, Vaibhav

2011-10-31

The circadian clock allows plants to anticipate predictable daily changes in abiotic stimuli, such as light; however, whether the clock similarly allows plants to anticipate interactions with other organisms is unknown. Here we show that Arabidopsis thaliana (Arabidopsis) has circadian clock-mediated variation in resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), with plants being least susceptible to infection in the subjective morning. We suggest that the increased resistance to Pst DC3000 observed in the morning in Col-0 plants results from clock-mediated modulation of pathogen associated molecular pattern (PAMP)-triggered immunity. Analysis of publicly available microarray data revealed that a large number of Arabidopsis defence-related genes showed both diurnal- and circadian-regulation, including genes involved in the perception of the PAMP flagellin which exhibit a peak in expression in the morning. Accordingly, we observed that PAMP-triggered callose deposition was significantly higher in wild-type plants inoculated with Pst DC3000 hrpA in the subjective morning than in the evening, while no such temporal difference was evident in arrhythmic plants. Our results suggest that PAMP-triggered immune responses are modulated by the circadian clock and that temporal regulation allows plants to anticipate and respond more effectively to pathogen challenges in the daytime. © 2011 Bhardwaj et al.

High-Efficiency Photovoltaic System Using Partially-Connected DC-DC Converter

Science.gov (United States)

Uno, Masatoshi; Kukita, Akio; Tanaka, Koji

Power conversion electronics for photovoltaic (PV) systems are desired to operate as efficiently as possible to exploit the power generated by PV modules. This paper proposes a novel PV system in which a dc-dc converter is partially connected to series-connected PV modules. The proposed system achieves high power-conversion efficiency by reducing the passing power and input/output voltages of the converter. The theoretical operating principle was experimentally validated. Resultant efficiency performances of the proposed and conventional systems demonstrated that the proposed system was more efficient in terms of power conversion though the identical converter was used for the both systems.

Coronatine Facilitates Pseudomonas syringae Infection of Arabidopsis Leaves at Night

Science.gov (United States)

Panchal, Shweta; Roy, Debanjana; Chitrakar, Reejana; Price, Lenore; Breitbach, Zachary S.; Armstrong, Daniel W.; Melotto, Maeli

2016-01-01

In many land plants, the stomatal pore opens during the day and closes during the night. Thus, periods of darkness could be effective in decreasing pathogen penetration into leaves through stomata, the primary sites for infection by many pathogens. Pseudomonas syringae pv. tomato (Pst) DC3000 produces coronatine (COR) and opens stomata, raising an intriguing question as to whether this is a virulence strategy to facilitate bacterial infection at night. In fact, we found that (a) biological concentration of COR is effective in opening dark-closed stomata of Arabidopsis thaliana leaves, (b) the COR defective mutant Pst DC3118 is less effective in infecting Arabidopsis in the dark than under light and this difference in infection is reduced with the wild type bacterium Pst DC3000, and (c) cma, a COR biosynthesis gene, is induced only when the bacterium is in contact with the leaf surface independent of the light conditions. These findings suggest that Pst DC3000 activates virulence factors at the pre-invasive phase of its life cycle to infect plants even when environmental conditions (such as darkness) favor stomatal immunity. This functional attribute of COR may provide epidemiological advantages for COR-producing bacteria on the leaf surface. PMID:27446113

Coronatine Facilitates Pseudomonas syringae Infection of Arabidopsis Leaves at Night.

Science.gov (United States)

Panchal, Shweta; Roy, Debanjana; Chitrakar, Reejana; Price, Lenore; Breitbach, Zachary S; Armstrong, Daniel W; Melotto, Maeli

2016-01-01

In many land plants, the stomatal pore opens during the day and closes during the night. Thus, periods of darkness could be effective in decreasing pathogen penetration into leaves through stomata, the primary sites for infection by many pathogens. Pseudomonas syringae pv. tomato (Pst) DC3000 produces coronatine (COR) and opens stomata, raising an intriguing question as to whether this is a virulence strategy to facilitate bacterial infection at night. In fact, we found that (a) biological concentration of COR is effective in opening dark-closed stomata of Arabidopsis thaliana leaves, (b) the COR defective mutant Pst DC3118 is less effective in infecting Arabidopsis in the dark than under light and this difference in infection is reduced with the wild type bacterium Pst DC3000, and (c) cma, a COR biosynthesis gene, is induced only when the bacterium is in contact with the leaf surface independent of the light conditions. These findings suggest that Pst DC3000 activates virulence factors at the pre-invasive phase of its life cycle to infect plants even when environmental conditions (such as darkness) favor stomatal immunity. This functional attribute of COR may provide epidemiological advantages for COR-producing bacteria on the leaf surface.

PV installations, protection and the code

Energy Technology Data Exchange (ETDEWEB)

Silecky, L. [Mersen, Toronto, ON (Canada)

2010-12-15

This article discussed the need for improved standards in Ontario's solar industry to ensure safety for the systems and also safety for the workers. Photovoltaic cells used in solar arrays can now deliver between 50 vDC to 600 vDC. The workings of such a high voltage photocell must be understood in order to understand its protection needs. Since PVs are semiconductors and susceptible to damage from short circuits and overloads, a fast-acting overcurrent protective device (OCPD) should be used. Combiner boxes are also needed to provide a clean method of safely connecting all the wires that are needed in the system, including surge protection and a means of isolation between the PV array and the inverter. Section 50 of the Canadian Electrical Code outlines the requirements for solar PV systems, but it does not mention the protection of DC circuits, including DC fuse protectors which are manufactured to provide a high degree of protection for the PV array. As the photovoltaic (PV) market continues to grow in Ontario, the PV industry also has a responsibility to ensure it is in compliance with codes and standards related to photovoltaic systems. This author suggested that Article 690 of the National Electric Code (NEC) is a good document to use when determining the requirements for PV systems. 3 figs.

Firefighter Safety for PV Systems

DEFF Research Database (Denmark)

Mathe, Laszlo; Sera, Dezso; Spataru, Sergiu

2015-01-01

An important and highly discussed safety issue for photovoltaic (PV) systems is that as long as the PV panels are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters that is independent of the state of the inverter's dc disconnection switch...

Reliability evaluation of an impedance-source PV microconverter

DEFF Research Database (Denmark)

Shen, Yanfeng; Liivik, Elizaveta; Blaabjerg, Frede

2018-01-01

The reliability of an impedance-source PV microconverter is evaluated based on the real-field mission profile. As part of a PV microinverter, the dc-dc microconverter is firstly described. Then the electro-thermal and lifetime models are built for the most reliability-critical components, i...

Water Extract from Spent Mushroom Substrate of Hericium erinaceus Suppresses Bacterial Wilt Disease of Tomato

Science.gov (United States)

Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop

2015-01-01

Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048

Virulence of Pseudomonas syringae pv. tomato DC3000 is modulated through the Catabolite Repression Control protein Crc

Science.gov (United States)

Pseudomonas syringae (P.s.) infects diverse plant species and several P.s. pathovars have been used in the study of molecular events that occur during plant-microbe interactions. Although the relationship between bacterial metabolism, nutrient acquisition and virulence has attracted increasing atten...

Methods for the Optimal Design of Grid-Connected PV Inverters

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2011-01-01

and the efficient processing of this power by the DC/AC inverter. In this paper two new methods are presented for the optimal design of a PV inverter power section, output filter and MPPT control strategy. The influences of the electric grid regulations and standards as well as the PV array operational......The DC/AC inverters are used in grid-connected PV energy production systems as the power processing interface between the PV energy source and the electric grid. The energy injected into the electric grid by the PV installation depends on the amount of power extracted from the PV power source...

Methodology for assessment of characteristics of PV water pumping systems using a DC power supply; Metodologia de levantamento de caracteristicas de sistemas fotovoltaicos de bombeamento d'agua utilizando fonte de alimentacao CC

Energy Technology Data Exchange (ETDEWEB)

Vilela, Olga de Castro; Fraidenraich, Naum [Universidade Federal de Pernambuco (FAE/DEN/UFPE), Recife, PE (Brazil). Grupo de Fontes Alternativas de Energia. Dept. de Energia Nuclear], Emails: ocv@ufpe.br, nf@ufpe.br; Galdino, Marco Antonio [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)], E-mail: marcoag@cepel.br

2010-07-01

This article describes a methodology which was used to reduce the time required to perform experimental assessment of characteristic curves (flowrate vs. solar irradiance) of PV water pumping systems showing different configurations. The characteristic curves are proposed to be obtained from two other types of curves: flowrate vs. DC power - measured using a DC power supply adjusted to simulate the operation of the PV panel in the system, and DC power vs. solar irradiance - obtained through outdoors measurements using PV panels. It is demonstrated how is possible to reduce the number of days of outdoor measurements necessary for obtaining these curves when the systems under test show configurations using the same pumping heights or the same PV panels. The flowrates, thus also the daily pumped volumes, calculated using the curves obtained through this methodology are considered the upper limits of system performance. (author)

Real time expression of ACC oxidase and PR-protein genes mediated by Methylobacterium spp. in tomato plants challenged with Xanthomonas campestris pv. vesicatoria.

Science.gov (United States)

Yim, W J; Kim, K Y; Lee, Y W; Sundaram, S P; Lee, Y; Sa, T M

2014-07-15

Biotic stress like pathogenic infection increases ethylene biosynthesis in plants and ethylene inhibitors are known to alleviate the severity of plant disease incidence. This study aimed to reduce the bacterial spot disease incidence in tomato plants caused by Xanthomonas campestris pv. vesicatoria (XCV) by modulating stress ethylene with 1-aminocyclopropane-1-carboxylate (ACC) deaminase activity of Methylobacterium strains. Under greenhouse condition, Methylobacterium strains inoculated and pathogen challenged tomato plants had low ethylene emission compared to pathogen infected ones. ACC accumulation and ACC oxidase (ACO) activity with ACO related gene expression increased in XCV infected tomato plants over Methylobacterium strains inoculated plants. Among the Methylobacterium spp., CBMB12 resulted lowest ACO related gene expression (1.46 Normalized Fold Expression), whereas CBMB20 had high gene expression (3.42 Normalized Fold Expression) in pathogen challenged tomato. But a significant increase in ACO gene expression (7.09 Normalized Fold Expression) was observed in the bacterial pathogen infected plants. In contrast, Methylobacterium strains enhanced β-1,3-glucanase and phenylalanine ammonia-lyase (PAL) enzyme activities in pathogen challenged tomato plants. The respective increase in β-1,3-glucanase related gene expressions due to CBMB12, CBMB15, and CBMB20 strains were 66.3, 25.5 and 10.4% higher over pathogen infected plants. Similarly, PAL gene expression was high with 0.67 and 0.30 Normalized Fold Expression, in pathogen challenged tomato plants inoculated with CBMB12 and CBMB15 strains. The results suggest that ethylene is a crucial factor in bacterial spot disease incidence and that methylobacteria with ACC deaminase activity can reduce the disease severity with ultimate pathogenesis-related protein increase in tomato. Copyright © 2014 Elsevier GmbH. All rights reserved.

DC-DC Converter Topology Assessment for Large Scale Distributed Photovoltaic Plant Architectures

Energy Technology Data Exchange (ETDEWEB)

Agamy, Mohammed S; Harfman-Todorovic, Maja; Elasser, Ahmed; Sabate, Juan A; Steigerwald, Robert L; Jiang, Yan; Essakiappan, Somasundaram

2011-07-01

Distributed photovoltaic (PV) plant architectures are emerging as a replacement for the classical central inverter based systems. However, power converters of smaller ratings may have a negative impact on system efficiency, reliability and cost. Therefore, it is necessary to design converters with very high efficiency and simpler topologies in order not to offset the benefits gained by using distributed PV systems. In this paper an evaluation of the selection criteria for dc-dc converters for distributed PV systems is performed; this evaluation includes efficiency, simplicity of design, reliability and cost. Based on this evaluation, recommendations can be made as to which class of converters is best fit for this application.

Design and Analysis of Stepped DC Link Hybrid Converter for Solar PV Systems

Directory of Open Access Journals (Sweden)

R. Uthirasamy

2017-09-01

Full Text Available A structure of single phase DC Link Multilevel H-Bridge Inverter (DCLMLHBI is proposed for symmetrical Photo Voltaic (PV systems. Voltage stress across the inverter switches, Power Spectral Density (PSD, voltage and current harmonics are reduced in the proposed configuration. Compared with conventional 13-level Cascaded Multilevel Inverter (CMLI configuration, the proposed system configuration is structured with less number of series connected power switches and gate drive circuits. None of the passive components are utilized in the proposed inverter configuration, which highlight the significance of the proposed system. The performance parameters are investigated through Phase Opposition Pulse Width Modulation (POD-PWM switching scheme and its results are validated with computer simulation and prototype hardware models.

Background information to the installers guide for small scale mains connected PV

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

This report contains background information used by BRE, EA Technology, Halcrows and Sundog when compiling guidance for the UK's New and Renewable Energy Programme on the installation of small-scale photovoltaics (PV) in buildings. The report considers: relevant standards; general safety issues; fire and safety issues, including the fire resistance of PV modules; PV module ratings such as maximum voltage and maximum current; DC cabling; the DC disconnect; the DC junction box; fault analysis; general and AC side earthing; DC earthing; lightning and surge suppression; inverters; AC modules; AC systems; getting connection; mounting options; and installation issues.

Optimal Operation of Photovoltaic System with a DC-DC Boost Converter FED SAF Using ICosφ Algorithm

Directory of Open Access Journals (Sweden)

G.Vijayakumar

2014-07-01

Full Text Available This paper presents an optimal utilization of Photovoltaic (PV solar system based Shunt Active Filter (PV-SAF for harmonic mitigation, real and reactive power compensation at the point of common coupling (PCC throughout the day. This PV system operated SAF reduces the energy consumption by disconnecting the utility grid from the load through semiconductor switches, when the PV system generates excessive or equal real power to the required load demand. However, the reduction of energy consumption is always desirable for the reduction of panel tariff and global warming gasses. The PV module is connected to the DC side of SAF through the DC-DC converter with fuzzy based Perturb & Observe (P&O Maximum Power Point Tracking (MPPT algorithm to eliminate the drawback of the conventional PV system by tracking maximum power point of the PV array is presented. The reference currents extract by the Fuzzy logic controller based ICosΦ control strategy. This proposed PV-SAF, if connected at the terminals of a small industry or a home or a small enlightening institution can avoid interruptible power supply, use of individual stabilizer and potential panel tariff over a 12 hour period. A MATLAB simulink is presented to validate the advantage of the proposed system.

Next-generation systemic acquired resistance.

Science.gov (United States)

Luna, Estrella; Bruce, Toby J A; Roberts, Michael R; Flors, Victor; Ton, Jurriaan

2012-02-01

Systemic acquired resistance (SAR) is a plant immune response to pathogen attack. Recent evidence suggests that plant immunity involves regulation by chromatin remodeling and DNA methylation. We investigated whether SAR can be inherited epigenetically following disease pressure by Pseudomonas syringae pv tomato DC3000 (PstDC3000). Compared to progeny from control-treated Arabidopsis (Arabidopsis thaliana; C(1)), progeny from PstDC3000-inoculated Arabidopsis (P(1)) were primed to activate salicylic acid (SA)-inducible defense genes and were more resistant to the (hemi)biotrophic pathogens Hyaloperonospora arabidopsidis and PstDC3000. This transgenerational SAR was sustained over one stress-free generation, indicating an epigenetic basis of the phenomenon. Furthermore, P(1) progeny displayed reduced responsiveness of jasmonic acid (JA)-inducible genes and enhanced susceptibility to the necrotrophic fungus Alternaria brassicicola. This shift in SA- and JA-dependent gene responsiveness was not associated with changes in corresponding hormone levels. Instead, chromatin immunoprecipitation analyses revealed that SA-inducible promoters of PATHOGENESIS-RELATED GENE1, WRKY6, and WRKY53 in P(1) plants are enriched with acetylated histone H3 at lysine 9, a chromatin mark associated with a permissive state of transcription. Conversely, the JA-inducible promoter of PLANT DEFENSIN1.2 showed increased H3 triple methylation at lysine 27, a mark related to repressed gene transcription. P(1) progeny from the defense regulatory mutant non expressor of PR1 (npr1)-1 failed to develop transgenerational defense phenotypes, demonstrating a critical role for NPR1 in expression of transgenerational SAR. Furthermore, the drm1drm2cmt3 mutant that is affected in non-CpG DNA methylation mimicked the transgenerational SAR phenotype. Since PstDC3000 induces DNA hypomethylation in Arabidopsis, our results suggest that transgenerational SAR is transmitted by hypomethylated genes that direct priming

Rhizosphere-associated Pseudomonas induce systemic resistance to herbivores at the cost of susceptibility to bacterial pathogens.

Science.gov (United States)

Haney, Cara H; Wiesmann, Christina L; Shapiro, Lori R; Melnyk, Ryan A; O'Sullivan, Lucy R; Khorasani, Sophie; Xiao, Li; Han, Jiatong; Bush, Jenifer; Carrillo, Juli; Pierce, Naomi E; Ausubel, Frederick M

2017-10-31

Plant-associated soil microbes are important mediators of plant defence responses to diverse above-ground pathogen and insect challengers. For example, closely related strains of beneficial rhizosphere Pseudomonas spp. can induce systemic resistance (ISR), systemic susceptibility (ISS) or neither against the bacterial foliar pathogen Pseudomonas syringae pv. tomato DC3000 (Pto DC3000). Using a model system composed of root-associated Pseudomonas spp. strains, the foliar pathogen Pto DC3000 and the herbivore Trichoplusia ni (cabbage looper), we found that rhizosphere-associated Pseudomonas spp. that induce either ISS and ISR against Pto DC3000 all increased resistance to herbivory by T. ni. We found that resistance to T. ni and resistance to Pto DC3000 are quantitative metrics of the jasmonic acid (JA)/salicylic acid (SA) trade-off and distinct strains of rhizosphere-associated Pseudomonas spp. have distinct effects on the JA/SA trade-off. Using genetic analysis and transcriptional profiling, we provide evidence that treatment of Arabidopsis with Pseudomonas sp. CH267, which induces ISS against bacterial pathogens, tips the JA/SA trade-off towards JA-dependent defences against herbivores at the cost of a subset of SA-mediated defences against bacterial pathogens. In contrast, treatment of Arabidopsis with the ISR strain Pseudomonas sp. WCS417 disrupts JA/SA antagonism and simultaneously primes plants for both JA- and SA-mediated defences. Our findings show that ISS against the bacterial foliar pathogens triggered by Pseudomonas sp. CH267, which is a seemingly deleterious phenotype, may in fact be an adaptive consequence of increased resistance to herbivory. Our work shows that pleiotropic effects of microbiome modulation of plant defences are important to consider when using microbes to modify plant traits in agriculture. © 2017 John Wiley & Sons Ltd.

Automatic fault diagnosis in PV systems with distributed MPPT

International Nuclear Information System (INIS)

Solórzano, J.; Egido, M.A.

2013-01-01

Highlights: • An automatic failure diagnosis procedure for PV systems with DMPPT is presented. • The different failures diagnosed and their effects on the PV systems are described. • No use of irradiance and temperature sensors decreasing the cost of the system. • Voltage and current analysis to diagnose different failures. • Hot-spots, localized dirt, shading, module degradation and cable losses diagnosis. - Abstract: This work presents a novel procedure for fault diagnosis in PV systems with distributed maximum power point tracking at module level—power optimizers (DC/DC) or micro-inverters (DC/AC). Apart from the power benefits obtained when an irregular irradiance distribution is present, this type of systems permit the monitoring of the PV plant parameters at the module level: voltage and current at the working power point. With these parameters, a prototype diagnosis tool has been developed in Matlab and it has been experimentally verified in a real rooftop PV generator by applying different failures. The tool can diagnose the following failures: fixed object shading (with distance estimation), localized dirt, generalized dirt, possible hot-spots, module degradation and excessive losses in DC cables. In addition, it alerts the user of the power losses produced by each failure and classifies the failures by their severity. This system does not require the use of irradiance or temperature sensors, except for the generalized dirt failure, reducing the cost of installation, especially important in small PV systems

TRNSYS HYBRID wind diesel PV simulator

Energy Technology Data Exchange (ETDEWEB)

Quinlan, P.J.A.; Mitchell, J.W.; Klein, S.A.; Beckman, W.A.; Blair, N.J. [Univ. of Wisconsin, Madison, WI (United States)

1996-12-31

The Solar Energy Laboratory (SEL) has developed a wind diesel PV hybrid systems simulator, UW-HYBRID 1.0, an application of the TRNSYS 14.2 time-series simulation environment. An AC/DC bus links up to five diesels and wind turbine models, along with PV modules, a battery bank, and an AC/DC converter. Multiple units can be selected. PV system simulations include solar angle and peak power tracking options. Weather data are Typical Meteorological Year data, parametrically generated synthesized data, or external data files. PV performance simulations rely on long-standing SEL-developed algorithms. Loads data are read as scalable time series. Diesel simulations include estimated fuel-use and waste heat output, and are dispatched using a least-cost of fuel strategy. Wind system simulations include varying air density, wind shear and wake effects. Time step duration is user-selectable. UW-HYBRID 1.0 runs in Windows{reg_sign}, with TRNSED providing a customizable user interface. 12 refs., 6 figs.

Differential modulation of plant immune responses by diverse members of the Pseudomonas savastanoi pv. savastanoi HopAF type III effector family.

Science.gov (United States)

Castañeda-Ojeda, M Pilar; López-Solanilla, Emilia; Ramos, Cayo

2017-06-01

The Pseudomonas savastanoi pv. savastanoi NCPPB 3335 type III secretion system (T3SS) effector repertoire includes 33 candidates, seven of which translocate into host cells and interfere with plant defences. The present study was performed to investigate the co-existence of both plasmid- and chromosomal-encoded members of the HopAF effector family, HopAF1-1 and HopAF1-2, respectively, in the genome of NCPPB 3335. Here, we show that the HopAF1 paralogues are widely distributed in the Pseudomonas syringae complex, where HopAF1-1 is most similar to the homologues encoded by other P. syringae pathovars infecting woody hosts that belong to phylogroups 1 and 3. We show that the expression of both HopAF1-1 and HopAF-2 is transcriptionally dependent on HrpL and demonstrate their delivery into Nicotiana tabacum leaves. Although the heterologous delivery of either HopAF1-1 or HopAF1-2 significantly suppressed the production of defence-associated reactive oxygen species levels, only HopAF1-2 reduced the levels of callose deposition. Moreover, the expression of HopAF1-2 by functionally effectorless P. syringae pv. tomato DC3000D28E completely inhibited the hypersensitive response in tobacco and significantly increased the competitiveness of the strain in Nicotiana benthamiana. Despite their functional differences, subcellular localization studies reveal that green fluorescent protein (GFP) fusions to either HopAF1-1 or HopAF1-2 are targeted to the plasma membrane when they are expressed in plant cells, a process that is completely dependent on the integrity of their N-myristoylation motif. Our results further support the notion that highly similar T3SS effectors might differentially interact with diverse plant targets, even when they co-localize in the same cell compartment. © 2016 BSPP AND JOHN WILEY & SONS LTD.

Design optimization of grid-connected PV inverters

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2011-01-01

The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....

Dynamic response evaluation of sensorless MPPT method for hybrid PV-DFIG wind turbine system

Directory of Open Access Journals (Sweden)

Danvu Nguyen

2016-01-01

Full Text Available This research proposes a sensorless Maximum Power Point Tracking (MPPT method for a hybrid Photovoltaic-Wind system, which consists of Photovoltaic (PV system and Doubly-Fed Induction Generator (DFIG Wind Turbine. In the hybrid system, the DC/DC converter output of the PV system is directly connected to the DC-link of DFIG’s back-to-back converter. Therefore, the PV inverter and its associated circuit can be removed in this structure. Typically, the PV power is monitored by using PV current sensor and PV voltage sensor for MPPT. In this paper, the powers of converters on grid side and rotor side of DFIG are used to estimate the PV power without the PV current sensor. That can efficiently reduce the cost of the hybrid system. The detailed analysis of the sensorless MPPT method, which includes derived equations and operation response, is also presented in this paper. In addition, an overview of PV-DFIG research in literature is stated to supply comprehensive knowledge of related research.

Performance evaluation of directly photovoltaic powered DC PM (direct current permanent magnet) motor – propeller thrust system

International Nuclear Information System (INIS)

Atlam, Ozcan; Kolhe, Mohan

2013-01-01

Photovoltaic (PV) powered directly coupled electro-mechanical system has wide applications (e.g. PV powered cooling fans in green houses, PV water pumping system, solar vehicles). The objective of this work is to analyse the operation of directly PV powered DC PM (direct current permanent magnet) motor – propeller system for selection of motor parameters. The performance of such system mainly depends on the incident solar radiation, operating cell temperature, DC motor and propeller load parameters. It is observed that the operating points of the PV DC PM motor – propeller system matches very closely with the maximum power points (MPPs) of the PV array, if the DC PM motor – propeller parameters have been properly selected. It is found that for a specific application of such type of system, matching of torque–speed operating points with respect to the maximum power points of PV array are very important. It is ascertained through results that the DC PM motor's armature resistance, magnetic field constant, starting current to overcome the starting torque and torque coefficient are the main parameters. In designing a PV powered DC PM motor for a specific application, selection of these parameters are important for maximum utilization of the PV array output. The results of this system are useful for designing of directly PV powered DC PM motor's for aerodynamic applications. - Highlights: • We analyse the performance of directly PV powered DC PM motor – propeller system. • We examine PV electro-mechanical system for selection of DC motor parameters. • Matching of torque–speed curve to maximum power points of PV array is important

Role of soil, crop debris, and a plant pathogen in Salmonella enterica contamination of tomato plants.

Directory of Open Access Journals (Sweden)

Jeri D Barak

Full Text Available BACKGROUND: In the U.S., tomatoes have become the most implicated vehicle for produce-associated Salmonellosis with 12 outbreaks since 1998. Although unconfirmed, trace backs suggest pre-harvest contamination with Salmonella enterica. Routes of tomato crop contamination by S. enterica in the absence of direct artificial inoculation have not been investigated. METHODOLOGY/PRINCIPAL FINDINGS: This work examined the role of contaminated soil, the potential for crop debris to act as inoculum from one crop to the next, and any interaction between the seedbourne plant pathogen Xanthomonas campestris pv. vesicatoria and S. enterica on tomato plants. Our results show S. enterica can survive for up to six weeks in fallow soil with the ability to contaminate tomato plants. We found S. enterica can contaminate a subsequent crop via crop debris; however a fallow period between crop incorporation and subsequent seeding can affect contamination patterns. Throughout these studies, populations of S. enterica declined over time and there was no bacterial growth in either the phyllosphere or rhizoplane. The presence of X. campestris pv. vesicatoria on co-colonized tomato plants had no effect on the incidence of S. enterica tomato phyllosphere contamination. However, growth of S. enterica in the tomato phyllosphere occurred on co-colonized plants in the absence of plant disease. CONCLUSIONS/SIGNIFICANCE: S. enterica contaminated soil can lead to contamination of the tomato phyllosphere. A six week lag period between soil contamination and tomato seeding did not deter subsequent crop contamination. In the absence of plant disease, presence of the bacterial plant pathogen, X. campestris pv. vesicatoria was beneficial to S. enterica allowing multiplication of the human pathogen population. Any event leading to soil contamination with S. enterica could pose a public health risk with subsequent tomato production, especially in areas prone to bacterial spot disease.

Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid

Directory of Open Access Journals (Sweden)

Mahmudreza Changizian

2017-11-01

Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.

Control of a Multi-Functional Inverter for Grid Integration of PV and Battery Energy Storage System

DEFF Research Database (Denmark)

Mousazadeh, Seyyed Yousef; Firoozabadi, Mehdi Savaghebi; Beirami, A.

2015-01-01

This paper presents a multi-functional control of a DC/AC inverter for Power Quality compensation of nonlinear and unequal local loads and grid integration of hybrid photovoltaic (PV) and battery energy storage systems. Multi-layer neural network estimator and a DC/DC converter are used for maximum...... is used for delivering desire power to the grid. For compensation aim, instantaneous active and reactive power theory (p-q) is used. Via the algorithm, the DC/AC inverter not only can be controlled to inject the power of battery and PV, but also it is used as shunt active filter for compensating unequal...... power point tracking (MPPT) of PV array. The power system is 3-phase 4-wires and the DC/AC inverter is chosen 4-leg three phase inverter which has good performance in presence of zero sequence components. Battery energy storage is connected to PV system in common DC bus and a power management strategy...

MPPT algorithm for voltage controlled PV inverters

DEFF Research Database (Denmark)

Kerekes, Tamas; Teodorescu, Remus; Liserre, Marco

2008-01-01

This paper presents a novel concept for an MPPT that can be used in case of a voltage controlled grid connected PV inverters. In case of single-phase systems, the 100 Hz ripple in the AC power is also present on the DC side. Depending on the DC link capacitor, this power fluctuation can be used t...... to track the MPP of the PV array, using the information that at MPP the power oscillations are very small. In this way the algorithm can detect the fact that the current working point is at the MPP, for the current atmospheric conditions....

A technological review on electric vehicle DC charging stations using photovoltaic sources

Science.gov (United States)

Youssef, Cheddadi; Fatima, Errahimi; najia, Es-sbai; Chakib, Alaoui

2018-05-01

Within the next few years, Electrified vehicles are destined to become the essential component of the transport field. Consequently, the charging infrastructure should be developed in the same time. Among this substructure, Charging stations photovoltaic-assisted are attracting a substantial interest due to increased environmental awareness, cost reduction and rise in efficiency of the PV modules. The intention of this paper is to review the technological status of Photovoltaic–Electric vehicle (PV-EV) charging stations during the last decade. The PV-EV charging station is divided into two categories, which are PV-grid and PV-standalone charging systems. From a practical point view, the distinction between the two architectures is the bidirectional inverter, which is added to link the station to the smart grid. The technological infrastructure includes the common hardware components of every station, namely: PV array, dc-dc converter provided with MPPT control, energy storage unit, bidirectional dc charger and inverter. We investigate, compare and evaluate many valuable researches that contain the design and control of PV-EV charging system. Additionally, this concise overview reports the studies that include charging standards, the power converters topologies that focus on the adoption of Vehicle-to grid technology and the control for both PV–grid and PV standalone DC charging systems.

Photovoltaic-wind hybrid system for permanent magnet DC motor

Science.gov (United States)

Nasir, M. N. M.; Lada, M. Y.; Baharom, M. F.; Jaafar, H. I.; Ramani, A. N.; Sulaima, M. F.

2015-05-01

Hybrid system of Photovoltaic (PV) - Wind turbine (WT) generation has more advantages and reliable compared to PV or wind turbine system alone. The aim of this paper is to model and design hybrid system of PV-WT supplying 100W permanent-magnet dc motor. To achieve the objective, both of PV and WT are connected to converter in order to get the same source of DC supply. Then both sources were combined and straightly connected to 100W permanent magnet dc motor. All the works in this paper is only applied in circuit simulator by using Matlab Simulink. The output produced from each converter is expected to be suit to the motor specification. The output produced from each renewable energy system is as expected to be high as it can support the motor if one of them is breakdown

Identification of a Candidate Gene in Solanum habrochaites for Resistance to a Race 1 Strain of Pseudomonas syringae pv. tomato

Directory of Open Access Journals (Sweden)

Zhilong Bao

2015-11-01

Full Text Available Bacterial speck disease caused by pv. ( is a persistent problem on tomato ( L.. Resistance against race 0 strains is conferred by the Pto protein, which recognizes either of two pathogen effectors: AvrPto or AvrPtoB. However, current tomato varieties do not have resistance to the increasingly common race 1 strains, which lack these effectors. We identified accessions of S. Knapp & D. M. Spooner that are resistant to the race 1 strain T1. Genome sequence comparisons of T1 and two strains that are virulent on these accessions suggested that known microbe-associated molecular patterns (MAMPs or effectors are not involved in the resistance. We developed an F population from a cross between one T1-resistant accession, LA2109, and a susceptible tomato cultivar to investigate the genetic basis of this resistance. Linkage analysis using whole-genome sequence of 58 F plants identified quantitative trait loci (QTL, , in a 5.8-Mb region on chromosome 2, and , in a 52.4-Mb region on chromosome 8, which account for 24 and 26% of the phenotypic variability, respectively. High-resolution mapping of confirmed it contributed to T1 resistance and delimited it to a 1060-kb region containing 139 genes, including three encoding receptor-like proteins (RLPs and 17 encoding receptor-like protein kinases (RLKs. One RLK gene, Solyc02g072470, is a promising candidate for , as it is highly expressed in LA2109 and induced on treatment with MAMPs. might be useful for enhancing resistance to race 1 strains and its future characterization could provide insights into the plant immune system.

Design of A Grid Integrated PV System with MPPT Control and Voltage Oriented Controller using MATLAB/PLECES

Science.gov (United States)

Soreng, Bineeta; Behera, Pradyumna; Pradhan, Raseswari

2017-08-01

This paper presents model of a grid-integrated photovoltaic array with Maximum Power Point Tracker (MPPT) and voltage oriented controller. The MPPT of the PV array is usually an essential part of PV system as MPPT helps the operating point of the solar array to align its maximum power point. In this model, the MPPT along with a DC-DC converter lets a PV generator to produce continuous power, despite of the measurement conditions. The neutral-point-clamped converter (NPC) with a boost converter raises the voltage from the panels to the DC-link. An LCL-filter smoothens the current ripple caused by the PWM modulation of the grid-side inverter. In addition to the MPPT, the system has two more two controllers, such as voltage controller and a current controller. The voltage control has a PI controller to regulate the PV voltage to optimal level by controlling the amount of current injected into the boost stage. Here, the grid-side converter transfers the power from the DC-link into the grid and maintains the DC-link voltage. Three-phase PV inverters are used for off-grid or designed to create utility frequency AC. The PV system can be connected in series or parallel to get the desired output power. To justify the working of this model, the grid-integrated PV system has been designed in MATLAB/PLECS. The simulation shows the P-V curve of implemented PV Array consisting 4 X 20 modules, reactive, real power, grid voltage and current.

A Fuzzy Logic Based Three phase Inverter with Single DC Source for Grid Connected PV System Employing Three Phase Transformer

OpenAIRE

Mani, venkatesan; Ramachandran, Rajeswari; N, Deverajan

2016-01-01

A fuzzy based three phase inverter with single DC source for grid connected photo voltaic (PV) system employing three phase transformer is presented in this paper. Space Vector Pulse Width Modulation (SVPWM) control scheme is effectively used to generate the appropriate switching sequences to the inverter switches. The intend of the fuzzy logic approach is to meet high quality output, fast response and high robustness. Finally Total Harmonics Distortion (THD) generated by the inverter is comp...

TOPOLOGICAL REVIEW AND ANALYSIS OF DC-DC BOOST CONVERTERS

Directory of Open Access Journals (Sweden)

V. INDRA GANDHI

2017-06-01

Full Text Available DC voltage boost up is essential in numerous applications; especially considering Photovoltaic (PV based renewable power generation system. The conventional DC-DC boost converter is the most admired configuration for this scheme, even if the converter efficiency is restricted at duty cycle near to maximum value. In order to find solution to the problem and improve its conversion capability, many converter configurations have been implemented so far. With this circumstance, this research work proposes to give overview of a few most imperative research works related to DC-DC boost converters. Some configurations are covered and classified basically based on the application. The major benefits and disadvantages related to the available techniques are also briefly conveyed. At last, a proper evaluation is recognized among the important types of DC-DC boost converters in terms of efficiency, number of components, and stability.

Use Conditions and Efficiency Measurements of DC Power Optimizers for Photovoltaic Systems: Preprint

Energy Technology Data Exchange (ETDEWEB)

Deline, C.; MacAlpine, S.

2013-10-01

No consensus standard exists for estimating annual conversion efficiency of DC-DC converters or power optimizers in photovoltaic (PV) applications. The performance benefits of PV power electronics including per-panel DC-DC converters depend in large part on the operating conditions of the PV system, along with the performance characteristics of the power optimizer itself. This work presents acase study of three system configurations that take advantage of the capabilities of DC power optimizers. Measured conversion efficiencies of DC-DC converters are applied to these scenarios to determine the annual weighted operating efficiency. A simplified general method of reporting weighted efficiency is given, based on the California Energy Commission's CEC efficiency rating and severalinput / output voltage ratios. Efficiency measurements of commercial power optimizer products are presented using the new performance metric, along with a description of the limitations of the approach.

MPPT algorithm test on a photovoltaic emulating system constructed by a DC power supply and an indoor solar panel

International Nuclear Information System (INIS)

Zhou, Z.; Holland, P.M.; Igic, P.

2014-01-01

Highlights: • A novel PV emulator is constructed by using conventional solar panels with a DC power supply. • The proposed PV emulator is cost-effectiveness, relatively easy implementation. • The proposed PV emulator avoids the bandwidth problem associated with electronics PV emulators. • Indoor testing of MPPT algorithms and power converters avoids the dependency on solar irradiation. • The PV emulating system has been used for testing a P and O MPPT algorithm and a boost dc converter. - Abstract: In this paper a novel photovoltaic (PV) emulating scheme for testing maximum power point tracking (MPPT) algorithms and PV inverters has been proposed. It is constructed by the parallel connection of conventional solar panels with a DC power supply operating in current source mode. The advantages of the proposed scheme are cost-effectiveness, relatively easy implementation and indoor testing of MPPT algorithms and power converters avoiding weather and time of day dependency on solar irradiation levels. Furthermore, the proposed PV emulator avoids the bandwidth problem associated with the dc converter based PV emulating systems. Detailed circuit connection, parameters, electrical characteristics and mathematical model of the PV emulator are presented and discussed. Proposed PV emulating system has been used to test a boost DC/DC converter controlled by Perturb and Observe (P and O) MPPT algorithm. Test results confirmed the effectiveness of the proposed PV emulation system and all achieved results correspond well to the original designed values

DC Home Appliances for DC Distribution System

Directory of Open Access Journals (Sweden)

MUHAMMAD KAMRAN

2017-10-01

Full Text Available This paper strengthens the idea of DC distribution system for DC microgrid consisting of a building of 50 apartments. Since the war of currents AC system has been dominant because of the paucity of research in the protection of the DC system. Now with the advance research in power electronics material and components, generation of electricity is inherently DC as by solar PV, fuel cell and thermoelectric generator that eliminates the rectification process. Transformers are replaced by the power electronics buck-boost converters. DC circuit breakers have solved the protection problems for both DC transmission and distribution system. In this paper 308V DC microgrid is proposed and home appliances (DC internal are modified to operate on 48V DC from DC distribution line. Instead of using universal and induction motors in rotary appliances, BLDC (Brushless DC motors are proposed that are highly efficient with minimum electro-mechanical and no commutation losses. Proposed DC system reduces the power conversion stages, hence diminishes the associated power losses and standby losses that boost the overall system efficiency. So in view of all this a conventional AC system can be replaced by a DC system that has many advantages by cost as well as by performance

Analysis of high voltage step-up nonisolated DC-DC boost converters

Science.gov (United States)

Alisson Alencar Freitas, Antônio; Lessa Tofoli, Fernando; Junior, Edilson Mineiro Sá; Daher, Sergio; Antunes, Fernando Luiz Marcelo

2016-05-01

A high voltage step-up nonisolated DC-DC converter based on coupled inductors suitable to photovoltaic (PV) systems applications is proposed in this paper. Considering that numerous approaches exist to extend the voltage conversion ratio of DC-DC converters that do not use transformers, a detailed comparison is also presented among the proposed converter and other popular topologies such as the conventional boost converter and the quadratic boost converter. The qualitative analysis of the coupled-inductor-based topology is developed so that a design procedure can be obtained, from which an experimental prototype is implemented to validate the theoretical assumptions.

Impact of modified perturb and observe control on MPPT of PV/battery fed three - port DC‐DC converter

Directory of Open Access Journals (Sweden)

Venmathi Mahendran

2017-07-01

Full Text Available This paper presents the modified perturb and observe (P&O maximum power point tracking (MPPT method for photovoltaic (PV fed three-port DC‐DC converter in PV/battery hybrid system. The proposed MPPT technique reduces the drift problem which occurs in the conventional MPPT methods by including the data of change in current (ΔI in addition to the data used in the conventional P&O algorithm. The drift phenomenon and its effects are clearly demonstrated in this paper. The ability of the proposed P&O method to address this issue is proved by comparing the conventional P&O algorithm in different modes of operation. The performance assessment includes peak overshoot, settling time, MPP ratio and stability. The experimental validation was implemented using DSPIC30F4011 microcontroller. From the analysis and results, it could be seen that the modified P&O showed better performance in terms of accuracy in tracking the maximum power, less tracking time, high MPP ratio and reduced drift in the changing weather conditions.

Maximum power point tracking for photovoltaic applications by using two-level DC/DC boost converter

Science.gov (United States)

Moamaei, Parvin

Recently, photovoltaic (PV) generation is becoming increasingly popular in industrial applications. As a renewable and alternative source of energy they feature superior characteristics such as being clean and silent along with less maintenance problems compared to other sources of the energy. In PV generation, employing a Maximum Power Point Tracking (MPPT) method is essential to obtain the maximum available solar energy. Among several proposed MPPT techniques, the Perturbation and Observation (P&O;) and Model Predictive Control (MPC) methods are adopted in this work. The components of the MPPT control system which are P&O; and MPC algorithms, PV module and high gain DC-DC boost converter are simulated in MATLAB Simulink. They are evaluated theoretically under rapidly and slowly changing of solar irradiation and temperature and their performance is shown by the simulation results, finally a comprehensive comparison is presented.

Brushless DC motor drives supplied by PV power system based on Z-source inverter and FL-IC MPPT controller

International Nuclear Information System (INIS)

Mozaffari Niapour, S.A.KH.; Danyali, S.; Sharifian, M.B.B.; Feyzi, M.R.

2011-01-01

Highlights: → Employing the BLDC motor in water pumping systems. → Utilizing the ZSI as a single-stage power converter in the PV water pumping systems based on BLDC motor. → Improvement of the conventional IC MPPT method with the fuzzy logic control scheme to save more energy from the PV array. → Taking the advantages of the DTC drive of the BLDC motor. → Optimizing the water pumping system speed response characteristic by PSO. - Abstract: This paper discusses operation performance of a water pumping system consist of a brushless dc (BLDC) motor coupled a centrifugal pump and accompanying a Z-source inverter (ZSI) fed by a photovoltaic (PV) array, to be improved. Despite conventional double-stage power converters, this paper proposes utilizing a single-stage ZSI to extract the maximum power of the PV array and supply the BLDC motor simultaneously. Utilizing the ZSI provides some inherent advantages such as high efficiency and low cost, which is very promising for PV systems due to its novel voltage buck/boost capability. In addition, in order to precisely perform the maximum power point tracking (MPPT) of the PV array the fuzzy logic-incremental conductance (FL-IC) MPPT scheme is proposed. The proposed FL-IC MPPT scheme provides enough modification to the conventional IC method to enjoy an appropriate variable step size MPPT control signal for the ZSI. Moreover, direct torque control (DTC) is found more effective in comparison with hysteresis current control with current shaping to drive the BLDC motor, because it benefits from faster torque response, reduced torque ripple, less sensitivity to parameters variations, and simple implementation. In the mean time, due to the frequently variations of the PV power generation; delivered mechanical power to the centrifugal pump is variable. Thus, the BLDC motor should be driven with variable reference speed. In order to improve the speed transient response of the BLDC motor and enhance the energy saving aspect of

Bacillus cereus AR156 primes induced systemic resistance by suppressing miR825/825* and activating defense-related genes in Arabidopsis.

Science.gov (United States)

Niu, Dongdong; Xia, Jing; Jiang, Chunhao; Qi, Beibei; Ling, Xiaoyu; Lin, Siyuan; Zhang, Weixiong; Guo, Jianhua; Jin, Hailing; Zhao, Hongwei

2016-04-01

Small RNAs play an important role in plant immune responses. However, their regulatory function in induced systemic resistance (ISR) is nascent. Bacillus cereus AR156 is a plant growth-promoting rhizobacterium that induces ISR in Arabidopsis against bacterial infection. Here, by comparing small RNA profiles of Pseudomonas syringae pv. tomato (Pst) DC3000-infected Arabidopsis with and without AR156 pretreatment, we identified a group of Arabidopsis microRNAs (miRNAs) that are differentially regulated by AR156 pretreatment. miR825 and miR825* are two miRNA generated from a single miRNA gene. Northern blot analysis indicated that they were significantly downregulated in Pst DC3000-infected plants pretreated with AR156, in contrast to the plants without AR156 pretreatment. miR825 targets two ubiquitin-protein ligases, while miR825* targets toll-interleukin-like receptor (TIR)-nucleotide binding site (NBS) and leucine-rich repeat (LRR) type resistance (R) genes. The expression of these target genes negatively correlated with the expression of miR825 and miR825*. Moreover, transgenic plants showing reduced expression of miR825 and miR825* displayed enhanced resistance to Pst DC3000 infection, whereas transgenic plants overexpressing miR825 and miR825* were more susceptible. Taken together, our data indicates that Bacillus cereus AR156 pretreatment primes ISR to Pst infection by suppressing miR825 and miR825* and activating the defense related genes they targeted. © 2015 Institute of Botany, Chinese Academy of Sciences.

¬MPPT Pada Sistem PV Menggunakan Algoritma Firefly dan Modified P&O dengan Konverter Hybrid Cuk terkoneksi ke Grid Satu Phasa di Bawah Kondisi Partial Shaded

Directory of Open Access Journals (Sweden)

Dhuhari Chalis Bani

2017-01-01

Full Text Available Abstrak— Photovoltaic (PV merupakan sumber energi terbarukan yang paling banyak dijumpai di alam serta merupakn energi alternatif yang sangat pesat perkembangannya. Untuk mengahasilkan daya, sebuah PV dipengaruhi sebuah nilai intensitas cahaya matahari yang mengenainya. Sebuah sistem PV membutuhkan sebuah kontrol yang bertujuan untuk meningkatkan efisien daya PV tersebut. Kontrol ini adalah Maximum Power Point Tracking (MPPT yang dapat mengoptimalkan daya yang dihasilkan oleh PV.  Sebuah PV hanya menghasilkan nilai tegangan yang rendah, untuk itu perlu menggunakan koverter DC-DC step up untuk menaikan rasio tegangan DC tadi. Untuk mengoptimalkan sistem ini, diperlukan sebuah konverter yang efisien dan dapat menghasilkan rasio konversi tegangan yang tinggi. Pada penelitian menggunakan firefly algoritm (FFA dan modified perturb and observe (P&O sebagai MPPT untuk mendapatkan nilai daya optimal pada keluaran PV.  Konverter DC-DC yang digunakan adalah hybrid cuk converter boost mode yang memiliki rasio tegangan yang tinggi. Dari DC-link kemudian masuk ke inverter (VSI yang diinterkoneksi dengan grid menggunakan current control. Hasil analisis simulasi menunjukan bahwa FFA dan P&O mampu menghasilkan daya PV yang optimum dengan riak yang kecil dan konverter hybrid cuk converter boost mode dapat menghasilkan rasio tegangan yang lebih besar dibandingkan konverter cuk biasa.   Kata Kunci — PV, MPPT FFA, MPPT P&O, Hybrid Cuk Converter, DC-Link, Inverter Grid Connected

Investigating radiostimulation effects of tomatoes, pepper and aubergines productivity improvement

International Nuclear Information System (INIS)

Daskalov, Khr.; Mal'tseva, S.

1974-01-01

The paper presents results of a study on the stimulating effect of ionizing radiation with low doses on tomatoes, pepper, and eggplants with a view to determining optimal radiation doses and possible practical applications of this method. The tomato varieties used were those most common in Bulgaria. It was found that (a) presowing irradiation of tomato, pepper, and eggplant seeds (graded by moisture content) with low doses of gamma rays from Co 60 had a strong stimulating effect; (b) radiation did not cause any changes in chemical composition or palatability; (c) irradiated variants produced more fruits per plant; and (d) the optimal doses are 1500-2500 r for tomatoes, 1200-1800 r for pepper, and 1500-3000 r for eggplants. (E.T.)

PHYSICOCHEMICAL AND ANTIBACTERIAL PROPERTIES OF PLA-CHITOSAN BLENDS OBTAINED BY CASTING WITH POTENTIAL USE AS AGRICULTURAL MULCH FILMS

Directory of Open Access Journals (Sweden)

Danila Merino

2016-03-01

Full Text Available PLA-Chitosan films compatibilized with hexamethylenediisocyanate (HDI were obtained by casting and subsequent hot pressing. The films were prepared with different contents of chitosan (CS and then its physicochemical properties were studied by Fourier Transform infrared spectroscopy (FTIR, thermogravimetric analysis (TGA, differential scanning calorimetry (DSC, optical microscopy (OM and X-ray diffraction (XRD. It was found that the compatibilizing agent reacts completely and that chitosan affects the thermal properties of the films decreasing their decomposition temperatures, glass transition temperature (Tg and melting (Tm and increase its crystallinity. From the functional standpoint, antimicrobial properties of each blend were tested against Pseudomonas syringae pv tomato DC-3000. The increase in chitosan content was proportional to the antimicrobial effect allowing project its potential application in the agronomic field.

A Modular PV System Using Chain-Link-Type Multilevel Converter

Science.gov (United States)

Hatano, Nobuhiko; Ise, Toshifumi

This paper presents a modular photovoltaic system (MPVS) that uses a chain-link-type multilevel converter (CLMC). In large-scale PV generating systems, the DC power supply is generally composed of a large number of PV panels. Hence, losses are caused by differences in the maximum power point at each PV panel. An MPVS has been proposed to address the above mentioned problem. It helps improve the photoelectric conversion efficiency by applying maximum power point tracking (MPPT) control to each group of PV panels. In addition, if a CLMC is used in an MPVS, a high voltage can be output from the AC side and transmission losses can be decreased. However, with this circuit configuration, the current output from the AC side may be unbalanced. Therefore, we propose a method to output balanced current from the AC side, even if the output of the DC power supply is unbalanced. The validity of the proposed method is examined by digital simulation.

Design and comparison of a 10-kW interleaved boost converter for PV application using Si and SiC devices

NARCIS (Netherlands)

Chandra Mouli, G.R.; Schijffelen, Jos H.; Bauer, P.; Zeman, M.

2017-01-01

Grid-connected photovoltaic (PV) inverters have a dc/dc converter connected to the PV for executing the maximum power point tracking. The design of an interleaved boost converter (IBC) with three switching legs for a 10-kW PV inverter is presented in this paper. This paper shows how the use of

Potencialidade de um actinomiceto de rizosfera de tomateiro como agente de biocontrole de doenças Potenciality of an actinomycete from tomato rhizosphere as a biocontrol agent for tomato diseases

Directory of Open Access Journals (Sweden)

Renato Carrer Filho

2009-09-01

Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested

Type I J-domain NbMIP1 proteins are required for both Tobacco mosaic virus infection and plant innate immunity.

Directory of Open Access Journals (Sweden)

Yumei Du

Full Text Available Tm-2² is a coiled coil-nucleotide binding-leucine rich repeat resistance protein that confers durable extreme resistance against Tomato mosaic virus (ToMV and Tobacco mosaic virus (TMV by recognizing the viral movement protein (MP. Here we report that the Nicotiana benthamiana J-domain MIP1 proteins (NbMIP1s associate with tobamovirus MP, Tm-2² and SGT1. Silencing of NbMIP1s reduced TMV movement and compromised Tm-2²-mediated resistance against TMV and ToMV. Furthermore, silencing of NbMIP1s reduced the steady-state protein levels of ToMV MP and Tm-2². Moreover, NbMIP1s are required for plant resistance induced by other R genes and the nonhost pathogen Pseudomonas syringae pv. tomato (Pst DC3000. In addition, we found that SGT1 associates with Tm-2² and is required for Tm-2²-mediated resistance against TMV. These results suggest that NbMIP1s function as co-chaperones during virus infection and plant immunity.

Closed Loop Fuzzy Logic Controlled PV Based Cascaded Boost Five-Level Inverter System

Science.gov (United States)

Revana, Guruswamy; Kota, Venkata Reddy

2018-04-01

Recent developments in intelligent control methods and power electronics have produced PV based DC to AC converters related to AC drives. Cascaded boost converter and inverter find their way in interconnecting PV and Induction Motor. This paper deals with digital simulation and implementation of closed loop controlled five-level inverter based Photo-Voltaic (PV) system. The objective of this work is to reduce the harmonics using Multi Level Inverter based system. The DC output from the PV panel is boosted using cascaded-boost-converters. The DC output of these cascaded boost converters is applied to the bridges of the cascaded inverter. The AC output voltage is obtained by the series cascading of the output voltage of the two inverters. The investigations are done with Induction motor load. Cascaded boost-converter is proposed in the present work to produce the required DC Voltage at the input of the bridge inverter. A simple FLC is applied to CBFLIIM system. The FLC is proposed to reduce the steady state error. The simulation results are compared with the hardware results. The results of the comparison are made to show the improvement in dynamic response in terms of settling time and steady state error. Design procedure and control strategy are presented in detail.

Evaluation of the PV energy production after 12-years of operating

Science.gov (United States)

Bouchakour, Salim; Arab, Amar Hadj; Abdeladim, Kamel; Boulahchiche, Saliha; Amrouche, Said Ould; Razagui, Abdelhak

2018-05-01

This paper presents a simple way to approximately evaluate the photovoltaic (PV) array performance degradation, the studied PV arrays are connected to the local electric grid at the Centre de Developpement des Energies Renouvelables (CDER) in Algiers, Algeria, since June 2004. The used PV module model takes in consideration the module temperature and the effective solar radiance, the electrical characteristics provided by the manufacturer data sheet and the evaluation of the performance coefficient. For the dynamic behavior we use the Linear Reoriented Coordinates Method (LRCM) to estimate the maximum power point (MPP). The performance coefficient is evaluated on the one hand under STC conditions to estimate the dc energy according to the manufacturer data. On the other hand, under real conditions using both the monitored data and the LM optimization algorithm, allowing a good degree of accuracy of estimated dc energy. The application of the developed modeling procedure to the analysis of the monitored data is expected to improve understanding and assessment of the PV performance degradation of the PV arrays after 12 years of operation.

High Efficiency Non-isolated Three Port DC-DC Converter for PV-Battery Systems

DEFF Research Database (Denmark)

Tomas Manez, Kevin; Anthon, Alexander; Zhang, Zhe

2016-01-01

This paper presents a nonisolated Three Port Converter (TPC) with a unidirectional port for photovoltaic (PV) panels and a bidirectional port for energy storage. With the proposed topology single power conversion is performed between each port, so high efficiencies are obtained. A theoretical...

Control of Late Blight of Tomato and Potato by Oilgochitosan

Directory of Open Access Journals (Sweden)

Yong Ho Choi

2011-08-01

Full Text Available Chitosan is a linear polysaccharide composed of randomly distributed β-(1-4-linked D-glucosamine and Nacetyl- D-glucosamine. There have been many reports on the induced systemic resistance and in vivo antifungal activities of higher molecular weight chitosans with molecular weights over 3,000 amu (atomatic mass unit, but there are few papers on in vivo antifungal activities of low molecular weight chitosans (oligochitosans with molecular weights less than 3,000 amu. In our study, an oligochitosan sample (320?3,000 amu showed a potent 1-day protective activity with control values more than 94% at concentrations of 500 and 1,000 ?g/ml especially against tomato late blight caused by Phytophthora infestans under growth chamber conditions. It also displayed a moderate 1-day protective activity with control values of 67?89% at concentrations of 500 and 1,000 ?g/ml against wheat leaf rust and red pepper anthracnose. On the other hand, it showed a 16-hr curative activity against red pepper anthracnose, but not against tomato late blight and wheat leaf rust. In field experiments, oligochitosan effectively suppressed the development of late blight on potato and tomato plants with control values of 72% and 48%, respectively. The results strongly indicate that oligochitosan can be used as an eco-friendly organic material for the control of late blight on tomato and potato plants.

Xanthomonads and other yellow-pigmented, Xanthomonas-like bacteria associated with tomato seeds in Tanzania

DEFF Research Database (Denmark)

Mbega, Ernest Rashid; Wulff, Ednar Gadelha; Mabagala, R.B.

2012-01-01

of Xanthomonas campestris pv. malvacearum, were pathogenic on tomato and pepper plants. Strains identified by Biolog as Sphingomonas sanguinis and Sphingomonas terrae also incited black rot symptoms on pepper leaves. However, bacterial strains belonging to the genus Stenotrophomonas, Chryseobacterium, Pantoea...... and Flavobacterium were not pathogenic on tomato and pepper. Phylogenetic analysis showed that strains of the genus Xanthomonas are more closely related to Stenotrophomonas and Pantoea compared to the other bacterial genera found in tomato seeds....

A new DC/AC boost transformerless converter in application of photovoltaic power generation

DEFF Research Database (Denmark)

Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....

DC-based smart PV-powered home energy management system based on voltage matching and RF module

Science.gov (United States)

Hasan, W. Z. W.

2017-01-01

The main tool for measuring system efficiency in homes and offices is the energy monitoring of the household appliances’ consumption. With the help of GUI through a PC or smart phone, there are various applications that can be developed for energy saving. This work describes the design and prototype implementation of a wireless PV-powered home energy management system under a DC-distribution environment, which allows remote monitoring of appliances’ energy consumptions and power rate quality. The system can be managed by a central computer, which obtains the energy data based on XBee RF modules that access the sensor measurements of system components. The proposed integrated prototype framework is characterized by low power consumption due to the lack of components and consists of three layers: XBee-based circuit for processing and communication architecture, solar charge controller, and solar-battery-load matching layers. Six precise analogue channels for data monitoring are considered to cover the energy measurements. Voltage, current and temperature analogue signals were accessed directly from the remote XBee node to be sent in real time with a sampling frequency of 11–123 Hz to capture the possible surge power. The performance shows that the developed prototype proves the DC voltage matching concept and is able to provide accurate and precise results. PMID:28934271

DC-based smart PV-powered home energy management system based on voltage matching and RF module.

Directory of Open Access Journals (Sweden)

Ahmad H Sabry

Full Text Available The main tool for measuring system efficiency in homes and offices is the energy monitoring of the household appliances' consumption. With the help of GUI through a PC or smart phone, there are various applications that can be developed for energy saving. This work describes the design and prototype implementation of a wireless PV-powered home energy management system under a DC-distribution environment, which allows remote monitoring of appliances' energy consumptions and power rate quality. The system can be managed by a central computer, which obtains the energy data based on XBee RF modules that access the sensor measurements of system components. The proposed integrated prototype framework is characterized by low power consumption due to the lack of components and consists of three layers: XBee-based circuit for processing and communication architecture, solar charge controller, and solar-battery-load matching layers. Six precise analogue channels for data monitoring are considered to cover the energy measurements. Voltage, current and temperature analogue signals were accessed directly from the remote XBee node to be sent in real time with a sampling frequency of 11-123 Hz to capture the possible surge power. The performance shows that the developed prototype proves the DC voltage matching concept and is able to provide accurate and precise results.

DC-based smart PV-powered home energy management system based on voltage matching and RF module.

Science.gov (United States)

Sabry, Ahmad H; Hasan, W Z W; Ab Kadir, Mza; Radzi, M A M; Shafie, S

2017-01-01

The main tool for measuring system efficiency in homes and offices is the energy monitoring of the household appliances' consumption. With the help of GUI through a PC or smart phone, there are various applications that can be developed for energy saving. This work describes the design and prototype implementation of a wireless PV-powered home energy management system under a DC-distribution environment, which allows remote monitoring of appliances' energy consumptions and power rate quality. The system can be managed by a central computer, which obtains the energy data based on XBee RF modules that access the sensor measurements of system components. The proposed integrated prototype framework is characterized by low power consumption due to the lack of components and consists of three layers: XBee-based circuit for processing and communication architecture, solar charge controller, and solar-battery-load matching layers. Six precise analogue channels for data monitoring are considered to cover the energy measurements. Voltage, current and temperature analogue signals were accessed directly from the remote XBee node to be sent in real time with a sampling frequency of 11-123 Hz to capture the possible surge power. The performance shows that the developed prototype proves the DC voltage matching concept and is able to provide accurate and precise results.

A New Technique for Tracking the Global Maximum Power Point of PV Arrays Operating Under Partial-Shading Conditions

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2012-01-01

The power-voltage characteristic of photovoltaic (PV) arrays operating under partial-shading conditions exhibits multiple local maximum power points (MPPs). In this paper, a new method to track the global MPP is presented, which is based on controlling a dc/dc converter connected at the PV array...

Reliability of hybrid photovoltaic DC micro-grid systems for emergency shelters and other applications

Science.gov (United States)

Dhere, Neelkanth G.; Schleith, Susan

2014-10-01

Improvement of energy efficiency in the SunSmart Schools Emergency Shelters requires new methods for optimizing the energy consumption within the shelters. One major limitation in current systems is the requirement of converting direct current (DC) power generated from the PV array into alternating current (AC) power which is distributed throughout the shelters. Oftentimes, this AC power is then converted back to DC to run certain appliances throughout the shelters resulting in a significant waste of energy due to DC to AC and then again AC to DC conversion. This paper seeks to extract the maximum value out of PV systems by directly powering essential load components within the shelters that already run on DC power without the use of an inverter and above all to make the system reliable and durable. Furthermore, additional DC applications such as LED lighting, televisions, computers and fans operated with DC brushless motors will be installed as replacements to traditional devices in order to improve efficiency and reduce energy consumption. Cost of energy storage technologies continue to decline as new technologies scale up and new incentives are put in place. This will provide a cost effective way to stabilize the energy generation of a PV system as well as to provide continuous energy during night hours. It is planned to develop a pilot program of an integrated system that can provide uninterrupted DC power to essential base load appliances (heating, cooling, lighting, etc.) at the Florida Solar Energy Center (FSEC) command center for disaster management. PV arrays are proposed to be installed on energy efficient test houses at FSEC as well as at private homes having PV arrays where the owners volunteer to participate in the program. It is also planned to monitor the performance of the PV arrays and functioning of the appliances with the aim to improve their reliability and durability. After a successful demonstration of the hybrid DC microgrid based emergency

Implementation of a PV lighting system based on DC-DC converter with intelligent controlled approach

Energy Technology Data Exchange (ETDEWEB)

Hua, C.-C.; Chuang, D.-J. [National Yunlin Univ. of Science and Technology, Douliou, Yunlin, Taiwan (China). Dept. of Electrical Engineering; Chuang, C.-W. [National Yunlin Univ. of Science and Technology, Douliou, Yunlin, Taiwan (China). Graduate School of Engineering Science and Technology

2007-07-01

Photovoltaic (PV) lighting systems for municipalities represent one of the largest cost effective markets for PVs. The installation cost of just one or two utility power poles can justify the initial cost of a PV lighting system. However, many previous PV lighting systems have experienced a number of component failures including premature charge controller, battery, and ballast illumination failures. This paper presented the design and implementation of a digital high performance photovoltaic lighting system based on a microcontroller. A high brightness light-emitting diode (HBLED), was used as it can work at very high efficiency with a specially designed lighting power module. The proposed system consisted of a photovoltaic module, a light emitting diode (LED) lighting module, a bi-directional buck-boost converter and a battery. The paper analysed battery charging methods and proposed a control strategy and hardware implementation. The dimming control methods for LED were also discussed and compared. The experimental results were also provided to verify the theoretical analysis and design procedure of a digital controlled photovoltaic lighting system. It was concluded that the experimental results verified the performance of the proposed photovoltaic lighting system. 8 refs., 1 tab., 18 figs.

Solar Photovoltaic (PV) Distributed Generation Systems - Control and Protection

Science.gov (United States)

Yi, Zhehan

This dissertation proposes a comprehensive control, power management, and fault detection strategy for solar photovoltaic (PV) distribution generations. Battery storages are typically employed in PV systems to mitigate the power fluctuation caused by unstable solar irradiance. With AC and DC loads, a PV-battery system can be treated as a hybrid microgrid which contains both DC and AC power resources and buses. In this thesis, a control power and management system (CAPMS) for PV-battery hybrid microgrid is proposed, which provides 1) the DC and AC bus voltage and AC frequency regulating scheme and controllers designed to track set points; 2) a power flow management strategy in the hybrid microgrid to achieve system generation and demand balance in both grid-connected and islanded modes; 3) smooth transition control during grid reconnection by frequency and phase synchronization control between the main grid and microgrid. Due to the increasing demands for PV power, scales of PV systems are getting larger and fault detection in PV arrays becomes challenging. High-impedance faults, low-mismatch faults, and faults occurred in low irradiance conditions tend to be hidden due to low fault currents, particularly, when a PV maximum power point tracking (MPPT) algorithm is in-service. If remain undetected, these faults can considerably lower the output energy of solar systems, damage the panels, and potentially cause fire hazards. In this dissertation, fault detection challenges in PV arrays are analyzed in depth, considering the crossing relations among the characteristics of PV, interactions with MPPT algorithms, and the nature of solar irradiance. Two fault detection schemes are then designed as attempts to address these technical issues, which detect faults inside PV arrays accurately even under challenging circumstances, e.g., faults in low irradiance conditions or high-impedance faults. Taking advantage of multi-resolution signal decomposition (MSD), a powerful signal

A soft-switching coupled inductor bidirectional DC-DC converter with high-conversion ratio

Science.gov (United States)

Chao, Kuei-Hsiang; Jheng, Yi-Cing

2018-01-01

A soft-switching bidirectional DC-DC converter is presented herein as a way to improve the conversion efficiency of a photovoltaic (PV) system. Adoption of coupled inductors enables the presented converter not only to provide a high-conversion ratio but also to suppress the transient surge voltage via the release of the energy stored in leakage flux of the coupled inductors, and the cost can kept down consequently. A combined use of a switching mechanism and an auxiliary resonant branch enables the converter to successfully perform zero-voltage switching operations on the main switches and improves the efficiency accordingly. It was testified by experiments that our proposed converter works relatively efficiently in full-load working range. Additionally, the framework of the converter intended for testifying has high-conversion ratio. The results of a test, where a generating system using PV module array coupled with batteries as energy storage device was used as the low-voltage input side, and DC link was used as high-voltage side, demonstrated our proposed converter framework with high-conversion ratio on both high-voltage and low-voltage sides.

Droop Control with Improved Disturbance Adaption for PV System with Two Power Conversion Stages

DEFF Research Database (Denmark)

Liu, Hongpeng; Loh, Poh Chiang; Wang, Xiongfei

2016-01-01

with no or insufficient storage for cushioning climatic changes. In addition, most droop-controlled literatures have assumed a single dc-ac inverter with its input dc source fixed. Front-end dc-dc converter added to a two-stage photovoltaic (PV) system has therefore usually been ignored. To address these unresolved...

A Distributed Control Strategy Based on DC Bus Signaling for Modular Photovoltaic Generation Systems With Battery Energy Storage

DEFF Research Database (Denmark)

Sun, Kai; Zhang, Li; Xing, Yan

2011-01-01

on improved dc bus signaling is proposed for a modular photovoltaic (PV) generation system with battery energy storage elements. In this paper, the modular PV generation system is composed of three modular dc/dc converters for PV arrays, two grid-connected dc/ac converters, and one dc/dc converter for battery......, grid-connected inversion, and islanding with constant voltage (CV) generation.The power balance of the system under extreme conditions such as the islanding operation with a full-charged battery is taken into account in this control strategy. The dc bus voltage level is employed as an information......Modular generation system, which consists of modular power conditioning converters, is an effective solution to integrate renewable energy sources with conventional utility grid to improve reliability and efficiency, especially for photovoltaic generation. A distributed control strategy based...

Cell wall-bound invertase limits sucrose export and is involved in symptom development and inhibition of photosynthesis during compatible interaction between tomato and Xanthomonas campestris pv vesicatoria.

Science.gov (United States)

Kocal, Nurcan; Sonnewald, Uwe; Sonnewald, Sophia

2008-11-01

Cell wall-bound invertase (cw-Inv) plays an important role in carbohydrate partitioning and regulation of sink-source interaction. There is increasing evidence that pathogens interfere with sink-source interaction, and induction of cw-Inv activity has frequently been shown in response to pathogen infection. To investigate the role of cw-Inv, transgenic tomato (Solanum lycopersicum) plants silenced for the major leaf cw-Inv isoforms were generated and analyzed during normal growth and during the compatible interaction with Xanthomonas campestris pv vesicatoria. Under normal growth conditions, activities of sucrolytic enzymes as well as photosynthesis and respiration were unaltered in the transgenic plants compared with wild-type plants. However, starch levels of source leaves were strongly reduced, which was most likely caused by an enhanced sucrose exudation rate. Following X. campestris pv vesicatoria infection, cw-Inv-silenced plants showed an increased sucrose to hexose ratio in the apoplast of leaves. Symptom development, inhibition of photosynthesis, and expression of photosynthetic genes were clearly delayed in transgenic plants compared with wild-type plants. In addition, induction of senescence-associated and pathogenesis-related genes observed in infected wild-type plants was abolished in cw-Inv-silenced tomato lines. These changes were not associated with decreased bacterial growth. In conclusion, cw-Inv restricts carbon export from source leaves and regulates the sucrose to hexose ratio in the apoplast. Furthermore, an increased apoplastic hexose to sucrose ratio can be linked to inhibition of photosynthesis and induction of pathogenesis-related gene expression but does not significantly influence bacterial growth. Indirectly, bacteria may benefit from low invertase activity, since the longevity of host cells is raised and basal defense might be dampened.

Selective harmonic elimination strategy in eleven level inverter for PV system with unbalanced DC sources

Science.gov (United States)

Ghoudelbourk, Sihem.; Dib, D.; Meghni, B.; Zouli, M.

2017-02-01

The paper deals with the multilevel converters control strategy for photovoltaic system integrated in distribution grids. The objective of the proposed work is to design multilevel inverters for solar energy applications so as to reduce the Total Harmonic Distortion (THD) and to improve the power quality. The multilevel inverter power structure plays a vital role in every aspect of the power system. It is easier to produce a high-power, high-voltage inverter with the multilevel structure. The topologies of multilevel inverter have several advantages such as high output voltage, lower total harmonic distortion (THD) and reduction of voltage ratings of the power semiconductor switching devices. The proposed control strategy ensures an implementation of selective harmonic elimination (SHE) modulation for eleven levels. SHE is a very important and efficient strategy of eliminating selected harmonics by judicious selection of the firing angles of the inverter. Harmonics elimination technique eliminates the need of the expensive low pass filters in the system. Previous research considered that constant and equal DC sources with invariant behavior; however, this research extends earlier work to include variant DC sources, which are typical of lead-acid batteries when used in system PV. This Study also investigates methods to minimize the total harmonic distortion of the synthesized multilevel waveform and to help balance the battery voltage. The harmonic elimination method was used to eliminate selected lower dominant harmonics resulting from the inverter switching action.

Adaptive fuzzy sliding control of single-phase PV grid-connected inverter.

Science.gov (United States)

Fei, Juntao; Zhu, Yunkai

2017-01-01

In this paper, an adaptive fuzzy sliding mode controller is proposed to control a two-stage single-phase photovoltaic (PV) grid-connected inverter. Two key technologies are discussed in the presented PV system. An incremental conductance method with adaptive step is adopted to track the maximum power point (MPP) by controlling the duty cycle of the controllable power switch of the boost DC-DC converter. An adaptive fuzzy sliding mode controller with an integral sliding surface is developed for the grid-connected inverter where a fuzzy system is used to approach the upper bound of the system nonlinearities. The proposed strategy has strong robustness for the sliding mode control can be designed independently and disturbances can be adaptively compensated. Simulation results of a PV grid-connected system verify the effectiveness of the proposed method, demonstrating the satisfactory robustness and performance.

A Novel Supervisory Control Algorithm to Improve the Performance of a Real-Time PV Power-Hardware-In-Loop Simulator with Non-RTDS

Directory of Open Access Journals (Sweden)

Dae-Jin Kim

2017-10-01

Full Text Available A programmable direct current (DC power supply with Real-time Digital Simulator (RTDS-based photovoltaic (PV Power Hardware-In-the-Loop (PHIL simulators has been used to improve the control algorithm and reliability of a PV inverter. This paper proposes a supervisory control algorithm for a PV PHIL simulator with a non-RTDS device that is an alternative solution to a high-cost PHIL simulator. However, when such a simulator with the conventional algorithm which is used in an RTDS is connected to a PV inverter, the output is in the transient state and it makes it impossible to evaluate the performance of the PV inverter. Therefore, the proposed algorithm controls the voltage and current target values according to constant voltage (CV and constant current (CC modes to overcome the limitation of the Computing Unit and DC power supply, and it also uses a multi-rate system to account for the characteristics of each component of the simulator. A mathematical model of a PV system, programmable DC power supply, isolated DC measurement device, and Computing Unit are integrated to form a real-time processing simulator. Performance tests are carried out with a commercial PV inverter and prove the superiority of this proposed algorithm against the conventional algorithm.

Realworld maximum power point tracking simulation of PV system based on Fuzzy Logic control

Science.gov (United States)

Othman, Ahmed M.; El-arini, Mahdi M. M.; Ghitas, Ahmed; Fathy, Ahmed

2012-12-01

In the recent years, the solar energy becomes one of the most important alternative sources of electric energy, so it is important to improve the efficiency and reliability of the photovoltaic (PV) systems. Maximum power point tracking (MPPT) plays an important role in photovoltaic power systems because it maximize the power output from a PV system for a given set of conditions, and therefore maximize their array efficiency. This paper presents a maximum power point tracker (MPPT) using Fuzzy Logic theory for a PV system. The work is focused on the well known Perturb and Observe (P&O) algorithm and is compared to a designed fuzzy logic controller (FLC). The simulation work dealing with MPPT controller; a DC/DC Ćuk converter feeding a load is achieved. The results showed that the proposed Fuzzy Logic MPPT in the PV system is valid.

Control of Grid Interactive PV Inverters for High Penetration in Low Voltage Distribution Networks

DEFF Research Database (Denmark)

Demirok, Erhan

Regarding of high density deployment of PV installations in electricity grids, new technical challenges such as voltage rise, thermal loading of network components, voltage unbalance, harmonic interaction and fault current contributions are being added to tasks list of distribution system operators...... of these inverters may depend on grid connection rules which are forced by DSOs. Minimum requirement expected from PV inverters is to transfer maximum power by taking direct current (DC) form from PV modules and release it into AC grid and also continuously keep the inverters synchronized to the grid even under...... for this problem but PV inverters connected to highly capacitive networks are able to employ extra current and voltage harmonics compensation to avoid triggering network resonances at low order frequencies. The barriers such as harmonics interaction, flicker, fault current contribution and dc current injections...

DC microgrid power flow optimization by multi-layer supervision control. Design and experimental validation

International Nuclear Information System (INIS)

Sechilariu, Manuela; Wang, Bao Chao; Locment, Fabrice; Jouglet, Antoine

2014-01-01

Highlights: • DC microgrid (PV array, storage, power grid connection, DC load) with multi-layer supervision control. • Power balancing following power flow optimization while providing interface for smart grid communication. • Optimization under constraints: storage capability, grid power limitations, grid time-of-use pricing. • Experimental validation of DC microgrid power flow optimization by multi-layer supervision control. • DC microgrid able to perform peak shaving, to avoid undesired injection, and to make full use of locally energy. - Abstract: Urban areas have great potential for photovoltaic (PV) generation, however, direct PV power injection has limitations for high level PV penetration. It induces additional regulations in grid power balancing because of lacking abilities of responding to grid issues such as reducing grid peak consumption or avoiding undesired injections. The smart grid implementation, which is designed to meet these requirements, is facilitated by microgrids development. This paper presents a DC microgrid (PV array, storage, power grid connection, DC load) with multi-layer supervision control which handles instantaneous power balancing following the power flow optimization while providing interface for smart grid communication. The optimization takes into account forecast of PV power production and load power demand, while satisfying constraints such as storage capability, grid power limitations, grid time-of-use pricing and grid peak hour. Optimization, whose efficiency is related to the prediction accuracy, is carried out by mixed integer linear programming. Experimental results show that the proposed microgrid structure is able to control the power flow at near optimum cost and ensures self-correcting capability. It can respond to issues of performing peak shaving, avoiding undesired injection, and making full use of locally produced energy with respect to rigid element constraints

A control strategy for PV stand-alone applications

International Nuclear Information System (INIS)

Slouma, S; Baccar, H

2015-01-01

This paper proposes a stand-alone photovoltaic (PV) system study in domestic applications. Because of the decrease in power of photovoltaic module as a consequence of changes in solar radiation and temperature which affect the photovoltaic module performance, the design and control of DC-DC buck converter was proposed for providing power to the load from a photovoltaic source.In fact, the control of this converter is carried out with integrated MPPT (Maximum Power Point Tracking) algorithm which ensures a maximum energy generated by the PV arrays. Moreover, the output stage is composed by a battery energy storage system, dc-ac inverter, LCL filter which enables higher efficiency, low distortion ac waveforms and low leakage currents. The control strategy adopted is cascade control composed by two regulation loops.Simulations performed with PSIM software were able to validate the control system.The realization and testing of the photovoltaic system were achieved in the Photovoltaic laboratory of the Centre for Research and Energy Technologies at the Technopark Borj Cedria. Experimental results verify the effeciency of the proposed system

A control strategy for PV stand-alone applications

Science.gov (United States)

Slouma, S.; Baccar, H.

2015-04-01

This paper proposes a stand-alone photovoltaic (PV) system study in domestic applications. Because of the decrease in power of photovoltaic module as a consequence of changes in solar radiation and temperature which affect the photovoltaic module performance, the design and control of DC-DC buck converter was proposed for providing power to the load from a photovoltaic source.In fact, the control of this converter is carried out with integrated MPPT (Maximum Power Point Tracking) algorithm which ensures a maximum energy generated by the PV arrays. Moreover, the output stage is composed by a battery energy storage system, dc-ac inverter, LCL filter which enables higher efficiency, low distortion ac waveforms and low leakage currents. The control strategy adopted is cascade control composed by two regulation loops.Simulations performed with PSIM software were able to validate the control system.The realization and testing of the photovoltaic system were achieved in the Photovoltaic laboratory of the Centre for Research and Energy Technologies at the Technopark Borj Cedria. Experimental results verify the effeciency of the proposed system.

The Arabidopsis thaliana cysteine-rich receptor-like kinase CRK20 modulates host responses to Pseudomonas syringae pv. tomato DC3000 infection

KAUST Repository

Ederli, Luisa; Madeo, Laura; Calderini, Ornella; Gehring, Christoph A; Moretti, Chiaraluce; Buonaurio, Roberto; Paolocci, Francesco; Pasqualini, Stefania

2011-01-01

by pathogens, salicylic acid and ozone (O3). However, its role in responses to biotic and abiotic stress remains to be elucidated. To determine the function of CRK20 in such responses, two CRK20 loss-of-function mutants, crk20-1 and crk20-2, were isolated from

Controller design and stability analysis of grid connected DC microgrid

DEFF Research Database (Denmark)

Chauhan, Rajeev Kumar; Chauhan, Kalpana; Guerrero, Josep M.

2018-01-01

DC microgrids are desired to provide the electricity for the remote areas which are far from the main grid. The microgrid gets popularity because DC power sources such as photovoltaics (PVs), battery banks, and fuel cells can be interconnected without AC/DC converters. The stochastic nature of PV...

A Single Phase Doubly Grounded Semi-Z-Source Inverter for Photovoltaic (PV Systems with Maximum Power Point Tracking (MPPT

Directory of Open Access Journals (Sweden)

Tofael Ahmed

2014-06-01

Full Text Available In this paper, a single phase doubly grounded semi-Z-source inverter with maximum power point tracking (MPPT is proposed for photovoltaic (PV systems. This proposed system utilizes a single-ended primary inductor (SEPIC converter as DC-DC converter to implement the MPPT algorithm for tracking the maximum power from a PV array and a single phase semi-Z-source inverter for integrating the PV with AC power utilities. The MPPT controller utilizes a fast-converging algorithm to track the maximum power point (MPP and the semi-Z-source inverter utilizes a nonlinear SPWM to produce sinusoidal voltage at the output. The proposed system is able to track the MPP of PV arrays and produce an AC voltage at its output by utilizing only three switches. Experimental results show that the fast-converging MPPT algorithm has fast tracking response with appreciable MPP efficiency. In addition, the inverter shows the minimization of common mode leakage current with its ground sharing feature and reduction of the THD as well as DC current components at the output during DC-AC conversion.

A Low-Voltage Ride-Through Control Strategy for Three-Phase Grid-Connected PV Systems

DEFF Research Database (Denmark)

Afshari, Ehsan; Farhangi, Babak; Yang, Yongheng

2017-01-01

similar variations in the dc-link voltage of conventional two-stage PV inverters. In such systems with an electrolytic capacitor in the dc-link, the oscillations of the dc-link voltage with DGF can deteriorate the capacitor lifetime, and thus the entire system. The proposed Low-Voltage Ride-Through (LVRT...

Realworld maximum power point tracking simulation of PV system based on Fuzzy Logic control

Directory of Open Access Journals (Sweden)

Ahmed M. Othman

2012-12-01

Full Text Available In the recent years, the solar energy becomes one of the most important alternative sources of electric energy, so it is important to improve the efficiency and reliability of the photovoltaic (PV systems. Maximum power point tracking (MPPT plays an important role in photovoltaic power systems because it maximize the power output from a PV system for a given set of conditions, and therefore maximize their array efficiency. This paper presents a maximum power point tracker (MPPT using Fuzzy Logic theory for a PV system. The work is focused on the well known Perturb and Observe (P&O algorithm and is compared to a designed fuzzy logic controller (FLC. The simulation work dealing with MPPT controller; a DC/DC Ćuk converter feeding a load is achieved. The results showed that the proposed Fuzzy Logic MPPT in the PV system is valid.

Energy harvesting using TEG and PV cell for low power application

Science.gov (United States)

Tawil, Siti Nooraya Mohd; Zainal, Mohd Zulkarnain

2018-02-01

A thermoelectric generator (TEG) module and photovoltaic cell (PV) were utilized to harvest energy from temperature gradients of heat sources from ambient heat and light of sun. The output of TEG and PV were connected to a power management circuit consist of step-up dc-dc converter in order to increase the output voltage to supply a low power application such as wireless communication module and the photovoltaic cell for charging an energy storage element in order to switch on a fan for cooling system of the thermoelectric generator. A switch is used as a selector to choose the input of source either from photovoltaic cell or thermoelectric generator to switch on DC-DC step-up converter. In order to turn on the DC-DC step-up converter, the input must be greater than 3V. The energy harvesting was designed so that it can be used continuously and portable anywhere. Multiple sources used in this energy harvesting system is to ensure the system can work in whatever condition either in good weather or not good condition of weather. This energy harvesting system has the potential to be used in military operation and environment that require sustainability of energy resources.

SiC-based High Efficiency Bidirectional Battery Converter for Smart PV Residential Systems

DEFF Research Database (Denmark)

Pham, Cam; Biris, Valeriu-Ciprian; Teodorescu, Remus

2013-01-01

Smart PV inverters are essential components of future grids. Beside conventional functionalities they can communicate with the grid, supports the grid with reactive power and with active power from internal battery storage. To maximize internal consumption, a high efficiency bidirectional DC-DC c...

New approach to exploit optimally the PV array output energy by maximizing the discharge rate of a directly-coupled photovoltaic water pumping system (DC/PVPS)

International Nuclear Information System (INIS)

Boutelhig, Azzedine; Hadj Arab, Amar; Hanini, Salah

2016-01-01

Highlights: • Mismatches on a designed d-c PV pumping system have been highlighted. • A new approach predicting the maximal discharge has been developed. • The approach has been discussed versus its linearity coefficient. • The approach effectiveness has been investigated and approved. • Theoretical and experimental obtained values have been compared and approved. - Abstract: A directly-coupled photovoltaic water pumping system (DC/PVPS) is generally designed by considering the worst month conditions on lowest daylight-hours, the maximum monthly daily required water volume and tank to store the excess water. In case of absence of hydraulic storage (water tank) or it is not enough dimensioned, the extra amount of pumped water is lost or is not reasonably used, when the system is operated on full daylight-hour. Beside that the extra amount of energy, which might be produced by the PV generator, is not exploited, when the system is operated only during a specified period-time needed to satisfy the demand. Beyond the accurate design that satisfying the end-user, a new approach has been developed as target to exploit maximally the PV array energy production, by maximizing the discharge rate of the system. The methodology consists of approaching maximally the demanded energy to the supplied energy on full operating day. Based on the demand/supply energy condition, the approach has been developed, upon the PV array and the pump performance models. The issued approach predicts the maximum delivery capacity of the system on monthly daily water volumes versus the monthly daily averages of solar irradiation, previously recorded. Its efficacy has been investigated and discussed according to the estimated and experimental values of its linearity coefficient, following the characterization tests of a designed system, carried out at our pumping test facility in Ghardaia (Algeria). The new theoretically and experimentally obtained flow-rates fit well, except

Grid Connected Solar PV System with SEPIC Converter Compared with Parallel Boost Converter Based MPPT

OpenAIRE

Bosco Raj, T. Ajith; Ramesh, R.; Maglin, J. R.; Vaigundamoorthi, M.; William Christopher, I.; Gopinath, C.; Yaashuwanth, C.

2014-01-01

The main objective of this work is to study the behaviour of the solar PV systems and model the efficient Grid-connected solar power system. The DC-DC MPPT circuit using chaotic pulse width modulation has been designed to track maximum power from solar PV module. The conversion efficiency of the proposed MPPT system is increased when CPWM is used as a control scheme. This paper also proposes a simplified multilevel (seven level) inverter for a grid-connected photovoltaic system. The primary g...

Modeling, Dynamics, Bifurcation Behavior and Stability Analysis of a DC-DC Boost Converter in Photovoltaic Systems

Science.gov (United States)

Zhioua, M.; El Aroudi, A.; Belghith, S.; Bosque-Moncusí, J. M.; Giral, R.; Al Hosani, K.; Al-Numay, M.

A study of a DC-DC boost converter fed by a photovoltaic (PV) generator and supplying a constant voltage load is presented. The input port of the converter is controlled using fixed frequency pulse width modulation (PWM) based on the loss-free resistor (LFR) concept whose parameter is selected with the aim to force the PV generator to work at its maximum power point. Under this control strategy, it is shown that the system can exhibit complex nonlinear behaviors for certain ranges of parameter values. First, using the nonlinear models of the converter and the PV source, the dynamics of the system are explored in terms of some of its parameters such as the proportional gain of the controller and the output DC bus voltage. To present a comprehensive approach to the overall system behavior under parameter changes, a series of bifurcation diagrams are computed from the circuit-level switched model and from a simplified model both implemented in PSIM© software showing a remarkable agreement. These diagrams show that the first instability that takes place in the system period-1 orbit when a primary parameter is varied is a smooth period-doubling bifurcation and that the nonlinearity of the PV generator is irrelevant for predicting this phenomenon. Different bifurcation scenarios can take place for the resulting period-2 subharmonic regime depending on a secondary bifurcation parameter. The boundary between the desired period-1 orbit and subharmonic oscillation resulting from period-doubling in the parameter space is obtained by calculating the eigenvalues of the monodromy matrix of the simplified model. The results from this model have been validated with time-domain numerical simulation using the circuit-level switched model and also experimentally from a laboratory prototype. This study can help in selecting the parameter values of the circuit in order to delimit the region of period-1 operation of the converter which is of practical interest in PV systems.

An Optimal Control Strategy for DC Bus Voltage Regulation in Photovoltaic System with Battery Energy Storage

Directory of Open Access Journals (Sweden)

Muhamad Zalani Daud

2014-01-01

Full Text Available This paper presents an evaluation of an optimal DC bus voltage regulation strategy for grid-connected photovoltaic (PV system with battery energy storage (BES. The BES is connected to the PV system DC bus using a DC/DC buck-boost converter. The converter facilitates the BES power charge/discharge to compensate for the DC bus voltage deviation during severe disturbance conditions. In this way, the regulation of DC bus voltage of the PV/BES system can be enhanced as compared to the conventional regulation that is solely based on the voltage-sourced converter (VSC. For the grid side VSC (G-VSC, two control methods, namely, the voltage-mode and current-mode controls, are applied. For control parameter optimization, the simplex optimization technique is applied for the G-VSC voltage- and current-mode controls, including the BES DC/DC buck-boost converter controllers. A new set of optimized parameters are obtained for each of the power converters for comparison purposes. The PSCAD/EMTDC-based simulation case studies are presented to evaluate the performance of the proposed optimized control scheme in comparison to the conventional methods.

An optimal control strategy for DC bus voltage regulation in photovoltaic system with battery energy storage.

Science.gov (United States)

Daud, Muhamad Zalani; Mohamed, Azah; Hannan, M A

2014-01-01

This paper presents an evaluation of an optimal DC bus voltage regulation strategy for grid-connected photovoltaic (PV) system with battery energy storage (BES). The BES is connected to the PV system DC bus using a DC/DC buck-boost converter. The converter facilitates the BES power charge/discharge to compensate for the DC bus voltage deviation during severe disturbance conditions. In this way, the regulation of DC bus voltage of the PV/BES system can be enhanced as compared to the conventional regulation that is solely based on the voltage-sourced converter (VSC). For the grid side VSC (G-VSC), two control methods, namely, the voltage-mode and current-mode controls, are applied. For control parameter optimization, the simplex optimization technique is applied for the G-VSC voltage- and current-mode controls, including the BES DC/DC buck-boost converter controllers. A new set of optimized parameters are obtained for each of the power converters for comparison purposes. The PSCAD/EMTDC-based simulation case studies are presented to evaluate the performance of the proposed optimized control scheme in comparison to the conventional methods.

High Efficiency Non-isolated Three Port DC-DC Converter for PV-Battery Systems

OpenAIRE

Tomas Manez, Kevin; Anthon, Alexander; Zhang, Zhe; Ouyang, Ziwei; Franke, Toke

2016-01-01

This paper presents a nonisolated Three Port Converter (TPC) with a unidirectional port for photovoltaic (PV) panels and a bidirectional port for energy storage. With the proposed topology single power conversion is performed between each port, so high efficiencies are obtained. A theoretical analysis is carried out to analyze all operating modes and design considerations with the main equations are given. A 4kW laboratory prototype is developed and tested under all operatingconditions. Resul...

Automatic supervision and fault detection of PV systems based on power losses analysis

Energy Technology Data Exchange (ETDEWEB)

Chouder, A.; Silvestre, S. [Electronic Engineering Department, Universitat Politecnica de Catalunya, C/Jordi Girona 1-3, Campus Nord UPC, 08034 Barcelona (Spain)

2010-10-15

In this work, we present a new automatic supervision and fault detection procedure for PV systems, based on the power losses analysis. This automatic supervision system has been developed in Matlab and Simulink environment. It includes parameter extraction techniques to calculate main PV system parameters from monitoring data in real conditions of work, taking into account the environmental irradiance and module temperature evolution, allowing simulation of the PV system behaviour in real time. The automatic supervision method analyses the output power losses, presents in the DC side of the PV generator, capture losses. Two new power losses indicators are defined: thermal capture losses (L{sub ct}) and miscellaneous capture losses (L{sub cm}). The processing of these indicators allows the supervision system to generate a faulty signal as indicator of fault detection in the PV system operation. Two new indicators of the deviation of the DC variables respect to the simulated ones have been also defined. These indicators are the current and voltage ratios: R{sub C} and R{sub V}. Analysing both, the faulty signal and the current/voltage ratios, the type of fault can be identified. The automatic supervision system has been successfully tested experimentally. (author)

Automatic supervision and fault detection of PV systems based on power losses analysis

International Nuclear Information System (INIS)

Chouder, A.; Silvestre, S.

2010-01-01

In this work, we present a new automatic supervision and fault detection procedure for PV systems, based on the power losses analysis. This automatic supervision system has been developed in Matlab and Simulink environment. It includes parameter extraction techniques to calculate main PV system parameters from monitoring data in real conditions of work, taking into account the environmental irradiance and module temperature evolution, allowing simulation of the PV system behaviour in real time. The automatic supervision method analyses the output power losses, presents in the DC side of the PV generator, capture losses. Two new power losses indicators are defined: thermal capture losses (L ct ) and miscellaneous capture losses (L cm ). The processing of these indicators allows the supervision system to generate a faulty signal as indicator of fault detection in the PV system operation. Two new indicators of the deviation of the DC variables respect to the simulated ones have been also defined. These indicators are the current and voltage ratios: R C and R V . Analysing both, the faulty signal and the current/voltage ratios, the type of fault can be identified. The automatic supervision system has been successfully tested experimentally.

Design and Implementation of an Innovative Residential PV System

Science.gov (United States)

Najm, Elie Michel

This work focuses on the design and implementation of an innovative residential PV system. In chapter one, after an introduction related to the rapid growth of solar systems' installations, the most commonly used state of the art solar power electronics' configurations are discussed, which leads to introducing the proposed DC/DC parallel configuration. The advantages and disadvantages of each of the power electronics' configurations are deliberated. The scope of work in the power electronics is defined in this chapter to be related to the panel side DC/DC converter. System integration and mechanical proposals are also within the scope of work and are discussed in later chapters. Operation principle of a novel low cost PV converter is proposed in chapter 2. The proposal is based on an innovative, simplified analog implementation of a master/slave methodology resulting in an efficient, soft-switched interleaved variable frequency flybacks, operating in the boundary conduction mode (BCM). The scheme concept and circuit configuration, operation principle and theoretical waveforms, design equations, and design considerations are presented. Furthermore, design examples are also given, illustrating the significance of the newly derived frequency equation for flybacks operating in BCM. In chapters 3, 4, and 5, the design implementation and optimization of the novel DC/DC converter illustrated in chapter 2 are discussed. In chapter 3, a detailed variable frequency BCM flyback design model leading to optimizing the component selections and transformer design, detailed in chapter 4, is presented. Furthermore, in chapter 4, the method enabling the use of lower voltage rating switching devices is also discussed. In chapter 5, circuitry related to Start-UP, drive for the main switching devices, zero-voltage-switching (ZVS) as well as turn OFF soft switching and interleaving control are fully detailed. The experimental results of the proposed DC/DC converter are presented in

The European PV market evaluation for potential investors - actual information on the 15 EU member state countries and Switzerland

International Nuclear Information System (INIS)

Kurdziel, M.

2004-01-01

The EU has ambitious targets for the introduction of PV. According to the white book of the European Commission, the target for 2010 is to install 3000 MWp. In the following the European PV markets of the 15 EU member state countries and Switzerland are presented and evaluated for potential investors. (author)

The potential of solar PV in Ontario

International Nuclear Information System (INIS)

McMonagle, R.

2005-01-01

Canada has lagged behind other industrialized nations in the growth of solar energy markets. Currently, over 78 per cent of the global market for solar energy is for grid-connected applications where power is fed into the electrical distribution network. Less than 3.5 per cent of the Canadian solar market is grid-connected. This report investigated the potential size of the photovoltaic (PV) market in Ontario given adequate support from both governments and utilities. The forecast was based on sustainable growth levels that the solar industry as a whole might maintain over an extended period of time. It was suggested that it is technically feasible to install over 3000 MW of PV in single, detached homes in the province, which could generate over 3200 GWh each year. If the right policy conditions were put in place, the technical potential for PV on all buildings in Ontario is over 14,000 MW by 2025, which would generate over 13,000 GWh annually. Support mechanisms such as the Advanced Renewable Tariff (ART) or Standard Offer Contracts (SOC) will enable the PV industry to build capacity. Future markets for PV include new homes, commercial buildings and the existing housing stock. With a properly designed system, it is forecasted that the deployment of PV by 2025 could result in the involvement of 400,000 homes with over 1200 MW of installed capacity and over 290 MW installed annually by 2025. Recommendations to Ontario Power Authority's (OPA) report supply mix report focused on the use of SOCs as the appropriate support mechanism to start building solar capacity in Ontario, as projections using SOCs would see Ontario following the growth patterns of other nations. It was concluded that the OPA report does not acknowledge the current growth rates of PV globally, nor does it fully consider the potential of PV in Ontario. 9 refs., 8 figs

Arabidopsis seedling flood-inoculation technique: a rapid and reliable assay for studying plant-bacterial interactions

Directory of Open Access Journals (Sweden)

Uppalapati Srinivasa R

2011-10-01

Full Text Available Abstract Background The Arabidopsis thaliana-Pseudomonas syringae model pathosystem is one of the most widely used systems to understand the mechanisms of microbial pathogenesis and plant innate immunity. Several inoculation methods have been used to study plant-pathogen interactions in this model system. However, none of the methods reported to date are similar to those occurring in nature and amicable to large-scale mutant screens. Results In this study, we developed a rapid and reliable seedling flood-inoculation method based on young Arabidopsis seedlings grown on MS medium. This method has several advantages over conventional soil-grown plant inoculation assays, including a shorter growth and incubation period, ease of inoculation and handling, uniform infection and disease development, requires less growth chamber space and is suitable for high-throughput screens. In this study we demonstrated the efficacy of the Arabidopsis seedling assay to study 1 the virulence factors of P. syringae pv. tomato DC3000, including type III protein secretion system (TTSS and phytotoxin coronatine (COR; 2 the effector-triggered immunity; and 3 Arabidopsis mutants affected in salicylic acid (SA- and pathogen-associated molecular pattern (PAMPs-mediated pathways. Furthermore, we applied this technique to study nonhost resistance (NHR responses in Arabidopsis using nonhost pathogens, such as P. syringae pv. tabaci, pv. glycinea and pv. tomato T1, and confirmed the functional role of FLAGELLIN-SENSING 2 (FLS2 in NHR. Conclusions The Arabidopsis seedling flood-inoculation assay provides a rapid, efficient and economical method for studying Arabidopsis-Pseudomonas interactions with minimal growth chamber space and time. This assay could also provide an excellent system for investigating the virulence mechanisms of P. syringae. Using this method, we demonstrated that FLS2 plays a critical role in conferring NHR against nonhost pathovars of P. syringae, but not to

Step-Up Partial Power DC-DC Converters for Two-Stage PV Systems with Interleaved Current Performance

Directory of Open Access Journals (Sweden)

Jaime Wladimir Zapata

2018-02-01

Full Text Available This work presents a partial power converter allowing us to obtain, with a single DC-DC converter, the same feature as the classical interleaved operation of two converters. More precisely, the proposed topology performs similarly as the input-parallel output-series (IPOS configuration reducing the current ripple at the input of the system and dividing the individual converters power rating, compared to a single converter. The proposed topology consists of a partial DC-DC converter processing only a fraction of the total power, thus allowing high efficiency. Experimental results are provided to validate the proposed converter topology with a Flyback-based 100 W test bench with a transformer turns ratio n 1 = n 2 . Experimental results show high performances reducing the input current ripple around 30 % , further increasing the conversion efficiency.

Inhibition of apoptic cell death induced by Pseudomonas syringae pv. Tabaci and mycotoxin fumonisin B1

NARCIS (Netherlands)

Iakimova, E.T.; Batchvorova, R.; Kapchina, V.; Popov, T.; Atanassov, A.; Woltering, E.J.

2004-01-01

The impact of programmed cell death (PCD) inhibitors on lesion formation and biochemical events in transgenic (ttr line) and non-transgenic (Nevrokop 1164) tobacco infected with Pseudomonas syringae pv. tabaci was tested. Programmed cell death in tomato cell culture was induced by Fumonisin B1 (FUM)

Antagonistic activity of Bacillus subtilis SB1 and its biocontrol effect on tomato bacterial wilt

Science.gov (United States)

A potential biocontrol agent of bacterial wilt, Bacillus subtilis SB1, isolated from tomato roots, showed a broad-spectrum of antimicrobial activity in in vitro experiments. It inhibited the growth of many plant pathogens, including Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, Fusarium ox...

DC-link Voltage Control to Compensate Voltage Deviation for PV–BESSs Integrated System in Low-Voltage (LV Networks

Directory of Open Access Journals (Sweden)

Lee Gyu-sub

2016-01-01

Full Text Available The exhaustion of fossil fuel and the greenhouse gas emission are one of the most significant energy and environmental issues, respectively. Photovoltaic (PV generators and battery energy storage systems (BESSs have been significantly increased for recent years. The BESSs are mainly used for smoothing active power fluctuation of the PV. In this paper, PV–BESSs integration of two DC/DC converters and one AC/DC converter is investigated and DC-link voltage control to compensate the AC voltage deviation is proposed for the PV‒BESS system in low-voltage (LV networks.

Experimental grid connected PV system power analysis

Science.gov (United States)

Semaoui, Smail; Abdeladim, Kamel; Arab, Amar Hadj; Boulahchich, Saliha; Amrouche, Said Ould; Yassaa, Noureddine

2018-05-01

Almost 80 % of Algerian territory is appropriate for the exploitation of solar energy. The Algerian energetic strategy provides a substantial injection of PV electricity to the national grid. Currently, about 344 MWp of PV arrays which corresponds approximately to 2,34 km2 of module surfaces, are connected on electricity grid over the national territory. The Algerian Northern regions are characterized by strong pollution and high humidity. These phenomena affect the energetic productivity of PV generator. The objective of our study is to analyze experimental grid connected PV system power in coastal locations. Hence, experiments have been conducted on three identical PV systems to determine the electrical performances. Transformer-less inverters are the most attractive for the ground-based photovoltaic (PV) system due to their efficiencies, reduced cost and weight. Besides, the absence of the galvanic isolation generates problems of capacitive leakage current on the AC side and the degradation of the insulation resistance on the DC side of the inverter. In this work, experimental study of the behavior of single-phase inverters without transformers is presented. The main objective of this work is to study the degradation of the insulation resistance at the input of the inverter, and the capacitive leakage current at the output of the inverter. This study was achieved at the CDER on a rainy day of 15/03/2017, on the first PV plant connected to the low voltage network in Algeria. This investigation can help forecasting the PV array energetic production by taking into account natural conditions.

Parameter Improved Particle Swarm Optimization Based Direct-Current Vector Control Strategy for Solar PV System

Directory of Open Access Journals (Sweden)

NAMMALVAR, P.

2018-02-01

Full Text Available This paper projects Parameter Improved Particle Swarm Optimization (PIPSO based direct current vector control technology for the integration of photovoltaic array in an AC micro-grid to enhance the system performance and stability. A photovoltaic system incorporated with AC micro-grid is taken as the pursuit of research study. The test system features two power converters namely, PV side converter which consists of DC-DC boost converter with Perturbation and Observe (P&O MPPT control to reap most extreme power from the PV array, and grid side converter which consists of Grid Side-Voltage Source Converter (GS-VSC with proposed direct current vector control strategy. The gain of the proposed controller is chosen from a set of three values obtained using apriori test and tuned through the PIPSO algorithm so that the Integral of Time multiplied Absolute Error (ITAE between the actual and the desired DC link capacitor voltage reaches a minimum and allows the system to extract maximum power from PV system, whereas the existing d-q control strategy is found to perform slowly to control the DC link voltage under varying solar insolation and load fluctuations. From simulation results, it is evident that the proposed optimal control technique provides robust control and improved efficiency.

Grid tied PV/battery system architecture and power management for fast electric vehicle charging

Science.gov (United States)

Badawy, Mohamed O.

The prospective spread of Electric vehicles (EV) and plug-in hybrid electric vehicles (PHEV) arises the need for fast charging rates. Higher charging rates requirements lead to high power demands, which cant be always supported by the grid. Thus, the use of on-site sources alongside the electrical grid for EVs charging is a rising area of interest. In this dissertation, a photovoltaic (PV) source is used to support the high power EVs charging. However, the PV output power has an intermittent nature that is dependable on the weather conditions. Thus, battery storage are combined with the PV in a grid tied system, providing a steady source for on-site EVs use in a renewable energy based fast charging station. Verily, renewable energy based fast charging stations should be cost effective, efficient, and reliable to increase the penetration of EVs in the automotive market. Thus, this Dissertation proposes a novel power flow management topology that aims on decreasing the running cost along with innovative hardware solutions and control structures for the developed architecture. The developed power flow management topology operates the hybrid system at the minimum operating cost while extending the battery lifetime. An optimization problem is formulated and two stages of optimization, i.e online and offline stages, are adopted to optimize the batteries state of charge (SOC) scheduling and continuously compensate for the forecasting errors. The proposed power flow management topology is validated and tested with two metering systems, i.e unified and dual metering systems. The results suggested that minimal power flow is anticipated from the battery storage to the grid in the dual metering system. Thus, the power electronic interfacing system is designed accordingly. Interconnecting bi-directional DC/DC converters are analyzed, and a cascaded buck boost (CBB) converter is chosen and tested under 80 kW power flow rates. The need to perform power factor correction (PFC) on

Performance of a directly-coupled PV water pumping system

International Nuclear Information System (INIS)

Mokeddem, Abdelmalek; Midoun, Abdelhamid; Kadri, D.; Hiadsi, Said; Raja, Iftikhar A.

2011-01-01

Highlights: → Directly coupled PV water pumping system installed and performance studied. → Configured for two static heads, operate without electronic control and auxiliary power. → The system attains steady state soon after any abrupt change. → Cost effective and useful for low head communicating wells system. - Abstract: This paper describes the experimental study carried out to investigate the performance of a simple, directly coupled dc photovoltaic (PV) powered water pumping system. The system comprises of a 1.5 kWp PV array, dc motor and a centrifugal pump. The experiment was conducted over a period of 4 months and the system performance was monitored under different climatic conditions and varying solar irradiance with two static head configurations. Although the motor-pump efficiency did not exceed 30%, which is typical for directly-coupled photovoltaic pumping systems, such a system is clearly suitable for low head irrigation in the remote areas, not connected to the national grid and where access to water comes as first priority issue than access to technology. The system operates without battery and complex electronic control, therefore not only the initial cost is low but also maintenance, repairing and replacement cost can be saved. The study showed that directly coupled system attains steady state soon after any abrupt change.

Tracking the global maximum power point of PV arrays under partial shading conditions

Science.gov (United States)

Fennich, Meryem

This thesis presents the theoretical and simulation studies of the global maximum power point tracking (MPPT) for photovoltaic systems under partial shading. The main goal is to track the maximum power point of the photovoltaic module so that the maximum possible power can be extracted from the photovoltaic panels. When several panels are connected in series with some of them shaded partially either due to clouds or shadows from neighboring buildings, several local maxima appear in the power vs. voltage curve. A power increment based MPPT algorithm is effective in identifying the global maximum from the several local maxima. Several existing MPPT algorithms are explored and the state-of-the-art power increment method is simulated and tested for various partial shading conditions. The current-voltage and power-voltage characteristics of the PV model are studied under different partial shading conditions, along with five different cases demonstrating how the MPPT algorithm performs when shading switches from one state to another. Each case is supplemented with simulation results. The method of tracking the Global MPP is based on controlling the DC-DC converter connected to the output of the PV array. A complete system simulation including the PV array, the direct current to direct current (DC-DC) converter and the MPPT is presented and tested using MATLAB software. The simulation results show that the MPPT algorithm works very well with the buck converter, while the boost converter needs further changes and implementation.

dc Arc Fault Effect on Hybrid ac/dc Microgrid

Science.gov (United States)

Fatima, Zahra

The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

PV Power-Generation System with a Phase-Shift PWM Technique for High Step-Up Voltage Applications

Directory of Open Access Journals (Sweden)

Cheng-Tao Tsai

2012-01-01

Full Text Available A PV power-generation system with a phase-shift pulse-width modulation (PWM technique for high step-up voltage applications is proposed. The proposed power-generation system consists of two stages. In the input stage, all power switches of the full-bridge converter with phase-shift technique can be operated with zero-current switching (ZCS at turn-on or turn-off transition. Hence, the switching losses of the power switches can be reduced. Then, in the DC output stage, a voltage-doubler circuit is used to boost a high dc-link bus voltage. To supply a utility power, a dc/ac inverter is connected to induce a sinusoidal source. In order to draw a maximum power from PV arrays source, a microcontroller is incorporated with the perturbation and observation method to implement maximum power point tracking (MPPT algorithm and power regulating scheme. In this study, a full load power of 300 W prototype has been built. Experimental results are presented to verify the performance and feasibility of the proposed PV power-generation system.

Optimizing Energy Savings from Direct-DC in U.S. Residential Buildings

Energy Technology Data Exchange (ETDEWEB)

Garbesi, Karina; Vossos, Vagelis; Sanstad, Alan; Burch, Gabriel

2011-10-13

An increasing number of energy efficient appliances operate on direct current (DC) internally, offering the potential to use DC from renewable energy systems directly and avoiding the losses inherent in converting power to alternating current (AC) and back. This paper investigates that potential for net-metered residences with on-site photovoltaics (PV) by modeling the net power draw of the ‘direct-DC house’ with respect to today’s typical configuration, assuming identical DC-internal loads. Power draws were modeled for houses in 14 U.S. cities, using hourly, simulated PV-system output and residential loads. The latter were adjusted to reflect a 33% load reduction, representative of the most efficient DC-internal technology, based on an analysis of 32 electricity end-uses. The model tested the effect of climate, electric vehicle (EV) loads, electricity storage, and load shifting on electricity savings; a sensitivity analysis was conducted to determine how future changes in the efficiencies of power system components might affect savings potential. Based on this work, we estimate that net-metered PV residences could save 5% of their total electricity load for houses without storage and 14% for houses with storage. Based on residential PV penetration projections for year 2035 obtained from the National Energy Modeling System (2.7% for the reference case and 11.2% for the extended policy case), direct-DC could save the nation 10 trillion Btu (without storage) or 40 trillion Btu (with storage). Shifting the cooling load by two hours earlier in the day (pre-cooling) has negligible benefits for energy savings. Direct-DC provides no energy savings benefits for EV charging, to the extent that charging occurs at night. However, if charging occurred during the day, for example with employees charging while at work, the benefits would be large. Direct-DC energy savings are sensitive to power system and appliance conversion efficiencies but are not significantly

Energy management for a PEMFC–PV hybrid system

International Nuclear Information System (INIS)

Karami, Nabil; Moubayed, Nazih; Outbib, Rachid

2014-01-01

Highlights: • The proposed hybrid structure is a grid-connected system composed of a PV panel, a FC, a battery, and a SC. • The output voltage of each component is regulated using a buck converter controlled by a type-III compensator. • All these components share one DC bus. • Loads can be the used battery, the grid, a DC load and/or an AC load. • The proposed topology offers a simple management technique using a low cost system controller. - Abstract: Most renewable energy sources depend on climatic circumstances and lack consistency even during a single day. The Hybrid System (HS) solves this drawback by relying on many types of renewable sources and managing them to get a satisfactory continuous power. In this paper, a grid connected HS composed of a Proton Exchange Membrane Fuel Cell (PEMFC), a Photovoltaic panel (PV), a battery and a Supercapacitor (SC) is proposed. Sources are pushed to deliver their maximum power thanks to a Maximum Power Point Tracker (MPPT). The output voltage of each component is regulated using a buck converter controlled by a type-III compensator. Consequently, HS components share the power on a single DC bus. The proposed topology offers a simple management technique using an affordable system controller. In order to illustrate our approach, a prototype is modeled, simulated and implemented on an emulator of a real system

Economic impacts of the solar PV sector in Ontario 2008-2018

International Nuclear Information System (INIS)

2011-07-01

Over the next 20 years most of the electricity generating facilities in Ontario will need to be replaced or refurbished and the electricity demand will rise by 15%. The province has adopted a long term energy plan (LTEP) to prepare for these changes; its objectives are to reduce demand and to produce electricity from nuclear power and renewable energy sources by 2030. The LTEP foresees the installation of 3,000 MW solar photovoltaic (PV) energy by 2018 in Ontario and the aim of this report is to determine the economic effects of this development on investments, job creation and cost to customers. Over 150 interviews and 100 surveys were carried out with solar PV stakeholders. It was found that the solar PV market in Ontario will drive $13 billion of private investment, create 74,000 jobs at a cost of $5 per month to electricity customers by 2018.

A local energy management of a hybrid PV-storage based distributed generation for microgrids

International Nuclear Information System (INIS)

Choudar, Adel; Boukhetala, Djamel; Barkat, Said; Brucker, Jean-Michel

2015-01-01

Highlights: • The proposed system is based on photovoltaic system, batteries and ultra-capacitors. • Batteries are used as an energy source, ultra-capacitors are used as a fast power regulator. • An energy management strategy, to operate a grid connected active PV system (APS). • Different levels of the control system are studied and organized in a hierarchical control structure. • Different operating modes are explained (island, limited PV power, normal, fast recovering). - Abstract: The presented work focuses on energy management strategy, to operate a grid connected active PV system (APS) in a microgrid. A microgrid is a smart grid in a small scale which can be stand-alone or grid-tied. The proposed system is based on photovoltaic system, batteries and ultra-capacitors. Three converters are used to interface the elements of the APS to a common DC-link capacitor. The presented control strategy manages the power flow between the converters and the grid through the DC-link in order to maintain the grid power demand coming from the grid operator. Batteries are used as an energy source, to stabilize and permit the APS units to run at a constant and stable output power, damping peak surges in electricity demand and to store the excess of energy from the PV array. Ultra-capacitors are used as a fast power regulator to: limit the battery’s current, regulate the DC-link voltage when the disconnection mode occurs and to deliver a smooth power to the grid, despite primary source and load fluctuations. Several operating modes are presented to manage locally the power flows between the various sources, taking into account the state of charge of batteries (SOC), the energy level of ultra-capacitors (Lev), the available PV power and the power demand from the grid operator

Integration of Hybrid PV/Wind Generation System Using Fuzzy MPPT in Grid Connected System for Remote Area

Directory of Open Access Journals (Sweden)

Soedibyo

2016-01-01

Full Text Available Photovoltaic and wind are renewable energy resources that widely used and grow rapidly in fulfilling electricity demand. Powers from both technologies depend on sunlight intensity and wind speed. For small scale power generation, DC voltage from both technologies is low and requires step-up converter to raise DC voltage ratio before converted into AC voltage. To optimize this system, step-up converter must have high ratio and efficiency to a distance of wide voltage input. This paper proposed an operation simulation and arrangement of DC-DC converter along with DC-AC from hybrid source PV-Wind which integrated to grid utilities without using storage device. High Gain Integrated Cascade Boost (HGICB is DC-DC converter that has quadratic voltage ratio and used in this research. Then DC link connected to Voltage Source Inverter (VSI which interconnected with utility grid and controlled by current control method. The total installed capacity of hybrid source is 4.4 kW. Wind turbine uses PMSG along with full bridge rectifier. To maximize and stabilize the generated power, MPPT fuzzy is used. Result from the simulation shows that converter capable to maintain maximum power whether from PV and wind turbine which canalized to utility grid in various irradiation condition, wind speed, and grid load alteration.

Grid-Forming-Mode Operation of Boost-Power-Stage Converter in PV-Generator-Interfacing Applications

Directory of Open Access Journals (Sweden)

Jukka Viinamäki

2017-07-01

Full Text Available The application of constant power control and inclusion of energy storage in grid-connected photovoltaic (PV energy systems may increase the use of two-stage system structures composed of DC–DC-converter-interfaced PV generator and grid-connected inverter connected in cascade. A typical PV-generator-interfacing DC–DC converter is a boost-power-stage converter. The renewable energy system may operate in three different operation modes—grid-forming, grid-feeding, and grid-supporting modes. In the last two operation modes, the outmost feedback loops are taken from the input terminal of the associated power electronic converters, which usually does not pose stability problems in terms of their input sources. In the grid-forming operation mode, the outmost feedback loops have to be connected to the output terminal of the associated power electronic converters, and hence the input terminal will behave as a negative incremental resistor at low frequencies. This property will limit the operation of the PV interfacing converter in either the constant voltage or constant current region of the PV generator for ensuring stable operation. The boost-power-stage converter can be applied as a voltage or current-fed converter limiting the stable operation region accordingly. The investigations of this paper show explicitly that only the voltage-fed mode would provide feasible dynamic and stability properties as a viable interfacing converter.

The Moroccan solar plan. A comparative analysis of CSP and PV utilization until 2020

International Nuclear Information System (INIS)

Richts, Christoph

2012-01-01

The present master thesis conducts technical and economic simulations of large-scale Photovoltaic (PV) and Concentrated Solar Power (CSP) plants for the Moroccan Solar Plan. It provides a database of performance indicators such as energy yields, capacity factors, typical efficiencies and losses of technical components, LCOE, and difference costs (DC: LCOE minus avoided costs of the conventional power system) for fixed tilted, 1-axis horizontal, 1-axis vertical and 2-axis tracking PV and CSP with no, 6, 12 and 18 full load hours of thermal storage. HelioClim irradiation data of 2005 for the sites in Ouarzazate, Ain Ben Mathar, Boujdour, Laayoune and Tarfaya is used ranging between 1,927 - 2,428 kWh/m 2 /y (DNI) and 1,968 - 2,154 kWh/m 2 /y (GHI). In the base scenario minimum LCOE are 9.6 - 5.4 EURct/kWh for PV (2012 - 2020) varying between 0.90 - 1.55 EURct/kWh among sites and technologies. CSP reaches 12.8 - 9.2 EURct/kWh and a bandwidth of 2.3 - 1.6 EURct/kWh. Average DC are lowest for horizontal 1-axis tracking (0.4 and -7.7 EURct/kWh for plants built in 2012 and 2020 respectively) and CSP with 6 hours of storage (1.3 and -3.5 EURct/kWh). PV is cheaper for all sites and technologies due to higher learning curves and less initial investment, but cannot contribute to coverage of the daily evening peak in Morocco. Four different MSP-scenarios with 2000 MW of solar energy require total investments of 3.7 - 7.5 billion EUR and yield 7.9% - 12.8% of the electricity demand in 2020 (given a growth 7%/y) depending on the ratio of PV and CSP utilization. The average LCOE are 8.3 - 11.7 EURct/kWh and the total discounted DC (10%/y) are -254 - 391 million EUR. Thus, solar energy is partly less expensive than a business-as-usual scenario. An extensive sensitivity analysis for WACC and price escalation of conventional energy shows that for only PV and only CSP scenarios in 55 and 22 out of 72 cases the DC are negative - although no environmental costs for conventional

Independent control strategy of two DC-link voltages for separate MPPTs in transformerless photovoltaic systems using neutral-point-clamped inverters

DEFF Research Database (Denmark)

Choi, Uimin; Blaabjerg, Frede; Lee, Kyo-Beum

2014-01-01

To improve the efficiency of the photovoltaic (PV) system, the centralized topology using three-level inverters are widely used. In this system, PV modules are separately connected to the split DC-links. This causes a decrease of maximum power point tracking (MPPT) efficiency under the partial...... shading condition. This paper proposes an independent control of two DC-link voltages for separate MPPT of each PV module in three-level inverters. The proposed method is simply implemented by adding or subtracting the time-offset to the three-phase turn-on times and modifying the reference voltages...

Novel Field test design and initial result for AC and DC characterization for PV-panels

DEFF Research Database (Denmark)

Thorsteinsson, Sune; Riedel, Nicholas; Santamaria Lancia, Adrian Alejo

This work describes the design and initial test results of a field test for PV modules, where the PV modules the majority of the time operates to produce power at their maximum power point. Sequentially the individual modules are switched into a measurement circuitry for IV curves and impedance s...

Modified Grid-Connected CSI for Hybrid PV/Wind Power Generation System

Directory of Open Access Journals (Sweden)

D. Amorndechaphon

2012-01-01

Full Text Available The principle of a power conditioning unit for hybrid PV/wind power generation system is proposed. The proposed power conditioner is based on the current source inverter (CSI topology. All energy sources are connected in parallel with a DC-bus through the modified wave-shaping circuits. To achieve the unity power factor at the utility grid, the DC-link current can be controlled via the wave-shaping circuits with the sinusoidal PWM scheme. In this work, the carrier-based PWM scheme is also proposed to minimize the utility current THD. The power rating of the proposed system can be increased by connecting more PV/wind modules through their wave-shaping circuits in parallel with the other modules. The details of the operating principles, the system configurations, and the design considerations are described. The effectiveness of the proposed CSI is demonstrated by simulation results.

A Review on Current Reference Calculation of Three-Phase Grid-Connected PV Converters under Grid Faults

DEFF Research Database (Denmark)

Afshari, Ehsan; Moradi, Gholam Reza; Yang, Yongheng

2017-01-01

Unbalanced grid voltage dips may lead to unbalanced non-sinusoidal current injections, dc-link voltage oscillations, and active and/or reactive power oscillations with twice the grid fundamental frequency in three-phase grid-connected Photovoltaic (PV) systems. Double grid frequency oscillations...... of the most important issues that should be coped with for a reliable operation of grid-connected converters under unbalanced grid faults. Accordingly, this paper reviews the existing CRC methods and presents a current reference generation method, which can have 16 unique modes. Issues are also investigated...... at the dc-link of the conventional two-stage PV inverters can further deteriorate the dc-link capacitor, which is one of the most life-limiting components in the system. Proper controls of these converters may efficiently address this problem. In those solutions, Current Reference Calculation (CRC) is one...

Instantaneous thermal modeling of the DC-link capacitor in PhotoVoltaic systems

DEFF Research Database (Denmark)

Yang, Yongheng; Ma, Ke; Wang, Huai

2015-01-01

, instantaneous thermal modeling approaches considering mission profiles for the DC-link capacitor in single-phase PV systems are explored in this paper. These thermal modelling approaches are based on: a) fast Fourier transform, b) look-up tables, and c) ripple current reconstruction. Moreover, the thermal...... grid-connected PV system have been adopted to demonstrate a look-up table based modelling approach, where real-field daily ambient conditions are considered....... modelling approaches for the DC-link capacitors take into account the instantaneous thermal characteristics, which are more challenging to the capacitor reliability during operation. Such instantaneous thermal modeling approaches enable a translation of instantaneous capacitor power losses to capacitor...

Application of DC-AC Hybrid Grid and Solar Photovoltaic Generation with Battery Storage Using Smart Grid

Directory of Open Access Journals (Sweden)

Shoaib Rauf

2017-01-01

Full Text Available Smart grid for the past few years has been the prime focus of research in power systems. The aim is to eliminate load shedding and problematic blackout conditions, further offering cheap and continuous supply of electricity for both large and small consumers. Another benefit is to integrate renewable energy resources with existing dump grid in more efficient and cost-effective manner. In past few years, growing demand for sustainable energy increases the consumption of solar PV. Since generation from solar PV is in DC and most of the appliances at home could be operated on DC, AC-DC hybrid distribution system with energy management system is proposed in this paper. EMS helps to shift or control the auxiliary load and compel the users to operate specific load at certain time slots. These techniques further help to manage the excessive load during peak and off peak hours. It demonstrates the practical implementation of DC-AC network with integration of solar PV and battery storage with existing infrastructure. The results show a remarkable improvement using hybrid AC-DC framework in terms of reliability and efficiency. All this functioning together enhances the overall efficiency; hence, a secure, economical, reliable, and intelligent system leads to a smart grid.

Maximum Power Point Tracking for Brushless DC Motor-Driven Photovoltaic Pumping Systems Using a Hybrid ANFIS-FLOWER Pollination Optimization Algorithm

Directory of Open Access Journals (Sweden)

Neeraj Priyadarshi

2018-04-01

Full Text Available In this research paper, a hybrid Artificial Neural Network (ANN-Fuzzy Logic Control (FLC tuned Flower Pollination Algorithm (FPA as a Maximum Power Point Tracker (MPPT is employed to amend root mean square error (RMSE of photovoltaic (PV modeling. Moreover, Gaussian membership functions have been considered for fuzzy controller design. This paper interprets the Luo converter occupied brushless DC motor (BLDC-directed PV water pump application. Experimental responses certify the effectiveness of the suggested motor-pump system supporting diverse operating states. The Luo converter, a newly developed DC-DC converter, has high power density, better voltage gain transfer and superior output waveform and can track optimal power from PV modules. For BLDC speed control there is no extra circuitry, and phase current sensors are enforced for this scheme. The most recent attempt using adaptive neuro-fuzzy inference system (ANFIS-FPA-operated BLDC directed PV pump with advanced Luo converter, has not been formerly conferred.

Firefighter safety for PV systems: Overview of future requirements and protection systems

DEFF Research Database (Denmark)

Spataru, Sergiu; Sera, Dezso; Blaabjerg, Frede

2013-01-01

for operators during maintenance or fire-fighting. One of the solutions is individual module shutdown by short-circuiting or disconnecting each PV module from the PV string. However, currently no standards have been adopted either for implementing or testing these methods, or doing an evaluation of the module...... shutdown procedures. This paper gives an overview on the most recent fire - and firefighter safety requirements for PV systems, with focus on system and module shutdown systems. Several solutions are presented, analyzed and compared by considering a number of essential characteristics, including......An important and highly discussed safety issue for photovoltaic systems is that, as long as they are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters, independent of the state of the inverter's dc disconnection switch, which poses a risk...

Hydrogen Production from Optimal Wind-PV Energies Systems

Energy Technology Data Exchange (ETDEWEB)

Tafticht, T.; Agbossou, K. [Institut de recherche sur l hydrogene, Universite du Quebec - Trois-Rivieres, C.P. 500, Trois-Rivieres, (Ciheam), G9A 5H7, (Canada)

2006-07-01

Electrolytic hydrogen offers a promising alternative for long-term energy storage of renewable energies (RE). A stand-alone RE system based on hydrogen production has been developed at the Hydrogen Research Institute and successfully tested for automatic operation with designed control devices. The system is composed of a wind turbine, a photovoltaic (PV) array, an electrolyser, batteries for buffer energy storage, hydrogen and oxygen storage tanks, a fuel cell, AC and DC loads, power conditioning devices and different sensors. The long-term excess energy with respect to load demand has been sent to the electrolyser for hydrogen production and then the fuel cell has utilised this stored hydrogen to produce electricity when there were insufficient wind and solar energies with respect to load requirements. The RE system components have substantially different voltage-current characteristics and they are integrated on the DC bus through power conditioning devices for optimal operation by using the developed Maximum Power Point Tracking (MPPT) control method. The experimental results show that the power gain obtained by this method clearly increases the hydrogen production and storage rate from wind-PV systems. (authors)

Hydrogen Production from Optimal Wind-PV Energies Systems

International Nuclear Information System (INIS)

T Tafticht; K Agbossou

2006-01-01

Electrolytic hydrogen offers a promising alternative for long-term energy storage of renewable energies (RE). A stand-alone RE system based on hydrogen production has been developed at the Hydrogen Research Institute and successfully tested for automatic operation with designed control devices. The system is composed of a wind turbine, a photovoltaic (PV) array, an electrolyzer, batteries for buffer energy storage, hydrogen and oxygen storage tanks, a fuel cell, AC and DC loads, power conditioning devices and different sensors. The long-term excess energy with respect to load demand has been sent to the electrolyser for hydrogen production and then the fuel cell has utilised this stored hydrogen to produce electricity when there were insufficient wind and solar energies with respect to load requirements. The RE system components have substantially different voltage-current characteristics and they are integrated on the DC bus through power conditioning devices for optimal operation by using the developed Maximum Power Point Tracking (MPPT) control method. The experimental results show that the power gain obtained by this method clearly increases the hydrogen production and storage rate from wind-PV systems. (authors)

Hydrogen Production from Optimal Wind-PV Energies Systems

International Nuclear Information System (INIS)

Tafticht, T.; Agbossou, K.

2006-01-01

Electrolytic hydrogen offers a promising alternative for long-term energy storage of renewable energies (RE). A stand-alone RE system based on hydrogen production has been developed at the Hydrogen Research Institute and successfully tested for automatic operation with designed control devices. The system is composed of a wind turbine, a photovoltaic (PV) array, an electrolyser, batteries for buffer energy storage, hydrogen and oxygen storage tanks, a fuel cell, AC and DC loads, power conditioning devices and different sensors. The long-term excess energy with respect to load demand has been sent to the electrolyser for hydrogen production and then the fuel cell has utilised this stored hydrogen to produce electricity when there were insufficient wind and solar energies with respect to load requirements. The RE system components have substantially different voltage-current characteristics and they are integrated on the DC bus through power conditioning devices for optimal operation by using the developed Maximum Power Point Tracking (MPPT) control method. The experimental results show that the power gain obtained by this method clearly increases the hydrogen production and storage rate from wind-PV systems. (authors)

Hydrogen Production from Optimal Wind-PV Energies Systems

Energy Technology Data Exchange (ETDEWEB)

T Tafticht; K Agbossou [Institut de recherche sur l hydrogene, Universite du Quebec - Trois-Rivieres, C.P. 500, Trois-Rivieres, (Ciheam), G9A 5H7, (Canada)

2006-07-01

Electrolytic hydrogen offers a promising alternative for long-term energy storage of renewable energies (RE). A stand-alone RE system based on hydrogen production has been developed at the Hydrogen Research Institute and successfully tested for automatic operation with designed control devices. The system is composed of a wind turbine, a photovoltaic (PV) array, an electrolyzer, batteries for buffer energy storage, hydrogen and oxygen storage tanks, a fuel cell, AC and DC loads, power conditioning devices and different sensors. The long-term excess energy with respect to load demand has been sent to the electrolyser for hydrogen production and then the fuel cell has utilised this stored hydrogen to produce electricity when there were insufficient wind and solar energies with respect to load requirements. The RE system components have substantially different voltage-current characteristics and they are integrated on the DC bus through power conditioning devices for optimal operation by using the developed Maximum Power Point Tracking (MPPT) control method. The experimental results show that the power gain obtained by this method clearly increases the hydrogen production and storage rate from wind-PV systems. (authors)

Maximum power point tracking controller for PV systems using neural networks

Energy Technology Data Exchange (ETDEWEB)

Bahgat, A.B.G. [Cairo Univ. (Egypt). Faculty of Engineering; Helwa, N.H.; Ahmad, G.E.; El Shenawy, E.T. [National Research Center, Dokki, Cairo (Egypt). Solar Energy Dept.

2005-07-01

This paper presents a development and implementation of a PC-based maximum power point tracker (MPPT) for PV system using neural networks (NN). The system consists of a PV module via a MPPT supplying a dc motor that drives an air fan. The control algorithm is developed to use the artificial NN for detecting the optimal operating point under different operating conditions, then the control action gives the driving signals to the MPPT. A PC is used for data acquisition, running the control algorithm, data storage, as well as data display and analysis. The system has been implemented and tested under various operating conditions. The experimental results showed that the PV system with MPPT always tracks the peak power point of the PV module under various operating conditions. The MPPT transmits about 97% of the actual maximum power generated by the PV module. The MPPT not only increases the power from the PV module to the load, but also maintains longer operating periods for the PV system. The air velocity and the air mass flow rate of the mechanical load are increased considerably, due to the increase of the PV system power. It is also found that the increase in the output energy due to using the MPPT is about 45.2% for a clear sunny day. (Author)

PV source based high voltage gain current fed converter

Science.gov (United States)

Saha, Soumya; Poddar, Sahityika; Chimonyo, Kudzai B.; Arunkumar, G.; Elangovan, D.

2017-11-01

This work involves designing and simulation of a PV source based high voltage gain, current fed converter. It deals with an isolated DC-DC converter which utilizes boost converter topology. The proposed converter is capable of high voltage gain and above all have very high efficiency levels as proved by the simulation results. The project intends to produce an output of 800 V dc from a 48 V dc input. The simulation results obtained from PSIM application interface were used to analyze the performance of the proposed converter. Transformer used in the circuit steps up the voltage as well as to provide electrical isolation between the low voltage and high voltage side. Since the converter involves high switching frequency of 100 kHz, ultrafast recovery diodes are employed in the circuitry. The major application of the project is for future modeling of solar powered electric hybrid cars.

A Decentralized Control Architecture applied to DC Nanogrid Clusters for Rural Electrification in Developing Regions

DEFF Research Database (Denmark)

Nasir, Mashood; Jin, Zheming; Khan, Hassan

2018-01-01

resources with the community. An adaptive I-V droop method is used which relies on local measurements of SOC and DC bus voltage for the coordinated power sharing among the contributing nanogrids. PV generation capability of individual nanogrids is synchronized with the grid stability conditions through......DC microgrids built through bottom-up approach are becoming very popular for swarm electrification due to their scalability and resource sharing capabilities. However, they typically require sophisticated control techniques involving communication among the distributed resources for stable...... and coordinated operation. In this work, we present a communication-less strategy for the decentralized control of a PV/battery-based highly distributed DC microgrid. The architecture consists of clusters of nanogrids (households), where each nanogrid can work independently along with provisions of sharing...

Building Integrated PV and PV/Hybrid Products - The PV:BONUS Experience: Preprint

Energy Technology Data Exchange (ETDEWEB)

Thomas, H.; Pierce, L. K.

2001-10-01

Presented at the 2001 NCPV Program Review Meeting: Successes and lessons learned from PV:BONUS (Building Opportunities in the United States in PV). This program has funded the development of PV or PV/hybrid products for building applications.

Multi-Input Converter with MPPT Feature for Wind-PV Power Generation System

Directory of Open Access Journals (Sweden)

Chih-Lung Shen

2013-01-01

Full Text Available A multi-input converter (MIC to process wind-PV power is proposed, designed, analyzed, simulated, and implemented. The MIC cannot only process solar energy but deal with wind power, of which structure is derived from forward-type DC/DC converter to step-down/up voltage for charger systems, DC distribution applications, or grid connection. The MIC comprises an upper modified double-ended forward, a lower modified double-ended forward, a common output inductor, and a DSP-based system controller. The two modified double-ended forwards can operate individually or simultaneously so as to accommodate the variation of the hybrid renewable energy under different atmospheric conditions. While the MIC operates at interleaving mode, better performance can be achieved and volume also is reduced. The proposed MIC is capable of recycling the energy stored in the leakage inductance and obtaining high step-up output voltage. In order to draw maximum power from wind turbine and PV panel, perturb-and-observe method is adopted to achieve maximum power point tracking (MPPT feature. The MIC is constructed, analyzed, simulated, and tested. Simulations and hardware measurements have demonstrated the feasibility and functionality of the proposed multi-input converter.

High levels of cyclic-di-GMP in plant-associated Pseudomonas correlate with evasion of plant immunity.

Science.gov (United States)

Pfeilmeier, Sebastian; Saur, Isabel Marie-Luise; Rathjen, John Paul; Zipfel, Cyril; Malone, Jacob George

2016-05-01

The plant innate immune system employs plasma membrane-localized receptors that specifically perceive pathogen/microbe-associated molecular patterns (PAMPs/MAMPs). This induces a defence response called pattern-triggered immunity (PTI) to fend off pathogen attack. Commensal bacteria are also exposed to potential immune recognition and must employ strategies to evade and/or suppress PTI to successfully colonize the plant. During plant infection, the flagellum has an ambiguous role, acting as both a virulence factor and also as a potent immunogen as a result of the recognition of its main building block, flagellin, by the plant pattern recognition receptors (PRRs), including FLAGELLIN SENSING2 (FLS2). Therefore, strict control of flagella synthesis is especially important for plant-associated bacteria. Here, we show that cyclic-di-GMP [bis-(3'-5')-cyclic di-guanosine monophosphate], a central regulator of bacterial lifestyle, is involved in the evasion of PTI. Elevated cyclic-di-GMP levels in the pathogen Pseudomonas syringae pv. tomato (Pto) DC3000, the opportunist P. aeruginosa PAO1 and the commensal P. protegens Pf-5 inhibit flagellin synthesis and help the bacteria to evade FLS2-mediated signalling in Nicotiana benthamiana and Arabidopsis thaliana. Despite this, high cellular cyclic-di-GMP concentrations were shown to drastically reduce the virulence of Pto DC3000 during plant infection. We propose that this is a result of reduced flagellar motility and/or additional pleiotropic effects of cyclic-di-GMP signalling on bacterial behaviour. © 2015 THE AUTHORS MOLECULAR PLANT PATHOLOGY PUBLISHED BY BRITISH SOCIETY FOR PLANT PATHOLOGY AND JOHN WILEY & SONS LTD.

Highly efficient maximum power point tracking using DC-DC coupled inductor single-ended primary inductance converter for photovoltaic power systems

Science.gov (United States)

Quamruzzaman, M.; Mohammad, Nur; Matin, M. A.; Alam, M. R.

2016-10-01

Solar photovoltaics (PVs) have nonlinear voltage-current characteristics, with a distinct maximum power point (MPP) depending on factors such as solar irradiance and operating temperature. To extract maximum power from the PV array at any environmental condition, DC-DC converters are usually used as MPP trackers. This paper presents the performance analysis of a coupled inductor single-ended primary inductance converter for maximum power point tracking (MPPT) in a PV system. A detailed model of the system has been designed and developed in MATLAB/Simulink. The performance evaluation has been conducted on the basis of stability, current ripple reduction and efficiency at different operating conditions. Simulation results show considerable ripple reduction in the input and output currents of the converter. Both the MPPT and converter efficiencies are significantly improved. The obtained simulation results validate the effectiveness and suitability of the converter model in MPPT and show reasonable agreement with the theoretical analysis.

Identification of Isolates that Cause a Leaf Spot Disease of Brassicas as Xanthomonas campestris pv. raphani and Pathogenic and Genetic Comparison with Related Pathovars.

Science.gov (United States)

Vicente, J G; Everett, B; Roberts, S J

2006-07-01

ABSTRACT Twenty-five Xanthomonas isolates, including some isolates received as either X. campestris pv. armoraciae or pv. raphani, caused discrete leaf spot symptoms when spray-inoculated onto at least one Brassica oleracea cultivar. Twelve of these isolates and four other Xanthomonas isolates were spray- and pin-inoculated onto 21 different plant species/cultivars including horseradish (Armoracia rusticana), radish (Raphanus sativus), and tomato (Lycopersicon esculentum). The remaining 13 leaf spot isolates were spray-inoculated onto a subset of 10 plant species/cultivars. The leaf spot isolates were very aggressive on several Brassica spp., radish, and tomato causing leaf spots and dark sunken lesions on the middle vein, petiole, and stem. Based on the differential reactions of several Brassica spp. and radish cultivars, the leaf spot isolates were divided into three races, with races 1 and 3 predominating. A differential series was established to determine the race-type of isolates and a gene-for-gene model based on the interaction of two avirulence genes in the pathogen races and two matching resistance genes in the differential hosts is proposed. Repetitive-DNA polymerase chain reaction-based fingerprinting was used to assess the genetic diversity of the leaf spot isolates and isolates of closely related Xanthomonas pathovars. Although there was variability within each race, the leaf spot isolates were clustered separately from the X. campestris pv. campestris isolates. We propose that X. campestris isolates that cause a nonvascular leaf spot disease on Brassica spp. should be identified as pv. raphani and not pv. armoraciae. Race-type strains and a neopathotype strain for X. campestris pv. raphani are proposed.

Optimization of SiC-based H5 and conergy-NPC transformerless PV inverters

DEFF Research Database (Denmark)

Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

2015-01-01

The transformerless dc/ac inverters are critical components in the rapidly growing market of grid-connected photovoltaic (PV) applications. They are synthesized by combining available solutions in terms of the power-section topology, power-semiconductors manufacturing technology, and structure...

The Moroccan solar plan. A comparative analysis of CSP and PV utilization until 2020

Energy Technology Data Exchange (ETDEWEB)

Richts, Christoph

2012-02-15

The present master thesis conducts technical and economic simulations of large-scale Photovoltaic (PV) and Concentrated Solar Power (CSP) plants for the Moroccan Solar Plan. It provides a database of performance indicators such as energy yields, capacity factors, typical efficiencies and losses of technical components, LCOE, and difference costs (DC: LCOE minus avoided costs of the conventional power system) for fixed tilted, 1-axis horizontal, 1-axis vertical and 2-axis tracking PV and CSP with no, 6, 12 and 18 full load hours of thermal storage. HelioClim irradiation data of 2005 for the sites in Ouarzazate, Ain Ben Mathar, Boujdour, Laayoune and Tarfaya is used ranging between 1,927 - 2,428 kWh/m{sup 2}/y (DNI) and 1,968 - 2,154 kWh/m{sup 2}/y (GHI). In the base scenario minimum LCOE are 9.6 - 5.4 EURct/kWh for PV (2012 - 2020) varying between 0.90 - 1.55 EURct/kWh among sites and technologies. CSP reaches 12.8 - 9.2 EURct/kWh and a bandwidth of 2.3 - 1.6 EURct/kWh. Average DC are lowest for horizontal 1-axis tracking (0.4 and -7.7 EURct/kWh for plants built in 2012 and 2020 respectively) and CSP with 6 hours of storage (1.3 and -3.5 EURct/kWh). PV is cheaper for all sites and technologies due to higher learning curves and less initial investment, but cannot contribute to coverage of the daily evening peak in Morocco. Four different MSP-scenarios with 2000 MW of solar energy require total investments of 3.7 - 7.5 billion EUR and yield 7.9% - 12.8% of the electricity demand in 2020 (given a growth 7%/y) depending on the ratio of PV and CSP utilization. The average LCOE are 8.3 - 11.7 EURct/kWh and the total discounted DC (10%/y) are -254 - 391 million EUR. Thus, solar energy is partly less expensive than a business-as-usual scenario. An extensive sensitivity analysis for WACC and price escalation of conventional energy shows that for only PV and only CSP scenarios in 55 and 22 out of 72 cases the DC are negative - although no environmental costs for conventional

A novel quasi-master-slave control frame for PV-storage independent microgrid

DEFF Research Database (Denmark)

Yang, Jian; Yuan, Wenbin; Sun, Yao

2018-01-01

In microgrid, photovoltaic (PV) and storage are always combined as a droop-controlled ideal source, which is not very practical. Alternatively, this paper introduces a PV-storage independent system via allocating the PV-storage separately. For this structure, a novel quasi-master-slave control...... frame is proposed without communication. Storages work as master voltage sources, and PVs operate as current controlled voltage sources (CCVS). For the slave PVs, a MPPT-based power droop control and an adaptive reactive power control are proposed. Thus, PVs can simultaneously achieve maximum energy...... is analyzed to design the physical and control parameters, such as, the minimum capacitance value of DC side, droop coefficients. Finally, simulation and experimental results are presented to verify the system effectiveness....

Grid Connected Solar PV System with SEPIC Converter Compared with Parallel Boost Converter Based MPPT

Directory of Open Access Journals (Sweden)

T. Ajith Bosco Raj

2014-01-01

Full Text Available The main objective of this work is to study the behaviour of the solar PV systems and model the efficient Grid-connected solar power system. The DC-DC MPPT circuit using chaotic pulse width modulation has been designed to track maximum power from solar PV module. The conversion efficiency of the proposed MPPT system is increased when CPWM is used as a control scheme. This paper also proposes a simplified multilevel (seven level inverter for a grid-connected photovoltaic system. The primary goal of these systems is to increase the energy injected to the grid by keeping track of the maximum power point of the panel, by reducing the switching frequency, and by providing high reliability. The maximum power has been tracked experimentally. It is compared with parallel boost converter. Also this model is based on mathematical equations and is described through an equivalent circuit including a PV source with MPPT, a diode, a series resistor, a shunt resistor, and dual boost converter with active snubber circuit. This model can extract PV power and boost by using dual boost converter with active snubber. By using this method the overall system efficiency is improved thereby reducing the switching losses and cost.

A New Energy Management Technique for PV/Wind/Grid Renewable Energy System

Directory of Open Access Journals (Sweden)

Onur Ozdal Mengi

2015-01-01

Full Text Available An intelligent energy management system (IEMS for maintaining the energy sustainability in renewable energy systems (RES is introduced here. It consists of wind and photovoltaic (PV solar panels are established and used to test the proposed IEMS. Since the wind and solar sources are not reliable in terms of sustainability and power quality, a management system is required for supplying the load power demand. The power generated by RES is collected on a common DC bus as a renewable green power pool to be used for supplying power to loads. The renewable DC power bus is operated in a way that there is always a base power available for permanent loads. Then the additional power requirement is supplied from either wind or PV or both depending upon the availability of these power sources. The decision about operating these systems is given by an IEMS with fuzzy logic decision maker proposed in this study. Using the generated and required power information from the wind/PV and load sides, the fuzzy reasoning based IEMS determines the amount of power to be supplied from each or both sources. Besides, the IEMS tracks the maximum power operating point of the wind energy system.

Intelligent PV Power Smoothing Control Using Probabilistic Fuzzy Neural Network with Asymmetric Membership Function

Directory of Open Access Journals (Sweden)

Faa-Jeng Lin

2017-01-01

Full Text Available An intelligent PV power smoothing control using probabilistic fuzzy neural network with asymmetric membership function (PFNN-AMF is proposed in this study. First, a photovoltaic (PV power plant with a battery energy storage system (BESS is introduced. The BESS consisted of a bidirectional DC/AC 3-phase inverter and LiFePO4 batteries. Then, the difference of the actual PV power and smoothed power is supplied by the BESS. Moreover, the network structure of the PFNN-AMF and its online learning algorithms are described in detail. Furthermore, the three-phase output currents of the PV power plant are converted to the dq-axis current components. The resulted q-axis current is the input of the PFNN-AMF power smoothing control, and the output is a smoothing PV power curve to achieve the effect of PV power smoothing. Comparing to the other smoothing methods, a minimum energy capacity of the BESS with a small fluctuation of the grid power can be achieved by the PV power smoothing control using PFNN-AMF. In addition, a personal computer- (PC- based PV power plant emulator and BESS are built for the experimentation. From the experimental results of various irradiance variation conditions, the effectiveness of the proposed intelligent PV power smoothing control can be verified.

PV-CAD: an integrated tool for designing PV facades; PV-CAD - Ein integriertes Werkzeug zur Auslegung von PV-Fassaden

Energy Technology Data Exchange (ETDEWEB)

Giese, H.; Viotto, M. [Inst. fuer Solare Energieversorgungstechnik (ISET) e.V., Kassel (Germany); Esser, M.; Pukrop, D. [Univ. Oldenburg (Germany). Abt. Energie- und Halbleiterforschung; Stellbogen, D. [Zentrum fuer Sonnenergie- und Wasserstoff-Forschung, Stuttgart (Germany)

1997-12-31

PV-CAD provides PV system planners with a practice-oriented tool for an efficient design of PV facades. Being compatible with the standard programmes of the architects` and electrical engineering sectors it can be used on already existing systems and allows the user to draw on previously acquired knowedge. Its open interfaces permit the integration of further design tools. PV CAD works under Microsoft Windows for which it has the necessary graphic user interface. Its compliance to PC standards opens up a wide range of applications and permits its use also on inexpensive computers. Thanks to its promotion by the Federal Ministry for Education, Science, Research, and Technology under the research project ``Computer programmes for the design of photovoltaic facades`` PV-CAD is available at a moderate price. PV-CAD permits an efficient planning of solar facades and therefore has the potential to stimulate the use of PV on buildings. (orig.) [Deutsch] Mit PV-CAD steht dem Anlagenplaner ein anwendungsorientiertes Werkzeug zur Verfuegung, das eine rationelle Auslegung von PV-Fassaden ermoeglicht. Die Kompatibilitaet zu Standardprogrammen aus dem Architektur- und Elektrosektor erlaubt die Nutzung bereits vorhandener Systeme und damit erworbener Kenntnisse. Offene Schnittstellen gestatten die Einbindung weiterer Entwurfswerkzeuge. PV-CAD arbeitet unter Microsoft-Windows und verfuegt ueber die entsprechende grafische Benutzerschnittstelle. Die Kompatibilitaet zum PC-Standard eroeffnet eine sehr breite Anwenderbasis und ermoeglicht den Einsatz des Programms auch auf preiswerten Rechnern. Aufgrund der Foerderung durch das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie im Rahmen des Forschungsprojekts `Rechnerprogramm zur Auslegung von Photovoltaik-Fassaden` steht PV-CAD preiswert zur Verfuegung. PV-CAD ermoeglicht eine effiziente Planung von Solarfassaden und kann daher dem PV-Einsatz in Gebaeuden weitere Impulse geben. (orig.)

PV-WEB: internet-based PV information tool

International Nuclear Information System (INIS)

Cowley, P.

2003-01-01

This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members

PV-WEB: internet-based PV information tool

Energy Technology Data Exchange (ETDEWEB)

Cowley, P

2003-07-01

This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members.

Distributed photovoltaic architecture powering a DC bus: Impact of duty cycle and load variations on the efficiency of the generator

Science.gov (United States)

Allouache, Hadj; Zegaoui, Abdallah; Boutoubat, Mohamed; Bokhtache, Aicha Aissa; Kessaissia, Fatma Zohra; Charles, Jean-Pierre; Aillerie, Michel

2018-05-01

This paper focuses on a photovoltaic generator feeding a load via a boost converter in a distributed PV architecture. The principal target is the evaluation of the efficiency of a distributed photovoltaic architecture powering a direct current (DC) PV bus. This task is achieved by outlining an original way for tracking the Maximum Power Point (MPP) taking into account load variations and duty cycle on the electrical quantities of the boost converter and on the PV generator output apparent impedance. Thereafter, in a given sized PV system, we analyze the influence of the load variations on the behavior of the boost converter and we deduce the limits imposed by the load on the DC PV bus. The simultaneous influences of 1- the variation of the duty cycle of the boost converter and 2- the load power on the parameters of the various components of the photovoltaic chain and on the boost performances are clearly presented as deduced by simulation.

Bacillus spp. from rainforest soil promote plant growth under limited nitrogen conditions.

Science.gov (United States)

Huang, X-F; Zhou, D; Guo, J; Manter, D K; Reardon, K F; Vivanco, J M

2015-03-01

The aim of this study was to evaluate effects of PGPR (plant growth-promoting rhizobacteria) isolated from rainforest soil on different plants under limited nitrogen conditions. Bacterial isolates from a Peruvian rainforest soil were screened for plant growth-promoting effects on Arabidopsis (Col-0). Four selected isolates including one Bacillus subtilis, two B. atrophaeus and one B. pumilus significantly promoted growth of Zea mays L. and Solanum lycopersicum under greenhouse conditions. Moreover, the PGPRs significantly promoted growth of S. lycopersicum in both low and nitrogen-amended soil conditions. These PGPR strains were further studied to obtain insights into possible mechanisms of plant growth promotion. Volatile chemicals from those isolates promoted Arabidopsis growth, and the expression of genes related to IAA production was induced in the Arabidopsis plants treated with PGPRs. Further, selected PGPR strains triggered induced systemic resistance (ISR) against Pseudomonas syringae pv tomato DC3000 in Arabidopsis. PGPR strains isolated from the rainforest soil promoted the plant growth of Arabidopsis, corn and tomato. New PGPR that have wider adaptability to different crops, soils and environmental conditions are needed to decrease our reliance on agricultural amendments derived from fossil-based fuels. The PGPRs isolated from a nonagricultural site constitute new plant growth-promoting strains that could be developed for agricultural uses. © 2014 The Society for Applied Microbiology.

The Pseudomonas syringae type III effector HopG1 targets mitochondria, alters plant development, and suppresses plant innate immunity

Science.gov (United States)

Block, Anna; Guo, Ming; Li, Guangyong; Elowsky, Christian; Clemente, Thomas E.; Alfano, James R.

2009-01-01

Summary The bacterial plant pathogen Pseudomonas syringae uses a type III protein secretion system to inject type III effectors into plant cells. Primary targets of these effectors appear to be effector-triggered immunity (ETI) and pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI). The type III effector HopG1 is a suppressor of ETI that is broadly conserved in bacterial plant pathogens. Here we show that HopG1 from P. syringae pv. tomato DC3000 also suppresses PTI. Interestingly, HopG1 localizes to plant mitochondria, suggesting that its suppression of innate immunity may be linked to a perturbation of mitochondrial function. While HopG1 possesses no obvious mitochondrial signal peptide, its N-terminal two-thirds was sufficient for mitochondrial localization. A HopG1-GFP fusion lacking HopG1’s N-terminal 13 amino acids was not localized to the mitochondria reflecting the importance of the N-terminus for targeting. Constitutive expression of HopG1 in Arabidopsis thaliana, Nicotiana tabacum (tobacco) and Lycopersicon esculentum (tomato) dramatically alters plant development resulting in dwarfism, increased branching and infertility. Constitutive expression of HopG1 in planta leads to reduced respiration rates and an increased basal level of reactive oxygen species. These findings suggest that HopG1’s target is mitochondrial and that effector/target interaction promotes disease by disrupting mitochondrial functions. PMID:19863557

Function of endoplasmic reticulum calcium ATPase in innate immunity-mediated programmed cell death

Science.gov (United States)

Zhu, Xiaohong; Caplan, Jeffrey; Mamillapalli, Padmavathi; Czymmek, Kirk; Dinesh-Kumar, Savithramma P

2010-01-01

Programmed cell death (PCD) initiated at the pathogen-infected sites during the plant innate immune response is thought to prevent the development of disease. Here, we describe the identification and characterization of an ER-localized type IIB Ca2+-ATPase (NbCA1) that function as a regulator of PCD. Silencing of NbCA1 accelerates viral immune receptor N- and fungal-immune receptor Cf9-mediated PCD, as well as non-host pathogen Pseudomonas syringae pv. tomato DC3000 and the general elicitor cryptogein-induced cell death. The accelerated PCD rescues loss-of-resistance phenotype of Rar1, HSP90-silenced plants, but not SGT1-silenced plants. Using a genetically encoded calcium sensor, we show that downregulation of NbCA1 results in the modulation of intracellular calcium signalling in response to cryptogein elicitor. We further show that NbCAM1 and NbrbohB function as downstream calcium decoders in N-immune receptor-mediated PCD. Our results indicate that ER-Ca2+-ATPase is a component of the calcium efflux pathway that controls PCD during an innate immune response. PMID:20075858

Online model-based fault detection for grid connected PV systems monitoring

KAUST Repository

Harrou, Fouzi; Sun, Ying; Saidi, Ahmed

2017-01-01

This paper presents an efficient fault detection approach to monitor the direct current (DC) side of photovoltaic (PV) systems. The key contribution of this work is combining both single diode model (SDM) flexibility and the cumulative sum (CUSUM) chart efficiency to detect incipient faults. In fact, unknown electrical parameters of SDM are firstly identified using an efficient heuristic algorithm, named Artificial Bee Colony algorithm. Then, based on the identified parameters, a simulation model is built and validated using a co-simulation between Matlab/Simulink and PSIM. Next, the peak power (Pmpp) residuals of the entire PV array are generated based on both real measured and simulated Pmpp values. Residuals are used as the input for the CUSUM scheme to detect potential faults. We validate the effectiveness of this approach using practical data from an actual 20 MWp grid-connected PV system located in the province of Adrar, Algeria.

An Optimized Prediction Intervals Approach for Short Term PV Power Forecasting

Directory of Open Access Journals (Sweden)

Qiang Ni

2017-10-01

Full Text Available High quality photovoltaic (PV power prediction intervals (PIs are essential to power system operation and planning. To improve the reliability and sharpness of PIs, in this paper, a new method is proposed, which involves the model uncertainties and noise uncertainties, and PIs are constructed with a two-step formulation. In the first step, the variance of model uncertainties is obtained by using extreme learning machine to make deterministic forecasts of PV power. In the second stage, innovative PI-based cost function is developed to optimize the parameters of ELM and noise uncertainties are quantization in terms of variance. The performance of the proposed approach is examined by using the PV power and meteorological data measured from 1kW rooftop DC micro-grid system. The validity of the proposed method is verified by comparing the experimental analysis with other benchmarking methods, and the results exhibit a superior performance.

Online model-based fault detection for grid connected PV systems monitoring

KAUST Repository

Harrou, Fouzi

2017-12-14

This paper presents an efficient fault detection approach to monitor the direct current (DC) side of photovoltaic (PV) systems. The key contribution of this work is combining both single diode model (SDM) flexibility and the cumulative sum (CUSUM) chart efficiency to detect incipient faults. In fact, unknown electrical parameters of SDM are firstly identified using an efficient heuristic algorithm, named Artificial Bee Colony algorithm. Then, based on the identified parameters, a simulation model is built and validated using a co-simulation between Matlab/Simulink and PSIM. Next, the peak power (Pmpp) residuals of the entire PV array are generated based on both real measured and simulated Pmpp values. Residuals are used as the input for the CUSUM scheme to detect potential faults. We validate the effectiveness of this approach using practical data from an actual 20 MWp grid-connected PV system located in the province of Adrar, Algeria.

Maximum Power Point Tracking for Cascaded PV-Converter Modules Using Two-Stage Particle Swarm Optimization.

Science.gov (United States)

Mao, Mingxuan; Duan, Qichang; Zhang, Li; Chen, Hao; Hu, Bei; Duan, Pan

2017-08-24

The paper presents a novel two-stage particle swarm optimization (PSO) for the maximum power point tracking (MPPT) control of a PV system consisting of cascaded PV-converter modules, under partial shading conditions (PSCs). In this scheme, the grouping method of the shuffled frog leaping algorithm (SFLA) is incorporated with the basic PSO algorithm, ensuring fast and accurate searching of the global extremum. An adaptive speed factor is also introduced to improve its convergence speed. A PWM algorithm enabling permuted switching of the PV sources is applied. The method enables this PV system to achieve the maximum power generation for any number of PV and converter modules. Simulation studies of the proposed MPPT scheme are performed on a system having two chained PV buck-converter modules and a dc-ac H-bridge connected at its terminals for supplying an AC load. The results show that this type of PV system allows each module to achieve the maximum power generation according its illumination level without affecting the others, and the proposed new control method gives significantly higher power output compared with the conventional P&O and PSO methods.

Grid-Connection Half-Bridge PV Inverter System for Power Flow Controlling and Active Power Filtering

Directory of Open Access Journals (Sweden)

Chih-Lung Shen

2012-01-01

Full Text Available A half-bridge photovoltaic (PV system is proposed, which can not only deal with bidirectional power flowing but also improve power quality. According to varying insolation, the system conditions real power for dc and ac loads to accommodate different amounts of PV power. Furthermore, the system eliminates current harmonics and improves power factor simultaneously. As compared with conventional PV inverter, the total number of active switches and current sensors can be reduced so that its cost is lower significantly. For current command determination, a linear-approximation method (LAM is applied to avoid the complicated calculation and achieve the maximum power point tracking (MPPT feature. For current controlling, a direct-source-current-shaping (DSCS algorithm is presented to shape the waveform of line current. Simulation results and practical measurements also demonstrate the feasibility of the proposed half-bridge PV system.

A Single-Phase Transformerless Inverter With Charge Pump Circuit Concept for Grid-Tied PV Applications

DEFF Research Database (Denmark)

Ardashir, Jaber Fallah; Sabahi, Mehran; Hosseini, Seyed Hossein

2017-01-01

This paper proposes a new single-phase transformerless photovoltaic (PV) inverter for grid-tied PV systems. The topology is derived from the concept of a charge pump circuit in order to eliminate the leakage current. It is composed of four power switches, two diodes, two capacitors, and an LCL...... resonant control strategy is used to control the injected current. The main benefits of the proposed inverter are: the neutral of the grid is directly connected to the negative terminal of the PV panel, so the leakage current is eliminated; its compact size; low cost; the used dc voltage of the proposed...... are presented. Experimental results are presented to confirm both the theoretical analysis and the concept of the proposed inverter. The obtained results clearly validate the performance of the proposed inverter and its practical application in grid-tied PV systems....

Power Oscillations Damping in DC Microgrids

DEFF Research Database (Denmark)

Hamzeh, Mohsen; Ghafouri, Mohsen; Karimi, Houshang

2016-01-01

This paper proposes a new control strategy for damping of power oscillations in a multi-source dc microgrid. A parallel combination of a fuel cell (FC), a photovoltaic (PV) system and a supercapacitor (SC) are used as a hybrid power conversion system (HPCS). The SC compensates for the slow transi...... of the proposed control scheme is verified using hardware-in-the-loop (HIL) simulations carried out in OPAL-RT technologies....

PV and PV/hybrid products for buildings

Energy Technology Data Exchange (ETDEWEB)

Thomas, H. P.; Hayter, S. J.; Martin, R. L., Pierce, L. K.

2000-05-15

Residential, commercial, and industrial buildings combined are the largest consumers of electricity in the United States and represent a significant opportunity for photovoltaic (PV) and PV/hybrid systems. The U.S. Department of Energy (DOE) is conducting a phased research and product development program, Building Opportunities in the United States for Photovoltaics (PV:BONUS), focused on this market sector. The purpose of the program is to develop technologies and foster business arrangements integrating cost-effective PV or hybrid products into buildings. The first phase was completed in 1996 and a second solicitation, PV:BONUS2, was initiated during 1997. These projects are resulting in a variety of building-integrated products. This paper summarizes the recent progress of the seven firms and collaborative teams currently participating in PV:BONUS2 and outlines planned work for the final phase of their work.

Improved PV system reliability results from surge evaluations at Sandia National Laboratories

International Nuclear Information System (INIS)

Russell H. Bonn; Sigifredo Gonzalez

2000-01-01

Electrical surges on ac and dc inverter power wiring and diagnostic cables have the potential to shorten the lifetime of power electronics. These surges may be caused by either nearby lightning or capacitor switching transients. This paper contains a description of ongoing surge evaluations of PV power electronics and surge mitigation hardware at Sandia

Improved Reliability of Single-Phase PV Inverters by Limiting the Maximum Feed-in Power

DEFF Research Database (Denmark)

Yang, Yongheng; Wang, Huai; Blaabjerg, Frede

2014-01-01

Grid operation experiences have revealed the necessity to limit the maximum feed-in power from PV inverter systems under a high penetration scenario in order to avoid voltage and frequency instability issues. A Constant Power Generation (CPG) control method has been proposed at the inverter level...... devices, allowing a quantitative prediction of the power device lifetime. A study case on a 3 kW single-phase PV inverter has demonstrated the advantages of the CPG control in terms of improved reliability.......Grid operation experiences have revealed the necessity to limit the maximum feed-in power from PV inverter systems under a high penetration scenario in order to avoid voltage and frequency instability issues. A Constant Power Generation (CPG) control method has been proposed at the inverter level....... The CPG control strategy is activated only when the DC input power from PV panels exceeds a specific power limit. It enables to limit the maximum feed-in power to the electric grids and also to improve the utilization of PV inverters. As a further study, this paper investigates the reliability performance...

Design and performance study of a DC-DC flyback converter based on wide bandgap power devices for photovoltaic applications

Science.gov (United States)

Alharbi, Salah S.; Alharbi, Saleh S.; Al-bayati, Ali M. S.; Matin, Mohammad

2017-08-01

This paper presents a high-performance dc-dc flyback converter design based on wide bandgap (WBG) semiconductor devices for photovoltaic (PV) applications. Two different power devices, a gallium nitride (GaN)-transistor and a silicon (Si)-MOSFET, are implemented individually in the flyback converter to examine their impact on converter performance. The total power loss of the converter with different power devices is analyzed for various switching frequencies. Converter efficiency is evaluated at different switching frequencies, input voltages, and output power levels. The results reveal that the converter with the GaN-transistor has lower total power loss and better efficiency compared to the converter with the conventional Si-MOSFET.

Pathogen exploitation of an abscisic acid- and jasmonate-inducible MAPK phosphatase and its interception by Arabidopsis immunity.

Science.gov (United States)

Mine, Akira; Berens, Matthias L; Nobori, Tatsuya; Anver, Shajahan; Fukumoto, Kaori; Winkelmüller, Thomas M; Takeda, Atsushi; Becker, Dieter; Tsuda, Kenichi

2017-07-11

Phytopathogens promote virulence by, for example, exploiting signaling pathways mediated by phytohormones such as abscisic acid (ABA) and jasmonate (JA). Some plants can counteract pathogen virulence by invoking a potent form of immunity called effector-triggered immunity (ETI). Here, we report that ABA and JA mediate inactivation of the immune-associated MAP kinases (MAPKs), MPK3 and MPK6, in Arabidopsis thaliana ABA induced expression of genes encoding the protein phosphatases 2C (PP2Cs), HAI1 , HAI2 , and HAI3 through ABF/AREB transcription factors. These three HAI PP2Cs interacted with MPK3 and MPK6 and were required for ABA-mediated MPK3/MPK6 inactivation and immune suppression. The bacterial pathogen Pseudomonas syringae pv. tomato ( Pto ) DC3000 activates ABA signaling and produces a JA-mimicking phytotoxin, coronatine (COR), that promotes virulence. We found that Pto DC3000 induces HAI1 through COR-mediated activation of MYC2, a master transcription factor in JA signaling. HAI1 dephosphorylated MPK3 and MPK6 in vitro and was necessary for COR-mediated suppression of MPK3/MPK6 activation and immunity. Intriguingly, upon ETI activation, A. thaliana plants overcame the HAI1-dependent virulence of COR by blocking JA signaling. Finally, we showed conservation of induction of HAI PP2Cs by ABA and JA in other Brassicaceae species. Taken together, these results suggest that ABA and JA signaling pathways, which are hijacked by the bacterial pathogen, converge on the HAI PP2Cs that suppress activation of the immune-associated MAPKs. Also, our data unveil interception of JA-signaling activation as a host counterstrategy against the bacterial suppression of MAPKs during ETI.

The Type-2 Fuzzy Logic Controller-Based Maximum Power Point Tracking Algorithm and the Quadratic Boost Converter for Pv System

Science.gov (United States)

Altin, Necmi

2018-05-01

An interval type-2 fuzzy logic controller-based maximum power point tracking algorithm and direct current-direct current (DC-DC) converter topology are proposed for photovoltaic (PV) systems. The proposed maximum power point tracking algorithm is designed based on an interval type-2 fuzzy logic controller that has an ability to handle uncertainties. The change in PV power and the change in PV voltage are determined as inputs of the proposed controller, while the change in duty cycle is determined as the output of the controller. Seven interval type-2 fuzzy sets are determined and used as membership functions for input and output variables. The quadratic boost converter provides high voltage step-up ability without any reduction in performance and stability of the system. The performance of the proposed system is validated through MATLAB/Simulink simulations. It is seen that the proposed system provides high maximum power point tracking speed and accuracy even for fast changing atmospheric conditions and high voltage step-up requirements.

DES-TOMATO: A Knowledge Exploration System Focused On Tomato Species

KAUST Repository

Salhi, Adil

2017-07-14

Tomato is the most economically important horticultural crop used as a model to study plant biology and particularly fruit development. Knowledge obtained from tomato research initiated improvements in tomato and, being transferrable to other such economically important crops, has led to a surge of tomato-related research and published literature. We developed DES-TOMATO knowledgebase (KB) for exploration of information related to tomato. Information exploration is enabled through terms from 26 dictionaries and combination of these terms. To illustrate the utility of DES-TOMATO, we provide several examples how one can efficiently use this KB to retrieve known or potentially novel information. DES-TOMATO is free for academic and nonprofit users and can be accessed at http://cbrc.kaust.edu.sa/des_tomato/, using any of the mainstream web browsers, including Firefox, Safari and Chrome.

DES-TOMATO: A Knowledge Exploration System Focused On Tomato Species

KAUST Repository

Salhi, Adil; Negrã o, Só nia; Essack, Magbubah; Morton, Mitchell J. L.; Bougouffa, Salim; Mohamad Razali, Rozaimi; Radovanovic, Aleksandar; Marchand, Benoit; Kulmanov, Maxat; Hoehndorf, Robert; Tester, Mark A.; Bajic, Vladimir B.

2017-01-01

Tomato is the most economically important horticultural crop used as a model to study plant biology and particularly fruit development. Knowledge obtained from tomato research initiated improvements in tomato and, being transferrable to other such economically important crops, has led to a surge of tomato-related research and published literature. We developed DES-TOMATO knowledgebase (KB) for exploration of information related to tomato. Information exploration is enabled through terms from 26 dictionaries and combination of these terms. To illustrate the utility of DES-TOMATO, we provide several examples how one can efficiently use this KB to retrieve known or potentially novel information. DES-TOMATO is free for academic and nonprofit users and can be accessed at http://cbrc.kaust.edu.sa/des_tomato/, using any of the mainstream web browsers, including Firefox, Safari and Chrome.

A Decentralized Wireless Solution to Monitor and Diagnose PV Solar Module Performance Based on Symmetrized-Shifted Gompertz Functions

Science.gov (United States)

Molina-García, Angel; Campelo, José Carlos; Blanc, Sara; Serrano, Juan José; García-Sánchez, Tania; Bueso, María C.

2015-01-01

This paper proposes and assesses an integrated solution to monitor and diagnose photovoltaic (PV) solar modules based on a decentralized wireless sensor acquisition system. Both DC electrical variables and environmental data are collected at PV module level using low-cost and high-energy efficiency node sensors. Data is real-time processed locally and compared with expected PV module performances obtained by a PV module model based on symmetrized-shifted Gompertz functions (as previously developed and assessed by the authors). Sensor nodes send data to a centralized sink-computing module using a multi-hop wireless sensor network architecture. Such integration thus provides extensive analysis of PV installations, and avoids off-line tests or post-processing processes. In comparison with previous approaches, this solution is enhanced with a low-cost system and non-critical performance constraints, and it is suitable for extensive deployment in PV power plants. Moreover, it is easily implemented in existing PV installations, since no additional wiring is required. The system has been implemented and assessed in a Spanish PV power plant connected to the grid. Results and estimations of PV module performances are also included in the paper. PMID:26230694

A Decentralized Wireless Solution to Monitor and Diagnose PV Solar Module Performance Based on Symmetrized-Shifted Gompertz Functions

Directory of Open Access Journals (Sweden)

Angel Molina-García

2015-07-01

Full Text Available This paper proposes and assesses an integrated solution to monitor and diagnose photovoltaic (PV solar modules based on a decentralized wireless sensor acquisition system. Both DC electrical variables and environmental data are collected at PV module level using low-cost and high-energy efficiency node sensors. Data is real-time processed locally and compared with expected PV module performances obtained by a PV module model based on symmetrized-shifted Gompertz functions (as previously developed and assessed by the authors. Sensor nodes send data to a centralized sink-computing module using a multi-hop wireless sensor network architecture. Such integration thus provides extensive analysis of PV installations, and avoids off-line tests or post-processing processes. In comparison with previous approaches, this solution is enhanced with a low-cost system and non-critical performance constraints, and it is suitable for extensive deployment in PV power plants. Moreover, it is easily implemented in existing PV installations, since no additional wiring is required. The system has been implemented and assessed in a Spanish PV power plant connected to the grid. Results and estimations of PV module performances are also included in the paper.

A Decentralized Wireless Solution to Monitor and Diagnose PV Solar Module Performance Based on Symmetrized-Shifted Gompertz Functions.

Science.gov (United States)

Molina-García, Angel; Campelo, José Carlos; Blanc, Sara; Serrano, Juan José; García-Sánchez, Tania; Bueso, María C

2015-07-29

This paper proposes and assesses an integrated solution to monitor and diagnose photovoltaic (PV) solar modules based on a decentralized wireless sensor acquisition system. Both DC electrical variables and environmental data are collected at PV module level using low-cost and high-energy efficiency node sensors. Data is real-time processed locally and compared with expected PV module performances obtained by a PV module model based on symmetrized-shifted Gompertz functions (as previously developed and assessed by the authors). Sensor nodes send data to a centralized sink-computing module using a multi-hop wireless sensor network architecture. Such integration thus provides extensive analysis of PV installations, and avoids off-line tests or post-processing processes. In comparison with previous approaches, this solution is enhanced with a low-cost system and non-critical performance constraints, and it is suitable for extensive deployment in PV power plants. Moreover, it is easily implemented in existing PV installations, since no additional wiring is required. The system has been implemented and assessed in a Spanish PV power plant connected to the grid. Results and estimations of PV module performances are also included in the paper.

21 CFR 73.585 - Tomato lycopene extract; tomato lycopene concentrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Tomato lycopene extract; tomato lycopene... SERVICES GENERAL LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.585 Tomato lycopene extract; tomato lycopene concentrate. (a) Identity. (1) The color additive tomato lycopene extract is a...

Model Predictive Control techniques with application to photovoltaic, DC Microgrid, and a multi-sourced hybrid energy system

Science.gov (United States)

Shadmand, Mohammad Bagher

Renewable energy sources continue to gain popularity. However, two major limitations exist that prevent widespread adoption: availability and variability of the electricity generated and the cost of the equipment. The focus of this dissertation is Model Predictive Control (MPC) for optimal sized photovoltaic (PV), DC Microgrid, and multi-sourced hybrid energy systems. The main considered applications are: maximum power point tracking (MPPT) by MPC, droop predictive control of DC microgrid, MPC of grid-interaction inverter, MPC of a capacitor-less VAR compensator based on matrix converter (MC). This dissertation firstly investigates a multi-objective optimization technique for a hybrid distribution system. The variability of a high-penetration PV scenario is also studied when incorporated into the microgrid concept. Emerging (PV) technologies have enabled the creation of contoured and conformal PV surfaces; the effect of using non-planar PV modules on variability is also analyzed. The proposed predictive control to achieve maximum power point for isolated and grid-tied PV systems speeds up the control loop since it predicts error before the switching signal is applied to the converter. The low conversion efficiency of PV cells means we want to ensure always operating at maximum possible power point to make the system economical. Thus the proposed MPPT technique can capture more energy compared to the conventional MPPT techniques from same amount of installed solar panel. Because of the MPPT requirement, the output voltage of the converter may vary. Therefore a droop control is needed to feed multiple arrays of photovoltaic systems to a DC bus in microgrid community. Development of a droop control technique by means of predictive control is another application of this dissertation. Reactive power, denoted as Volt Ampere Reactive (VAR), has several undesirable consequences on AC power system network such as reduction in power transfer capability and increase in

Supervisory Control of an Adaptive-Droop Regulated DC Microgrid with Battery Management Capability

DEFF Research Database (Denmark)

Dragicevic, Tomislav; Guerrero, Josep M.; Vasquez, Juan Carlos

2014-01-01

DC power systems are gaining an increasing interest in renewable energy applications because of the good matching with dc output type sources such as photovoltaic (PV) systems and secondary batteries. In this paper, several distributed generators (DGs) have been merged together with a pair...... of batteries and loads to form an autonomous dc Microgrid (MG). To overcome the control challenge associated with coordination of multiple batteries within one stand-alone MG, a double-layer hierarchical control strategy was proposed; 1) The unit-level primary control layer was established by an adaptive...

Single stage three level grid interactive MPPT inverter for PV systems

International Nuclear Information System (INIS)

Ozdemir, Saban; Altin, Necmi; Sefa, Ibrahim

2014-01-01

Highlights: • A three phase three-level NPC inverter for grid interactive PV systems is proposed. • A novel MPPT algorithm is introduced for single stage systems. • The proposed algorithm is robust with respect to parameter variations of PV system. • THD level is measured as 3.45% and it meets the international standards (<5%). • Total system efficiency is measured as 93.08%. - Abstract: In this study, three-phase, single stage neutral point clamped grid interactive inverter is designed and implemented. The reference current of the voltage source inverter is determined by maximum power point tracking sub-program in order to obtain maximum power from photovoltaic modules instantaneously. Proposed control is realized via TMS320F28335 32-bit floating point processor. The modified incremental conductance method is applied for maximum power point tracking; the PI regulator is used to control the inverter output current shape and level. Galvanic isolation is provided by a line frequency transformer that matches inverter output voltage to the grid voltage level and prevents DC current injection into the grid. Experimental results show that the designed inverter imports energy to the grid with unity power factor, total harmonic distortion level is 3.45% and this value is in the limits of the international standards. In addition, the total efficiency of the system is measured as 93.08%. The proposed system gets the maximum power from photovoltaic module and dispatches into the grid without using additional DC/DC converter

Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

DEFF Research Database (Denmark)

Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

2017-01-01

. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact on the overall PV energy cost, due to the increased maintenance for the PV inverters. This paper...... evaluates the lifetime of PV inverters considering the PV array sizing and installation sites, e.g., Denmark and Arizona. The results reveal that the PV array sizing has a considerable impact on the PV inverter lifetime and reliability, especially in Denmark, where the average solar irradiance level...

Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

OpenAIRE

Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso; Blaabjerg, Frede

2017-01-01

In order to enable a more wide-scale utilization of PV systems, the cost of PV energy has to be comparable with other energy sources. Oversizing the PV array is one common approach to reduce the cost of PV energy, since it increases the PV energy yield during low solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact...

Power Electronic Systems for Switched Reluctance Generator based Wind Farms and DC Networks

DEFF Research Database (Denmark)

Park, Kiwoo

enable various renewable energy sources, such as Photovoltaic (PV) and wind, to produce dc power directly. In addition, battery-based energy storage systems inherently operate with dc power. Hence, dc network (dc-grid) systems which connect these dc sources and storages directly using dc networks...... are gaining much attention again. The dc network system has a great potential to outdo the traditional ac systems in many technical challenges and could be highly profitable especially for offshore wind farm applications, where the size and weight of the components are crucial to the entire system costs......Wind power technology, as the most competitive renewable energy technology, is quickly developing. The wind turbine size is growing and the grid penetration of wind power is increasing rapidly. Recently, the developments on wind power technology pay more attentions on efficiency and reliability...

Redox proteomics of tomato in response to Pseudomonas syringae infection

Science.gov (United States)

Balmant, Kelly Mayrink; Parker, Jennifer; Yoo, Mi-Jeong; Zhu, Ning; Dufresne, Craig; Chen, Sixue

2015-01-01

Unlike mammals with adaptive immunity, plants rely on their innate immunity based on pattern-triggered immunity (PTI) and effector-triggered immunity (ETI) for pathogen defense. Reactive oxygen species, known to play crucial roles in PTI and ETI, can perturb cellular redox homeostasis and lead to changes of redox-sensitive proteins through modification of cysteine sulfhydryl groups. Although redox regulation of protein functions has emerged as an important mechanism in several biological processes, little is known about redox proteins and how they function in PTI and ETI. In this study, cysTMT proteomics technology was used to identify similarities and differences of protein redox modifications in tomato resistant (PtoR) and susceptible (prf3) genotypes in response to Pseudomonas syringae pv tomato (Pst) infection. In addition, the results of the redox changes were compared and corrected with the protein level changes. A total of 90 potential redox-regulated proteins were identified with functions in carbohydrate and energy metabolism, biosynthesis of cysteine, sucrose and brassinosteroid, cell wall biogenesis, polysaccharide/starch biosynthesis, cuticle development, lipid metabolism, proteolysis, tricarboxylic acid cycle, protein targeting to vacuole, and oxidation–reduction. This inventory of previously unknown protein redox switches in tomato pathogen defense lays a foundation for future research toward understanding the biological significance of protein redox modifications in plant defense responses. PMID:26504582

A Coordinated Control for Photovoltaic Generators and Energy Storages in Low-Voltage AC/DC Hybrid Microgrids under Islanded Mode

DEFF Research Database (Denmark)

Liu, Yao; Hou, Xiaochao; Wang, Xiaofeng

2016-01-01

The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES) units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based...... on photovoltaic (PV) generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can...... take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC) bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed...

Design development and testing of a solar PV pump based drip system for orchards

Energy Technology Data Exchange (ETDEWEB)

Pande, P.C.; Singh, A.K.; Ansari, S.; Vyas, S.K.; Dave, B.K. [Central Arid Zone Research Inst., Jodhpur (India)

2003-03-01

A Solar Photovoltaic (PV) pump operated drip irrigation system has been designed and developed for growing orchards in arid region considering different design parameters like pumps size, water requirements, the diurnal variation in the pressure of the pump due to change in irradiance and pressure compensation in the drippers. The system comprising a PV pump with 900 W{sub p} PV array and 800 W dc motor-pump mono-block, microfilter, main and sub-mains and three open-able low-pressure compensating drippers on each plant was field tested. The emission uniformity was observed to be 92-94% with discharge of 3.8 l/h in the pressure range of 70-100 kPa provided by the pump and thus the system could irrigate some 1 ha area within 2 h. Based on the performance of the PV pump and the drip system, it was inferred that about 5 ha area of orchard could be covered. The projected benefit-cost ratio for growing pomegranate orchards with such a system was evaluated to be above 2 even with the costly PV pump and therefore the system was considered to be an appropriate technology for the development of arid region. (Author)

A Coordinated Control for Photovoltaic Generators and Energy Storages in Low-Voltage AC/DC Hybrid Microgrids under Islanded Mode

Directory of Open Access Journals (Sweden)

Yao Liu

2016-08-01

Full Text Available The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based on photovoltaic (PV generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed for alternating current (AC-side ES. Thus, the ES lifetime is prolonged. Moreover, interlinking converters (ICs provide a bridge between AC/DC buses in a hybrid microgrid. The power control of IC is enabled when the AC- or DC-side suffer from active power demand shortage. In particular, if the AC microgrid does not satisfy the reactive power demand, IC then acts as a static synchronous compensator (STATCOM. The effectiveness of the proposed strategies is verified by simulations.

PV potential and potential PV rent in European regions

DEFF Research Database (Denmark)

Hansen, Anders Chr.; Thorn, Paul

2013-01-01

The paper provides a GIS based model for assessing the potentials of photovoltaic electricity in Europe by NUTS 2 regions. The location specific energy potential per PV-­‐panel area is estimated based on observations of solar irradiation, conversion efficiency, levelised costs and the social value...... of PV-­‐electricity. Combined with the potential density of PV-­‐panel area based on land cover and environental restrictions, the PV energy potential and the potential PV ressource rent is calculated. These calculations enbable the model to estimate the regional patterns at NUTS 2 level...

One-step Multiplex RT-PCR Method for Simultaneous Detection of Seed Transmissible Bacteria and Viruses in Pepper and Tomato Seeds

Directory of Open Access Journals (Sweden)

Kyusik Jeong

2011-04-01

Full Text Available The aim of this study was to develop specific and sensitive PCR-based procedures for simultaneous detection of economically important plant seed infection pathogenic bacteria and virus, Xanthomonns campestris pv. vesicatoria (Xcv, Clavibacter michiganensis subsp. michiganensis (Cmm, Erwinia carotovora subsp. carotovora (Ecc, Pepper mild mottle virus (PMMoV and Tobacco mild green mosaic virus (TMGMV in pepper and tomato seeds. Most of pepper and tomato bacterial and virus diseases are responsible for germination and growth obstruction. PCR with arbitral primers: selection of specific primers, performance of PCR with specific primers and determination of the threshold level for pathogens detection. To detect simultaneously the Xcv, Cmm, Ecc, PMMoV and TMGMV in pepper and tomato seeds, five pairs (Cmm-F/R, Ecc-F/R, Xcv-F/R, PMMoV-F/R, TMGMV-F/R of specific primer were synthesized by primer-blast program. The multiplex PCR for the five pathogens in pepper and tomato seeds could detect specially without interference among primers and/or cDNA of plant seeds and other plant pathogens. The PCR result for pathogen detection using 20 commercial pepper and 10 tomato seed samples, Ecc was detected from 4 pepper and 2 tomato seed samples, PMMoV was detected from 1 pepper seed sample, and PMMoV and TMGMV were simultaneously detected from 1 pepper seed sample.

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Tomato contact dermatitis

DEFF Research Database (Denmark)

Paulsen, Evy; Christensen, Lars P; Andersen, Klaus Ejner

2012-01-01

The tomato plant (Solanum lycopersicum) is an important crop worldwide. Whereas immediate-type reactions to tomato fruits are well known, contact dermatitis caused by tomatoes or tomato plants is rarely reported. The aims of this study were to present new data on contact sensitization to tomato...... plants and review the literature on contact dermatitis caused by both plants and fruits. An ether extract of tomato plants made as the original oleoresin plant extracts, was used in aimed patch testing, and between 2005 and 2011. 8 of 93 patients (9%) tested positive to the oleoresin extracts....... This prevalence is in accordance with the older literature that reports tomato plants as occasional sensitizers. The same applies to tomato fruits, which, in addition, may cause protein contact dermatitis. The allergens of the plant are unknown, but both heat-stable and heat-labile constituents seem...

Life cycle assessment of a medium sized PV facility in Scotland

International Nuclear Information System (INIS)

Muneer, T; Younes, S.; Kubie, J.

2006-01-01

Napier University's School of Engineering has been involved in education and research in renewable energy for the past 35 years. With the aim demonstration of the viability of production of solar electricity at a high latitude location such as Edinburgh (56 degree north)the school undertook to commission a medium-sized PV electricity generation project. The installation of 32 rows of BP solar silicon panels covering a total area of 160 square metres ensures generation of 17.6kW peak (AC) power. Figure 1 presents a photograph of the facility under discussion. The project has been part (60%) financed by UK Government's PV electricity demonstration programme through the office of Energy Saving Trust. The University has plans to generate hydrogen from solar electricity that will be stored for noctumal production of electricity using fuel-cell technology, thus completing the complete cycle of generation, storage and reproduction of sustainable energy. The project that is part of Napier University's Merchiton Campus was completed on 6 April 2005 and since that date AC power has been fed into the University grid with the peak power being enough to operate up to 80 of the 500 computers at the University's Jack Kilby Computing Centre. DC power is produced from the BP solar high efficincy (17%) monocrystalline panels, each of which produces 90W of power at 22 Volts. This DC electricity is then fed into a total of four inverters hence converting to a stable AC supply. Two of the larger inverters receive current from 12 rows (4 strings x 3 rows) each, while the smaller inverters take power in from 4 rows (2 strings x 2 rows) each. The PV facility is fully instrumented with both input (incident solar energy) and PV electrical energy output recorded at a frequency of 15 minutes. This article will present the energetic, environmental and monetary life cycle assessment (LCA) of the above facility.(Author)

Power Oscillations Damping in DC Microgrids

OpenAIRE

Hamzeh, Mohsen; Ghafouri, Mohsen; Karimi, Houshang; Sheshyekani, Keyhan; Guerrero, Josep M.

2016-01-01

This paper proposes a new control strategy for damping of power oscillations in a multi-source dc microgrid. A parallel combination of a fuel cell (FC), a photovoltaic (PV) system and a supercapacitor (SC) are used as a hybrid power conversion system (HPCS). The SC compensates for the slow transient response of the FC stack. The HPCS controller comprises a multi-loop voltage controller and a virtual impedance loop for power management. The virtual impedance loop uses a dynamic droop gain to a...

Feasibility analysis of the application and positioning of DC HTS FCL in a DC microgrid through modeling and simulation using Simulink and SimPowerSystem

Energy Technology Data Exchange (ETDEWEB)

Khan, U.A.; Shin, W.J.; Seong, J.K.; Oh, S.H.; Lee, S.H. [School of Electrical Engineering and Computer Science, Hanyang University, Ansan-Shi, Gyeonggi-do 426-791 (Korea, Republic of); Lee, B.W., E-mail: bangwook@hanyang.ac.kr [School of Electrical Engineering and Computer Science, Hanyang University, Ansan-Shi, Gyeonggi-do 426-791 (Korea, Republic of)

2011-11-15

We modeled DC SFCL by use of SimPowerSystem blocks. We examine the DC fault current limitation in low voltage DC distribution networks. SFCL's affects at critical points were measured. SFCL installed at the substation rectifier branch resulted in abnormal increase of fault current. The strategic location of SFCL is the point of integration of the PV plant with the power grid. DC fault current limitation in DC distribution network is one of the critical issues which need to be taken care of before they can be practically implemented. High temperature superconductors could be efficiently installed to cope with the problem of DC fault currents. In this paper, a generalized DC high temperature superconducting fault current limiter (SFCL) is modeled by integrating Simulink and SimPowerSystem blocks. This model is designed for limiting DC fault currents in low voltage DC distribution networks. A DC microgrid having a low voltage DC distribution network, an integrated photovoltaic plant and domestic customer load is modeled. Transient analysis of the DC microgrid is performed by generating fault and measuring DC fault currents at critical points. The designed DC SFCL is placed at different strategic locations in DC microgrid and fault current limitation performance of DC SFCL in DC microgrid has been analyzed. Moreover, the affects of rapid impedance changing in the distribution network due to the fault followed by DC SFCL activation is investigated. Finally, the best suitable position and affects of DC SFCL in a DC microgrid along with suggestions for implementation have been proposed.

Feasibility analysis of the application and positioning of DC HTS FCL in a DC microgrid through modeling and simulation using Simulink and SimPowerSystem

International Nuclear Information System (INIS)

Khan, U.A.; Shin, W.J.; Seong, J.K.; Oh, S.H.; Lee, S.H.; Lee, B.W.

2011-01-01

We modeled DC SFCL by use of SimPowerSystem blocks. We examine the DC fault current limitation in low voltage DC distribution networks. SFCL's affects at critical points were measured. SFCL installed at the substation rectifier branch resulted in abnormal increase of fault current. The strategic location of SFCL is the point of integration of the PV plant with the power grid. DC fault current limitation in DC distribution network is one of the critical issues which need to be taken care of before they can be practically implemented. High temperature superconductors could be efficiently installed to cope with the problem of DC fault currents. In this paper, a generalized DC high temperature superconducting fault current limiter (SFCL) is modeled by integrating Simulink and SimPowerSystem blocks. This model is designed for limiting DC fault currents in low voltage DC distribution networks. A DC microgrid having a low voltage DC distribution network, an integrated photovoltaic plant and domestic customer load is modeled. Transient analysis of the DC microgrid is performed by generating fault and measuring DC fault currents at critical points. The designed DC SFCL is placed at different strategic locations in DC microgrid and fault current limitation performance of DC SFCL in DC microgrid has been analyzed. Moreover, the affects of rapid impedance changing in the distribution network due to the fault followed by DC SFCL activation is investigated. Finally, the best suitable position and affects of DC SFCL in a DC microgrid along with suggestions for implementation have been proposed.

Interactive smart battery storage for a PV and wind hybrid energy management control based on conservative power theory

Science.gov (United States)

Godoy Simões, Marcelo; Davi Curi Busarello, Tiago; Saad Bubshait, Abdullah; Harirchi, Farnaz; Antenor Pomilio, José; Blaabjerg, Frede

2016-04-01

This paper presents interactive smart battery-based storage (BBS) for wind generator (WG) and photovoltaic (PV) systems. The BBS is composed of an asymmetric cascaded H-bridge multilevel inverter (ACMI) with staircase modulation. The structure is parallel to the WG and PV systems, allowing the ACMI to have a reduction in power losses compared to the usual solution for storage connected at the DC-link of the converter for WG or PV systems. Moreover, the BBS is embedded with a decision algorithm running real-time energy costs, plus a battery state-of-charge manager and power quality capabilities, making the described system in this paper very interactive, smart and multifunctional. The paper describes how BBS interacts with the WG and PV and how its performance is improved. Experimental results are presented showing the efficacy of this BBS for renewable energy applications.

Energy Management Strategy Based on Multiple Operating States for a Photovoltaic/Fuel Cell/Energy Storage DC Microgrid

Directory of Open Access Journals (Sweden)

Ying Han

2017-01-01

Full Text Available It is a great challenge for DC microgrids with stochastic renewable sources and volatility loads to achieve better operation performance. This study proposes an energy management strategy based on multiple operating states for a DC microgrid, which is comprised of a photovoltaic (PV array, a proton exchange membrane fuel cell (PEMFC system, and a battery bank. This proposed strategy can share the power properly and keep the bus voltage steady under different operating states (the state of charge (SOC of the battery bank, loading conditions, and PV array output power. In addition, a microgrids test platform is established. In order to verify the effectiveness of the proposed energy management strategy, the strategy is implemented in a hardware system and experimentally tested under different operating states. The experimental results illustrate the good performance of the proposed control strategy for the DC microgrid under different scenarios of power generation and load demand.

Intelligent Control for a DC Micro-Grid System

DEFF Research Database (Denmark)

Martino, Michele; Quiñones, Yamshid Farhat; Raboni, Pietro

2012-01-01

This paper presents the dynamic response of a DC–micro-grid (DC-MG) controlled in master-slave mode. The benefits of the micro-grids (MGs) are the low cost in terms of power electronics converters and the high reliability and quality, even in case of loss connection to the transmission system. A ...... the units, especially in case of variable weather conditions with different DC loads. Thus the voltage level of the system and the power flow are shown, out of a detailed description of the power electronic interfaces featuring the distributed generators (DGs).......This paper presents the dynamic response of a DC–micro-grid (DC-MG) controlled in master-slave mode. The benefits of the micro-grids (MGs) are the low cost in terms of power electronics converters and the high reliability and quality, even in case of loss connection to the transmission system. A DC......-MG in fact can survive in standalone mode if properly managed. The considered system is made by a photovoltaic array (PV), a wind turbine (WT), a gas engine (GE) and an energy storage system (ESS). The DC-MG behavior is analyzed in different scenarios to demonstrate the efficacy of the control for all...

Harmonic analysis and suppression in hybrid wind & PV solar system

Science.gov (United States)

Gupta, Tripti; Namekar, Swapnil

2018-04-01

The growing demand of electricity has led to produce power through non-conventional source of energy such as solar energy, wind energy, hydro power, energy through biogas and biomass etc. Hybrid system is taken to complement the shortcoming of either sources of energy. The proposed system is grid connected hybrid wind and solar system. A 2.1 MW Doubly fed Induction Generator (DFIG) has been taken for analysis of wind farm whose rotor part is connected to two back-to-back converters. A 250 KW Photovoltaic (PV) array taken to analyze solar farm where inverter is required to convert power from DC to AC since electricity generated through solar PV is in the form of DC. Stability and reliability of the system is very important when the system is grid connected. Harmonics is the major Power quality issue which degrades the quality of power at load side. Harmonics in hybrid system arise through the use of power conversion unit. The other causes of harmonics are fluctuation in wind speed and solar irradiance. The power delivered to grid must be free from harmonics and within the limits specified by Indian grid codes. In proposed work, harmonic analysis of the hybrid system is performed in Electrical Transient Analysis program (ETAP) and single tuned harmonic filter is designed to maintain the utility grid harmonics within limits.

Automatic Supervision And Fault Detection In PV System By Wireless Sensors With Interfacing By Labview Program

Directory of Open Access Journals (Sweden)

Yousra M Abbas

2015-08-01

Full Text Available In this work a wireless monitoring system are designed for automatic detection localization fault in photovoltaic system. In order to avoid the use of modeling and simulation of the PV system we detected the fault by monitoring the output of each individual photovoltaic panel connected in the system by Arduino and transmit this data wirelessly to laptop then interface it by LabVIEW program which made comparison between this data and the measured data taking from reference module at the same condition. The proposed method is very simple but effective detecting and diagnosing the main faults of a PV system and was experimentally validated and has demonstrated its effectiveness in the detection and diagnosing of main faults present in the DC side of PV system.

Respective contribution of CML8 and CML9, two arabidopsis calmodulin-like proteins, to plant stress responses.

Science.gov (United States)

Zhu, Xiaoyang; Perez, Manon; Aldon, Didier; Galaud, Jean-Philippe

2017-05-04

In their natural environment, plants have to continuously face constraints such as biotic and abiotic stresses. To achieve their life cycle, plants have to perceive and interpret the nature, but also the strength of environmental stimuli to activate appropriate physiological responses. Nowadays, it is well established that signaling pathways are crucial steps in the implementation of rapid and efficient plant responses such as genetic reprogramming. It is also reported that rapid raises in calcium (Ca 2+ ) levels within plant cells participate in these early signaling steps and are essential to coordinate adaptive responses. However, to be informative, calcium increases need to be decoded and relayed by calcium-binding proteins also referred as calcium sensors to carry-out the appropriate responses. In a recent study, we showed that CML8, an Arabidopsis calcium sensor belonging to the calmodulin-like (CML) protein family, promotes plant immunity against the phytopathogenic bacteria Pseudomonas syringae pv tomato (strain DC3000). Interestingly, other CML proteins such as CML9 were also reported to contribute to plant immunity using the same pathosystem. In this addendum, we propose to discuss about the specific contribution of these 2 CMLs in stress responses.

A nanosized Ag-silica hybrid complex prepared by γ-irradiation activates the defense response in Arabidopsis

Science.gov (United States)

Chu, Hyosub; Kim, Hwa-Jung; Su Kim, Joong; Kim, Min-Soo; Yoon, Byung-Dae; Park, Hae-Jun; Kim, Cha Young

2012-02-01

Silver nanoparticles have antimicrobial activity against many pathogenic microbes. Here, the preparation of a nanosized Ag-silica hybrid complex (NSS) prepared by γ-irradiation is described. The effects of both NSS and reduced Ag nanoparticles (Ag 0) on the growth of the model plant Arabidopsis thaliana were tested. The application of 1-10 ppm NSS complex improved Arabidopsis growth in soil, whereas 100 ppm NSS resulted in weakly curled leaves. In addition, supplementation of Murashige and Skoog (MS) growth medium with 1 ppm NSS promoted the root growth of Arabidopsis seedlings, but root growth was inhibited by supplementation with 10 ppm NSS. To investigate whether the NSS complex could induce plant defense responses, the expression of pathogenesis-related ( PR) genes that are implicated in systemic acquired resistance (SAR) in Arabidopsis plants was examined. PR1, PR2 and PR5 were significantly up-regulated by each application of 10 ppm NSS complex or Ag 0 to the rosette leaves. Furthermore, pretreatment with the NSS complex induced more pathogen resistance to the virulent pathogen Pseudomonas syringae pv. tomato DC3000 ( Pst) compared to water treatment in Arabidopsis plants.

Chitin nanofiber elucidates the elicitor activity of polymeric chitin in plants

Directory of Open Access Journals (Sweden)

Mayumi eEgusa

2015-12-01

Full Text Available Chitin, an N-acetyl-D-glucosamine polymer, is a component of fungal cell walls and a microbe/pathogen-associated molecular pattern that elicits plant defense responses. As polymeric chitin is difficult to handle due to its insolubility in water, many studies on chitin-induced immune responses have used water-soluble low-molecular weight chitin instead. Thus, it is unclear if polymeric chitin can induce resistance. Here, we examined the elicitor activity of chitin nanofiber (CNF of submicron thickness prepared from polymeric chitin. CNF showed a high dispersing ability in water and induced both reactive oxygen species (ROS production and chitin-induced defense-related gene expression in Arabidopsis thaliana seedlings. The Arabidopsis chitin elicitor receptor kinase 1 (Atcerk1 mutant, which is impaired in chitin perception, also failed to respond to CNF. CNF exposure triggered ROS generation in suspension-cultured cells from Oryza sativa. Furthermore, pre-treatment of Arabidopsis leaves with CNF effectively reduced pathogen infection by both the fungus Alternaria brassicicola and the bacterium Pseudomonas syringae pv. tomato DC3000. These results demonstrate that CNF has elicitor activity and will help define the role of polymeric chitin in plant immune responses.

Analysis of the grape (Vitis vinifera L.) thaumatin-like protein (TLP) gene family and demonstration that TLP29 contributes to disease resistance.

Science.gov (United States)

Yan, Xiaoxiao; Qiao, Hengbo; Zhang, Xiuming; Guo, Chunlei; Wang, Mengnan; Wang, Yuejin; Wang, Xiping

2017-06-27

Thaumatin-like protein (TLP) is present as a large family in plants, and individual members play different roles in various responses to biotic and abiotic stresses. Here we studied the role of 33 putative grape (Vitis vinifera L.) TLP genes (VvTLP) in grape disease resistance. Heat maps analysis compared the expression profiles of 33 genes in disease resistant and susceptible grape species infected with anthracnose (Elsinoe ampelina), powdery mildew (Erysiphe necator) or Botrytis cinerea. Among these 33 genes, the expression level of TLP29 increased following the three pathogens inoculations, and its homolog from the disease resistant Chinese wild grape V. quinquangularis cv. 'Shang-24', was focused for functional studies. Over-expression of TLP29 from grape 'Shang-24' (VqTLP29) in Arabidopsis thaliana enhanced its resistance to powdery mildew and the bacterium Pseudomonas syringae pv. tomato DC3000, but decreased resistance to B. cinerea. Moreover, the stomatal closure immunity response to pathogen associated molecular patterns was strengthened in the transgenic lines. A comparison of the expression profiles of various resistance-related genes after infection with different pathogens indicated that VqTLP29 may be involved in the salicylic acid and jasmonic acid/ethylene signaling pathways.

PROPIEDADES FISICOQUIMICAS Y ANTIBACTERIALES DE MEZCLAS PLA-QUITOSANO OBTENIDAS POR CASTING CON POTENCIAL USO COMO ACOLCHADOS AGRÍCOLAS

Directory of Open Access Journals (Sweden)

Danila Merino

2016-01-01

Full Text Available Se obtuvieron films PLA - Quitosano compatibilizados con diisocianato de hexametileno (HDI por el método de casting y posterior prensado. Los films fueron preparados con diferentes contenidos de quitosano (CS y a continuación se estudiaron sus propiedades fisicoquímicas, mediante espectroscopia infrarroja de Transformada de Fourier (FTIR, análisis termogravimétrico (TGA, calorimetría diferencial de barrido (DSC, microscopia óptica (MO y difracción de rayos X (DRX. Se encontró que el agente compatibilizante reacciona completamente y que el quitosano afecta las propiedades térmicas de los films disminuyendo sus temperaturas de descomposición, transición vítrea (T g y de fusión (T f e incrementando su cristalinidad. Desde el punt o de vista funcional, se estudiaron las propiedades antimicrobianas de cada uno de los films frente a la bacteria patógena Pseudomonas syringae pv tomato DC - 3000. E l aumento en el contenido de quitosano fue proporcional al efecto antimicrobiano permitiendo proyectar su potencial de aplicación en el campo agronómico.

The Wheat Bax Inhibitor-1 Protein Interacts with an Aquaporin TaPIP1 and Enhances Disease Resistance in Arabidopsis

Directory of Open Access Journals (Sweden)

Pan-Pan Lu

2018-01-01

Full Text Available Bax inhibitor-1 (BI-1 is an endoplasmic reticulum (ER-resident cell death suppressor evolutionarily conserved in eukaryotes. The ability of BI-1 to inhibit the biotic and abiotic stresses have been well-studied in Arabidopsis, while the functions of wheat BI-1 are largely unknown. In this study, the wheat BI-1 gene TaBI-1.1 was isolated by an RNA-seq analysis of Fusarium graminearum (Fg-treated wheat. TaBI-1.1 expression was induced by a salicylic acid (SA treatment and down-regulated by an abscisic acid (ABA treatment. Based on β-glucuronidase (GUS staining, TaBI-1.1 was expressed in mature leaves and roots but not in the hypocotyl or young leaves. Constitutive expression of TaBI-1.1 in Arabidopsis enhanced its resistance to Pseudomonas syringae pv. Tomato (Pst DC3000 infection and induced SA-related gene expression. Additionally, TaBI-1.1 transgenic Arabidopsis exhibited an alleviation of damage caused by high concentrations of SA and decreased the sensitivity to ABA. Consistent with the phenotype, the RNA-seq analysis of 35S::TaBI-1.1 and Col-0 plants showed that TaBI-1.1 was involved in biotic stresses. These results suggested that TaBI-1.1 positively regulates SA signals and plays important roles in the response to biotic stresses. In addition, TaBI-1.1 interacted with the aquaporin TaPIP1, and both them were localized to ER membrane. Furthermore, we demonstrated that TaPIP1 was up-regulated by SA treatment and TaPIP1 transgenic Arabidopsis enhanced the resistance to Pst DC3000 infection. Thus, the interaction between TaBI-1.1 and TaPIP1 on the ER membrane probably occurs in response to SA signals and defense response.

Dynamic Sliding Mode Evolution PWM Controller for a Novel High-Gain Interleaved DC-DC Converter in PV System

Directory of Open Access Journals (Sweden)

Taizhou Bei

2014-01-01

Full Text Available Considering the disadvantages of the traditional high-gain DC-DC converter such as big size, high voltage stress of switches, and large input current ripple, a novel high-gain interleaved boost converter with coupled-inductor and switched-capacitor was proposed correspondingly and the operation principle together with the steady-state analysis of this converter was also described. Besides, a new control approach-dynamic sliding mode evolution PWM controller (DSME PWM for the novel topological converter based on both dynamic evolution and sliding mode control was also presented. From the simulation results and experimental validation the proposed converter can fulfill high-gain boost, low ripple of both the input current and the output voltage. Furthermore, MPPT technique can be also achieved in a short time by simulation. The efficiency and stability of the converter proposed in this paper can be improved.

21 CFR 888.3000 - Bone cap.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Bone cap. 888.3000 Section 888.3000 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ORTHOPEDIC DEVICES Prosthetic Devices § 888.3000 Bone cap. (a) Identification. A bone cap is a mushroom...

Harmonic Injection-Based Power Fluctuation Control of Three-Phase PV Systems under Unbalanced Grid Voltage Conditions

Directory of Open Access Journals (Sweden)

Nian-Cheng Zhou

2015-02-01

Full Text Available Unbalanced voltage will inevitably cause power and DC voltage fluctuations in a three-phase PV system. The deterioration of power quality will do great harm to the PV panels and the loads, so it is necessary to suppress the power fluctuations. This paper further explores the coefficients control strategy of PV converters under unbalanced voltage conditions, aiming to suppress power fluctuations by controlling the injection of some specific orders of current harmonics into the grid. In order to achieve this, the current reference of the PV inverter has been changed by bringing in two control coefficients, and the expression of each order of the current harmonics has been deduced. Based on the standards of PV systems, the regions from which the coefficients can be selected are determined. Then, by tuning these coefficients in the feasible regions, the output parameters (power fluctuation, current THD and odd harmonics can be controlled precisely. The model of this method is built and simulated in PSCAD/EMTDC, and as a result, it is shown that the power fluctuations can be restricted according to different power quality requirements.

Interband cascade (IC) photovoltaic (PV) architecture for PV devices

Science.gov (United States)

Yang, Rui Q.; Tian, Zhaobing; Mishima, Tetsuya D.; Santos, Michael B.; Johnson, Matthew B.; Klem, John F.

2015-10-20

A photovoltaic (PV) device, comprising a PV interband cascade (IC) stage, wherein the IC PV stage comprises an absorption region with a band gap, the absorption region configured to absorb photons, an intraband transport region configured to act as a hole barrier, and an interband tunneling region configured to act as an electron barrier. An IC PV architecture for a photovoltaic device, the IC PV architecture comprising an absorption region, an intraband transport region coupled to the absorption region, and an interband tunneling region coupled to the intraband transport region and to the adjacent absorption region, wherein the absorption region, the intraband transport region, and the interband tunneling region are positioned such that electrons will flow from the absorption region to the intraband transport region to the interband tunneling region.

Supervision and control of grid connected PV-Storage systems with the five level diode clamped inverter

International Nuclear Information System (INIS)

Himour, Kamal; Ghedamsi, Kaci; Berkouk, El Madjid

2014-01-01

Highlights: • Use of battery bank in grid connection photovoltaic system to ensure the energetic autonomy of the system. • Improve the quality of energy by the use of five-level inverter in a grid connection PV generation system. • Control of inverter by fast and simplified space vector pulse width modulation. • Control and supervision of active and reactive power in the grid. - Abstract: This paper aimed to evaluate the use of photovoltaic-battery storage systems to supply electric power in the distribution grid through a multilevel inverter. The proposed system is composed by four PV generators with MPPT (P and O) control, four battery storage systems connected to each capacitor of the DC link and a five level diode clamped inverter connected to the grid by a traditional three phase transformer. The proposed control has a hierarchical structure with both a grid side control level to regulate the power and the current injected to the grid and four input side regulation units. The system operator controls the power production of the four PV generators by sending out reference power signals to each input side regulation unit, the input side regulation units regulate the voltage of each capacitor of the DC link, regulate the voltage and the state of charge of each battery storage system

Tracking the Sun V: An Historical Summary of the Installed Price of Photovoltaics in the United States from 1998 to 2011

Energy Technology Data Exchange (ETDEWEB)

Barbose, Galen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Darghouth, Naim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Wiser, Ryan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2012-11-01

As the deployment of grid-connected solar photovoltaic (PV) systems has increased, so too has the desire to track the installed price of these systems over time and by location, customer type, and system characteristics. This report helps to fill this need by summarizing trends in the installed price of grid-connected PV systems in the United States from 1998 through 2011, with preliminary data for 2012. The analysis is based on project-level data for more than 150,000 individual residential, commercial, and utility-scale PV systems, totaling more than 3,000 megawatts (MW) and representing 76% of all grid-connected PV capacity installed in the United States through 2011. The report describes installed price trends for residential and commercial PV systems, and another set of trends for utility-scale PV. In all cases, installed prices are identified in terms of real 2011 dollars per installed watt (DC-STC), prior to receipt of any direct financial incentives or tax credits.

An Analysis of Open World PvP in LOTRO's PvMP as a Case Study for PvP Games

Directory of Open Access Journals (Sweden)

Toh Weimin

2014-11-01

Full Text Available This article focuses on the analysis of emergent gameplay, based on a case study of the author's subjective gameplay experience of Player versus Monster Player (PvMP in The Lord of the Rings Online (LOTRO. The argument presented here is that although there is a core system of Player versus Player (PvP which LOTRO shares with other online games, each type of online game has a specific kind of PvP system which attracts players to engage in the gameplay. For instance, the open world sandbox type of PvP attracts certain players to play in LOTRO's PvMP. One of the main aims of this study is thus to investigate some of the core systems of PvP gameplay in open world sandbox PvP. In this article, LOTRO is shown to offer unique opportunities for studying emergent gameplay in open world games, with particular relevance to PvP studies. Two of the core systems of PvP discussed include the design of the simple gameplay rules to support emergent gameplay, and the community's attitudes towards player's behaviours. The types of emergent gameplay discussed include free play versus negotiated fair play, the players' utilisation of strategies in open world PvP to support collaborative and competitive gameplay, and the changing dynamics of open ended gameplay. It is hoped that the analysis provided in this article would form the­ basis of future work on a more general framework for understanding PvP in other online games.

Fire resistant PV shingle assembly

Science.gov (United States)

Lenox, Carl J.

2012-10-02

A fire resistant PV shingle assembly includes a PV assembly, including PV body, a fire shield and a connection member connecting the fire shield below the PV body, and a support and inter-engagement assembly. The support and inter-engagement assembly is mounted to the PV assembly and comprises a vertical support element, supporting the PV assembly above a support surface, an upper interlock element, positioned towards the upper PV edge, and a lower interlock element, positioned towards the lower PV edge. The upper interlock element of one PV shingle assembly is inter-engageable with the lower interlock element of an adjacent PV shingle assembly. In some embodiments the PV shingle assembly may comprise a ventilation path below the PV body. The PV body may be slidably mounted to the connection member to facilitate removal of the PV body.

Magnification of starting torques of dc motors by maximum power point trackers in photovoltaic systems

Science.gov (United States)

Appelbaum, Joseph; Singer, S.

1989-01-01

Direct current (dc) motors are used in terrestrial photovoltaic (PV) systems such as in water-pumping systems for irrigation and water supply. Direct current motors may also be used for space applications. Simple and low weight systems including dc motors may be of special interest in space where the motors are directly coupled to the solar cell array (with no storage). The system will operate only during times when sufficient insolation is available. An important performance characteristic of electric motors is the starting to rated torque ratio. Different types of dc motors have different starting torque ratios. These ratios are dictated by the size of solar cell array, and the developed motor torque may not be sufficient to overcome the load starting torque. By including a maximum power point tracker (MPPT) in the PV system, the starting to rated torque ratio will increase, the amount of which depends on the motor type. The starting torque ratio is calculated for the permanent magnet, series and shunt excited dc motors when powered by solar cell arrays for two cases: with and without MPPT's. Defining a motor torque magnification by the ratio of the motor torque with an MPPT to the motor torque without an MPPT, a magnification of 3 was obtained for the permanent magnet motor and a magnification of 7 for both the series and shunt motors. The effect of the variation of solar insolation on the motor starting torque was covered. All motor types are less sensitive to insolation variation in systems including MPPT's as compared to systems with MPPT's. The analysis of this paper will assist the PV system designed to determine whether or not to include an MPPT in the system for a specific motor type.

PV/T slates - Laboratory measurements; PV/T-Schiefer. Labormessungen

Energy Technology Data Exchange (ETDEWEB)

Kropf, S.

2003-07-01

This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with an experimental outdoor set-up and reviews in-situ measurements made on a prototype of a ventilated PV-tile system (PV/T-Slates). The report describes the configuration and construction of the experimental PV-tiled roof and the measurement system used to measure its electrical and thermal performance. The results of the measurements made are presented in detail in graphical form. The influence of various factors such as air-slit width and mounting angle are discussed.

Integrated Three-Voltage-Booster DC-DC Converter to Achieve High Voltage Gain with Leakage-Energy Recycling for PV or Fuel-Cell Power Systems

Directory of Open Access Journals (Sweden)

Chih-Lung Shen

2015-09-01

Full Text Available In this paper, an integrated three-voltage-booster DC-DC (direct current to direct current converter is proposed to achieve high voltage gain for renewable-energy generation systems. The proposed converter integrates three voltage-boosters into one power stage, which is composed of an active switch, a coupled-inductor, five diodes, and five capacitors. As compared with conventional high step-up converters, it has a lower component count. In addition, the features of leakage-energy recycling and switching loss reduction can be accomplished for conversion efficiency improvement. While the active switch is turned off, the converter can inherently clamp the voltage across power switch and suppress voltage spikes. Moreover, the reverse-recovery currents of all diodes can be alleviated by leakage inductance. A 200 W prototype operating at 100 kHz switching frequency with 36 V input and 400 V output is implemented to verify the theoretical analysis and to demonstrate the feasibility of the proposed high step-up DC-DC converter.

Module-level DC/DC conversion for photovoltaic systems

NARCIS (Netherlands)

Bergveld, H.J.; Büthker, D.; Castello, C.; Doorn, T.S.; Jong, de A.; van Otten, R.; Waal, de K.

2011-01-01

Photovoltaic (PV) systems are increasingly used to generate electrical energy from solar irradiance incident on PV modules. Each PV module is formed by placing a large amount of PV cells, typically 60, in series. The PV system is then formed by placing a number, typically 10–12, of PV modules in

Plasmodium vivax Tryptophan Rich Antigen PvTRAg36.6 Interacts with PvETRAMP and PvTRAg56.6 Interacts with PvMSP7 during Erythrocytic Stages of the Parasite.

Directory of Open Access Journals (Sweden)

Kriti Tyagi

Full Text Available Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to 'Pv-fam-a' family and some of them are potential drug/vaccine targets but their functional role(s largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7 and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle.

Plasmodium vivax Tryptophan Rich Antigen PvTRAg36.6 Interacts with PvETRAMP and PvTRAg56.6 Interacts with PvMSP7 during Erythrocytic Stages of the Parasite

Science.gov (United States)

Tyagi, Kriti; Hossain, Mohammad Enayet; Thakur, Vandana; Aggarwal, Praveen; Malhotra, Pawan; Mohmmed, Asif; Sharma, Yagya Dutta

2016-01-01

Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to ‘Pv-fam-a’ family and some of them are potential drug/vaccine targets but their functional role(s) largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP) of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM) development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7) and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle. PMID:26954579

Induced resistance in tomato by SAR activators during predisposing salinity stress

Directory of Open Access Journals (Sweden)

Matthew Francis Pye

2013-05-01

Full Text Available Plant activators are chemicals that induce disease resistance. The phytohormone salicylic acid (SA is a crucial signal for systemic acquired resistance (SAR, and SA-mediated resistance is a target of several commercial plant activators, including Actigard (1,2,3-benzothiadiazole-7-thiocarboxylic acid-s-methyl-ester, BTH and Tiadinil (N-(3-chloro-4-methylphenyl-4-methyl-1,2,3-thiadiazole-5-carboxamide, TDL. BTH and TDL were examined for their impact on abscisic acid (ABA-mediated, salt-induced disease predisposition in tomato seedlings. A brief episode of salt stress to roots significantly increased the severity of disease caused by Pseudomonas syringae pv. tomato (Pst and Phytophthora capsici relative to non-stressed plants. Root treatment with TDL induced resistance to Pst in leaves and provided protection in both non-stressed and salt-stressed seedlings in WT and highly susceptible NahG plants. Non-stressed and salt-stressed ABA-deficient sitiens mutants were highly resistant to Pst. Neither TDL nor BTH induced resistance to root infection by P. capsici, nor did they moderate the salt-induced increment in disease severity. Root treatment with these plant activators increased the levels of ABA in roots and shoots similar to levels observed in salt-stressed plants. The results indicate that SAR activators can protect tomato plants from bacterial speck disease under predisposing salt stress, and suggest that some SA-mediated defense responses function sufficiently in plants with elevated levels of ABA.

Transgenic tomato plants overexpressing tyramine N-hydroxycinnamoyltransferase exhibit elevated hydroxycinnamic acid amide levels and enhanced resistance to Pseudomonas syringae.

Science.gov (United States)

Campos, Laura; Lisón, Purificación; López-Gresa, María Pilar; Rodrigo, Ismael; Zacarés, Laura; Conejero, Vicente; Bellés, José María

2014-10-01

Hydroxycinnamic acid amides (HCAA) are secondary metabolites involved in plant development and defense that have been widely reported throughout the plant kingdom. These phenolics show antioxidant, antiviral, antibacterial, and antifungal activities. Hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase (THT) is the key enzyme in HCAA synthesis and is induced in response to pathogen infection, wounding, or elicitor treatments, preceding HCAA accumulation. We have engineered transgenic tomato plants overexpressing tomato THT. These plants displayed an enhanced THT gene expression in leaves as compared with wild type (WT) plants. Consequently, leaves of THT-overexpressing plants showed a higher constitutive accumulation of the amide coumaroyltyramine (CT). Similar results were found in flowers and fruits. Moreover, feruloyltyramine (FT) also accumulated in these tissues, being present at higher levels in transgenic plants. Accumulation of CT, FT and octopamine, and noradrenaline HCAA in response to Pseudomonas syringae pv. tomato infection was higher in transgenic plants than in the WT plants. Transgenic plants showed an enhanced resistance to the bacterial infection. In addition, this HCAA accumulation was accompanied by an increase in salicylic acid levels and pathogenesis-related gene induction. Taken together, these results suggest that HCAA may play an important role in the defense of tomato plants against P. syringae infection.

The PV market

International Nuclear Information System (INIS)

Hammond, B.

1992-01-01

This paper forecasts the photovoltaic (PV) market growth for the 1990s. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market however is highly dependent on a number of market factors such as the cost of conventional energy the cost of PV systems utility acceptance of PV and regulatory controls. Government and institutional regulations, environmental issues, and OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer stand-alone and utility markets

Implementation of a Small Type DC Microgrid Based on Fuzzy Control and Dynamic Programming

Directory of Open Access Journals (Sweden)

Chin-Hsing Cheng

2016-09-01

Full Text Available A DC microgrid (DC-MG is a novel power system that uses DC distribution in order to provide high quality power. The study system is made by a photovoltaic array (PV, a wind generator (WG, a fuel cell (FC, and an energy storage system (ESS to establish a small type DC microgrid, with the bus being established by DC/DC converters with fuzzy controllers. An overall power dispatch was designed for the proposed system to distribute the power flows among the different energy sources and the storage unit in the system in order to satisfy the load requirements throughout an entire 24-h period. The structure of a power supervisor based on an optimal power dispatch algorithm is here proposed. Optimization was performed using dynamic programming (DP. In this paper, a system configuration of a DC microgrid is analyzed in different scenarios to show the efficacy of the control for all devices for the variable weather conditions with different DC loads. Thus, the voltage level and the power flow of the system are shown for different load conditions.

Dynamic modelling of a PV pumping system with special consideration on water demand

International Nuclear Information System (INIS)

Campana, Pietro Elia; Li, Hailong; Yan, Jinyue

2013-01-01

Highlights: ► Evaluation of water demand and solar energy is essential for PV pumping system. ► The design for a PV water pumping system has been optimized based on dynamic simulations. ► It is important to conduct dynamic simulations to check the matching between water demand and water supply. ► AC pump driven by the fixed PV array is the most cost-effective solution. - Abstract: The exploitation of solar energy in remote areas through photovoltaic (PV) systems is an attractive solution for water pumping for irrigation systems. The design of a photovoltaic water pumping system (PVWPS) strictly depends on the estimation of the crop water requirements and land use since the water demand varies during the watering season and the solar irradiation changes time by time. It is of significance to conduct dynamic simulations in order to achieve the successful and optimal design. The aim of this paper is to develop a dynamic modelling tool for the design of a of photovoltaic water pumping system by combining the models of the water demand, the solar PV power and the pumping system, which can be used to validate the design procedure in terms of matching between water demand and water supply. Both alternate current (AC) and direct current (DC) pumps and both fixed and two-axis tracking PV array were analyzed. The tool has been applied in a case study. Results show that it has the ability to do rapid design and optimization of PV water pumping system by reducing the power peak and selecting the proper devices from both technical and economic viewpoints. Among the different alternatives considered in this study, the AC fixed system represented the best cost effective solution

Philadelphia and the Tomato.

Science.gov (United States)

Smith, Andrew F.; Kling, Tatiana

This booklet describes for elementary students the many contributions of people, traveling many places, over many years to bring the tomato to Philadelphia. The booklet includes the following: (1) "Introduction to the Tomato"; (2) "Where Does the Tomato Come From?"; (3) "The Spanish Tomato"; (4) "The Philadelphia…

Comparison of the Energy Conversion Efficiency of a Solar Chimney and a Solar PV-Powered Fan for Ventilation Applications

Directory of Open Access Journals (Sweden)

Lubomír Klimeš

2018-04-01

Full Text Available A study into the performance of a solar chimney and a solar photovoltaic (PV-powered fan for ventilation applications was carried out using numerical simulations. The performance of the solar chimney was compared with that of a direct current (DC fan powered by a solar PV panel. The comparison was carried out using the same area of the irradiated surface—the area of the solar absorber plate in the case of the solar chimney and the area of the solar panel in the case of the photovoltaic-powered fan. The two studied cases were compared under various solar radiation intensities of incident solar radiation. The results indicate that the PV-powered fans significantly outperform solar chimneys in terms of converting solar energy into the kinetic energy of air motion. Moreover, ventilation with PV-powered fans offers more flexibility in the arrangement of the ventilation system and also better control of the air flow rates in the case of battery storage.

COMPARISON OF CAROTENOID CONTENT IN TOMATO, TOMATO PULP AND KETCHUP BY LIQUID CHROMATOGRAPHY

Directory of Open Access Journals (Sweden)

J. J. T. GAMA

2009-01-01

Full Text Available

Although tomatoes are commonly consumed fresh, over 80 % the consumption of tomatoes is in the form of processed products such as tomato pulp, ketchup, juice and sauce. Research has indicated the potential health benefits of a diet rich in tomatoes and tomato products. The present study was carried out to determine the carotenoid content of fresh tomato, tomato pulp and ketchup by high performance liquid chromatography. The major differences among these products were in the concentration of some of the pigments. Tomato had all-trans-lycopene (1046-1099 μg/g DW, cislycopene (125-132 μg/g DW and all-trans- -carotene (45-59 μg/g DW as principal carotenoids. Tomato pulp and ketchup had all-trans-lycopene (951-999 μg/g DW and 455-476 μg/g DW, all-trans- -carotene (76-88 DW μg/g and 20-27 DW μg/g and cis-lycopene (71-83 μg/g DW and 14-25 μg/g DW as the main pigments, respectively. They also contained other carotenoids in much smaller amounts (lycoxanthin, zeaxanthin, anteraxanthin, lutein, -carotene, -carotene and phytofluene.

A Simple Approach in Estimating the Effectiveness of Adapting Mirror Concentrator and Tracking Mechanism for PV Arrays in the Tropics

Directory of Open Access Journals (Sweden)

M. E. Ya’acob

2014-01-01

Full Text Available Mirror concentrating element and tracking mechanism has been seriously investigated and widely adapted in solar PV technology. In this study, a practical in-field method is conducted in Serdang, Selangor, Malaysia, for the two technologies in comparison to the common fixed flat PV arrays. The data sampling process is measured under stochastic weather characteristics with the main target of calculating the effectiveness of PV power output. The data are monitored, recorded, and analysed in real time via GPRS online monitoring system for 10 consecutive months. The analysis is based on a simple comparison of the actual daily power generation from each PV generator with statistical analysis of multiple linear regression (MLR and analysis of variance test (ANOVA. From the analysis, it is shown that tracking mechanism generates approximately 88 Watts (9.4% compared to the mirror concentrator which generates 144 Watts (23.4% of the cumulative dc power for different array configurations at standard testing condition (STC references. The significant increase in power generation shows feasibilities of implying both mechanisms for PV generators and thus contributes to additional reference in PV array design.

Building brighter PV business

International Nuclear Information System (INIS)

Hacker, R.

2002-01-01

The current status and future prospects of the UK market for solar photovoltaic (PV) electricity are briefly discussed. Through the Department of Trade and Industry (DTI), the UK Government has supported research and development (R and D) into PV for a number of years. This programme has now been extended to demonstrating PV systems on houses. Phase 2 - the domestic field trial programme - aims to monitor the performance of individual systems and the impact on a cluster of systems on the electricity network. New funding had allowed a trebling of the size of this programme, which involves both private developers and housing associations. The DTI is also working to promote PV on commercial buildings, eg the installation of BP Solar PV systems at BP petrol stations. The PV industry in the UK is technically strong and is working to overcome the barriers in the UK to greater uptake of the technology (including cost, conservatism, legal requirements and metering practices). Improvements are expected in a number of recent initiatives in the electricity industry to boost PV use and the PV industry is lobbying for PV to be included in the Enhanced Capital Allowances (ECA) scheme

A high-performance stand-alone solar PV power system for LED lighting

KAUST Repository

Huang, B. J.

2010-06-01

The present study developed a high-performance solar PV power technology for the LED lighting of a solar home system. The nMPPO (near-Maximum-Power- Point- Operation) design is employed in system design to eliminate MPPT. A feedback control system using pulse width modulation (PWM) technique was developed for battery charging control which can increase the charging capacity by 78%. For high-efficiency lighting, the LED is directly driven by battery using a PWM discharge control to eliminate a DC/DC converter. Two solar-powered LED lighting systems (50W and 100W LED) were built. The long-term outdoor tests have shown that the loss of load probability for full-night lighting requirement is zero for 50W LED and 3.6% for 100W LED. © 2010 IEEE.

Building opportunities in the U.S. for PV (PV:BONUS): A progress report

International Nuclear Information System (INIS)

Taylor, R.W.

1994-01-01

Five contract teams are developing photovoltaic (PV) products that will have a significant impact on building-integrated PV systems. The product lines that these teams are pursuing include roofing materials, building facade materials, PV integrated into modular homes, ac-PV modules, and utility-dispatchable PV systems. The objective of these efforts is to develop product and market opportunities that can provide for the introduction of PV into the buildings market sector at higher allowable installed systems costs than conventional ground- or roof-mounted systems. Each of the teams has a unique approach, and synergistic opportunities among teams are beginning to emerge. This paper reviews the product and market development efforts of these teams and describes the links between the product efforts and parallel analytical work to develop PV as a demand-side management option

Production, Marketing and Value Chain Mapping of 'Srijana' Tomato Hybrid Seed in Nepal

Directory of Open Access Journals (Sweden)

Dinesh Babu Thapa Magar

2016-12-01

Full Text Available A tomato variety known as ‘Srijana’ developed by Nepal Agricultural Research Council (NARC has been substantially popular among Nepalese farmers and entrepreneurs. To understand the seed value chain of the Srijana hybrid tomato, a survey was conducted in 2014/15 with public research and extension institutions, private seed companies/firms, non-governmental organization and community group including individual farmers, involved in Srijana tomato seed production. The survey covered random selection of 30 agro-vets and 30 farmers in Kathmandu valley, Kavre, Nuwakot, Dolakha and Kaski districts, Nepal where production of Srijana tomato seed is mostly concentrated. A focus group discussion was also conducted with commercial tomato farmers in each of the study districts. The study showed a total production of 293 kg Srijana seed having a value of around 47 million Nepalese Rupees (US $ 470 thousands in year 2013/14. Private sector was the dominant actor sharing about 85% of the total Srijana seed production followed by non-governmental organization (10%, farmers group (3% and governmental station/farm/centers (2%, respectively. Out of the total Srijana seed produced, about 95% was consumed in domestic market while 5% was exported to India. The study revealed increasing trend of production, supply and price of Srijana tomato seed. About 0.3 million NRs (US $ 3,000 profit was estimated through the production of Srijana tomato seed in 0.05 hectares (500 m2 of land. Agro-vets (private sector seed dealers were the major actors for supplying the seed from the producers to farms and received a higher profit margins. The farmers producing and selling the seed in technical assistance of public agencies received higher producer`s share (66.6% than farmers producing and selling seed through own group (60%, technical assistance of non-governmental organization (53.3%, and in contract with private seed companies (26.7%. Majority of commercial tomato farmers

Three-Phase PV CHB Inverter for a Distributed Power Generation System

Directory of Open Access Journals (Sweden)

Pierluigi Guerriero

2016-10-01

Full Text Available This work deals with the design of a three-phase grid-tied photovoltaic (PV cascade H-bridge inverter for distributed power conversion. The power balancing among the phases must be properly addressed. In fact, an intra-phase power imbalance—arising from uneven irradiance and temperature conditions—generates a per-phase power imbalance. This latter can be compensated by the injection of a proper zero-sequence voltage, while the intra-phase balance is ensured by means of a hybrid modulation method which is able to guarantee the handling of unequal DC (Direct Current sources, stable circuit operation, and maximization of PV power production. The digital controller is developed and tested in Matlab/Simulink environment integrated with XSG (Xilinx System Generator, thus allowing an easy transfer on a field-programmable gate array (FPGA platform and accurately describing the behavior of a real hardware implementation. Thus, numerical results have been considered to prove the effectiveness of the proposed approach.

Effect of Emamectin Benzoate on Root-Knot Nematodes and Tomato Yield.

Science.gov (United States)

Cheng, Xingkai; Liu, Xiumei; Wang, Hongyan; Ji, Xiaoxue; Wang, Kaiyun; Wei, Min; Qiao, Kang

2015-01-01

Southern root-knot nematode (Meloidogyne incognita) is an obligate, sedentary endoparasite of more than 3000 plant species, that causes heavy economic losses and limit the development of protected agriculture of China. As a biological pesticide, emamectin benzoate has effectively prevented lepidopteran pests; however, its efficacy to control M. incognita remains unknown. The purpose of the present study was to test soil application of emamectin benzoate for management of M. incognita in laboratory, greenhouse and field trials. Laboratory results showed that emamectin benzoate exhibited high toxicity to M. incognita, with LC50 and LC90 values 3.59 and 18.20 mg L(-1), respectively. In greenhouse tests, emamectin benzoate soil application offered good efficacy against M. incognita while maintaining excellent plant growth. In field trials, emamectin benzoate provided control efficacy against M. incognita and resulted in increased tomato yields. Compared with the untreated control, there was a 36.5% to 81.3% yield increase obtained from all treatments and the highest yield was received from the highest rate of emamectin benzoate. The results confirmed that emamectin benzoate has enormous potential for the control of M. incognita in tomato production in China.

Effect of Emamectin Benzoate on Root-Knot Nematodes and Tomato Yield.

Directory of Open Access Journals (Sweden)

Xingkai Cheng

Full Text Available Southern root-knot nematode (Meloidogyne incognita is an obligate, sedentary endoparasite of more than 3000 plant species, that causes heavy economic losses and limit the development of protected agriculture of China. As a biological pesticide, emamectin benzoate has effectively prevented lepidopteran pests; however, its efficacy to control M. incognita remains unknown. The purpose of the present study was to test soil application of emamectin benzoate for management of M. incognita in laboratory, greenhouse and field trials. Laboratory results showed that emamectin benzoate exhibited high toxicity to M. incognita, with LC50 and LC90 values 3.59 and 18.20 mg L(-1, respectively. In greenhouse tests, emamectin benzoate soil application offered good efficacy against M. incognita while maintaining excellent plant growth. In field trials, emamectin benzoate provided control efficacy against M. incognita and resulted in increased tomato yields. Compared with the untreated control, there was a 36.5% to 81.3% yield increase obtained from all treatments and the highest yield was received from the highest rate of emamectin benzoate. The results confirmed that emamectin benzoate has enormous potential for the control of M. incognita in tomato production in China.

A New Control Method to Mitigate Power Fluctuations for Grid Integrated PV/Wind Hybrid Power System Using Ultracapacitors

Science.gov (United States)

Jayalakshmi, N. S.; Gaonkar, D. N.

2016-08-01

The output power obtained from solar-wind hybrid system fluctuates with changes in weather conditions. These power fluctuations cause adverse effects on the voltage, frequency and transient stability of the utility grid. In this paper, a control method is presented for power smoothing of grid integrated PV/wind hybrid system using ultracapacitors in a DC coupled structure. The power fluctuations of hybrid system are mitigated and smoothed power is supplied to the utility grid. In this work both photovoltaic (PV) panels and the wind generator are controlled to operate at their maximum power point. The grid side inverter control strategy presented in this paper maintains DC link voltage constant while injecting power to the grid at unity power factor considering different operating conditions. Actual solar irradiation and wind speed data are used in this study to evaluate the performance of the developed system using MATLAB/Simulink software. The simulation results show that output power fluctuations of solar-wind hybrid system can be significantly mitigated using the ultracapacitor based storage system.

PV ready roofing systems

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

The integration of PV technology into roofs of houses has become very popular in the United States, Japan, Germany and The Netherlands. There could be a considerable market in the UK for these systems, given the large number of houses that are projected to be built in the next 10 years, and taking account of increased awareness of energy issues. A significant proportion of the market share of annual installed PV is for solar PV systems installed into homes (currently 15%), this is expected to rise to 23% (900MW) by 2010. The grid connected roof and building mounted facade systems represent the fastest growing market for PV systems in Europe. In conclusion, therefore, innovative approached for fixing PV technology onto roofs have been identified for both domestic roofs and for the commercial sector. With reference to production methodologies within the roofing industry, both approaches should be capable of being designed with PV-ready connections suitable for fixing PV modules at a later date. This will help overcome the key barriers of cost of installation, skills required and the lack of retrofit potential. Based on the results of this project, Sustainable Energy together with PV Systems are keen to take forward the full research and development of PV-ready systems for both the domestic and commercial sectors.

Application of drum compost and vermicompost to improve soil health, growth, and yield parameters for tomato and cabbage plants.

Science.gov (United States)

Goswami, Linee; Nath, Anil; Sutradhar, Sweety; Bhattacharya, Satya Sundar; Kalamdhad, Ajay; Vellingiri, Kowsalya; Kim, Ki-Hyun

2017-09-15

Utilization of different types of solid wastes through composting is important for environmental sustainability and restoring soil quality. Although drum composting is an efficient technology, the possibility of heavy metal contamination restricts its large-scale use. In this research, a field experiment was conducted to evaluate the impact of water hyacinth drum compost (DC) and traditional vermicompost (VC) on soil quality and crop growth in an agro-ecosystem cultivated intensively with tomato and cabbage as test crops. A substantial improvement in soil health was observed with respect to nutrient availability, physical stability, and microbial diversity due to the application of drum compost and traditional vermicompost. Moreover, soil organic carbon was enriched through increased humic and fulvic acid carbon. Interestingly, heavy metal contamination was less significant in vermicompost-treated soils than in those receiving the other treatments. The use of VC and DC in combination with recommended chemical fertilization effectively stimulated crop growth, yield, product quality, and storage longevity for both tomato and cabbage. Copyright © 2017 Elsevier Ltd. All rights reserved.

Sensorless PV Array Diagnostic Method for Residential PV Systems

DEFF Research Database (Denmark)

Sera, Dezso; Spataru, Sergiu; Mathe, Laszlo

2011-01-01

This work proposes a temperature and irradiance sensorless diagnostic method suitable for small residential PV installations, focusing on detection of partial shadows. The method works by detection of failures in crystalline silicone PV arrays by concomitant monitoring of some of their key...

SoC-Based Output Voltage Control for BESS with a Lithium-Ion Battery in a Stand-Alone DC Microgrid

Directory of Open Access Journals (Sweden)

Seung-Yeong Yu

2016-11-01

Full Text Available This paper proposes a new DC output voltage control for a battery energy storage system (BESS with a lithium-ion battery based on the state of charge (SoC. The proposed control scheme was verified through computer simulations for a typical stand-alone DC microgrid, which consists of a BESS, photovoltaic (PV panel, engine generator (EG, and DC load. A scaled hardware prototype for a stand-alone DC microgrid was set up in the lab, in which the proposed control scheme was loaded in a DSP controller. The experimental results were compared with the simulation results for performance verification. The proposed control scheme provides relatively lower variation of the DC grid voltage than the conventional droop control.

City and County Solar PV Training Program, Module 2: Screening and Identifying PV Projects

Energy Technology Data Exchange (ETDEWEB)

Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2018-04-09

When screening and identifying PV projects, cities and counties should understand the different factors that impact the technical and economic potential of a PV project, the steps of the PV screening process, and how to use REopt Lite to screen a site for PV and storage project potential.

Ectopic Expression of the Wild Grape WRKY Transcription Factor VqWRKY52 in Arabidopsis thaliana Enhances Resistance to the Biotrophic Pathogen Powdery Mildew But Not to the Necrotrophic Pathogen Botrytis cinerea.

Science.gov (United States)

Wang, Xianhang; Guo, Rongrong; Tu, Mingxing; Wang, Dejun; Guo, Chunlei; Wan, Ran; Li, Zhi; Wang, Xiping

2017-01-01

WRKY transcription factors are known to play important roles in plant responses to biotic stresses. We previously showed that the expression of the WRKY gene, VqWRKY52 , from Chinese wild Vitis quinquangularis was strongly induced 24 h post inoculation with powdery mildew. In this study, we analyzed the expression levels of VqWRKY52 following treatment with the defense related hormones salicylic acid (SA) and methyl jasmonate, revealing that VqWRKY52 was strongly induced by SA but not JA. We characterized the VqWRKY52 gene, which encodes a WRKY III gene family member, and found that ectopic expression in Arabidopsis thaliana enhanced resistance to powdery mildew and Pseudomonas syringae pv. tomato DC3000, but increased susceptibility to Botrytis cinerea , compared with wild type (WT) plants. The transgenic A. thaliana lines displayed strong cell death induced by the biotrophic powdery mildew pathogen, the hemibiotrophic P. syringe pathogen and the necrotrophic pathogen B. cinerea . In addition, the relative expression levels of various defense-related genes were compared between the transgenic A. thaliana lines and WT plants following the infection by different pathogens. Collectively, the results indicated that VqWRKY52 plays essential roles in the SA dependent signal transduction pathway and that it can enhance the hypersensitive response cell death triggered by microbial pathogens.

A dual resistance gene system prevents infection by three distinct pathogens.

Science.gov (United States)

Narusaka, Mari; Kubo, Yasuyuki; Shiraishi, Tomonori; Iwabuchi, Masaki; Narusaka, Yoshihiro

2009-10-01

Colletotrichum higginsianum causes typical anthracnose lesions on the leaves, petioles, and stems of cruciferous plants. Inoculation of Arabidopsis thaliana ecotype Columbia leaves with C. higginsianum results in fungal growth and disease symptoms reminiscent of those induced in other cruciferous plants. We performed map-based cloning and natural variation analysis of 19 A. thaliana ecotypes to identify a dominant resistance locus against C. higginsianum. We found that the A. thaliana RCH2 (for recognition of C. higginsianum) locus encodes two NB-LRR proteins, both of which are required for resistance to C. higginsianum in the A. thaliana ecotype Ws-0. Both proteins are well-characterized R proteins involved in resistance against bacterial pathogens; RRS1 (resistance to Ralstonia solanacearum 1) confers resistance to strain Rs1000 of R. solanacearum and RPS4 to Pseudomonas syringae pv. tomato strain DC3000 expressing avrRps4 (Pst-avrRps4). Furthermore, we found that both RRS1-Ws and RPS4-Ws genes are required for resistance to Pst-avrRps4 and to Rs1002 R. solanacearum. We therefore demonstrate that a pair of neighboring genes, RRS1-Ws and RPS4-Ws, function cooperatively as a dual R-gene system against at least three distinct pathogens.

Cysteine homeostasis plays an essential role in plant immunity.

Science.gov (United States)

Álvarez, Consolación; Bermúdez, M Ángeles; Romero, Luis C; Gotor, Cecilia; García, Irene

2012-01-01

• Cysteine is the metabolic precursor of essential biomolecules such as vitamins, cofactors, antioxidants and many defense compounds. The last step of cysteine metabolism is catalysed by O-acetylserine(thiol)lyase (OASTL), which incorporates reduced sulfur into O-acetylserine to produce cysteine. In Arabidopsis thaliana, the main OASTL isoform OAS-A1 and the cytosolic desulfhydrase DES1, which degrades cysteine, contribute to the cytosolic cysteine homeostasis. • Meta-analysis of the transcriptomes of knockout plants for OAS-A1 and for DES1 show a high correlation with the biotic stress series in both cases. • The study of the response of knockout mutants to plant pathogens shows that des1 mutants behave as constitutive systemic acquired resistance mutants, with high resistance to biotrophic and necrotrophic pathogens, salicylic acid accumulation and WRKY54 and PR1 induction, while oas-a1 knockout mutants are more sensitive to biotrophic and necrotrophic pathogens. However, oas-a1 knockout mutants lack the hypersensitive response associated with the effector-triggered immunity elicited by Pseudomonas syringae pv. tomato DC3000 avrRpm1. • Our results highlight the role of cysteine as a crucial metabolite in the plant immune response. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

PV power plants

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-07-01

Within the international seminar of the Ostbayerisches Technologie-Transfer-Institut e.V. (OTTI) at 11th June, 2012 in Munich (Federal Republic of Germany), the following lectures were held: (1) Technical due diligence (Dietmar Obst); (2) Certification / rating system for large PV plants (Robert Pfatischer); (3) O and M requirements (Lars Rulf); (4) IR photography for large scale systems (Bernhard Weinreich); (5) New market models for PV systems - direct marketing and sales of PV electricity (Martin Schneider); (6) Needs and benefits for plant certification for grid connection and operation (Christoph Luetke-Lengerich); (7) Lare volume module testing / Screening in the field and workshop (Semir Merzoug); (8) Dismantling costs of large scale PV plants (Siegfried Schimpf).

Anti-atherosclerotic effects of tomatoes

Directory of Open Access Journals (Sweden)

Hidekatsu Yanai

2017-06-01

Full Text Available Tomatoes are rich in lycopene, which causes the red coloring of tomatoes. Several reports have suggested lycopene plays a role in the prevention of cardiovascular diseases. In this study, we systematically reviewed the interventional studies using tomatoes or tomato products to understandtheanti-atherosclerotic effects of the tomatoas a functional food. We found that a significantnumber of interventional studies reportedtheanti-atherosclerotic effects of tomatoes, includinganti-obesity effects, hypotensiveeffects, improvement of lipid/glucose metabolismand endothelial function, anti-oxidative and anti-inflammatory effect, and anti-platelet effect; however, the anti-platelet effect was disagreed uponby some studies. Furthermore, we discoveredcooking methods significantlyaffect anti-atherosclerotic effects of tomatoes.

Control Strategy for Three-Phase Grid-Connected PV Inverters Enabling Current Limitation Under Unbalanced Faults

DEFF Research Database (Denmark)

Afshari, Ehsan; Moradi, Gholam Reza; Rahimi, Ramin

2017-01-01

Power quality and voltage control are among the most important aspects of the grid-connected power converter operation under faults. Non-sinusoidal current is injected during unbalanced voltage sag and active or/and reactive power includes double frequency content. This paper introduces a novel...... control strategy to mitigate the double grid frequency oscillations in the active power and dc-link voltage of the two-stage three-phase grid-connected Photovoltaic (PV) inverters during unbalanced faults. With the proposed control method, PV inverter injects sinusoidal currents under unbalanced grid...... faults. In addition, an efficient and easy-to-implement current limitation method is introduced, which can effectively limit the injected currents to the rated value during faults. In this case, the fault-ride-through operation is ensured and it will not trigger the overcurrent protection. A non...

Tomato Preserves.

Science.gov (United States)

Stevens, Wendy Tessman

1996-01-01

Describes a project in which students selected seeds from two heirloom varieties of tomatoes, sowed the seeds, harvested the tomatoes, and fermented the seeds. Details are provided for each step of the project and the school address is included so that other students can begin similar projects. (DDR)

Expression of the Bs2 pepper gene confers resistance to bacterial spot disease in tomato.

Science.gov (United States)

Tai, T H; Dahlbeck, D; Clark, E T; Gajiwala, P; Pasion, R; Whalen, M C; Stall, R E; Staskawicz, B J

1999-11-23

The Bs2 resistance gene of pepper specifically recognizes and confers resistance to strains of Xanthomonas campestris pv. vesicatoria that contain the corresponding bacterial avirulence gene, avrBs2. The involvement of avrBs2 in pathogen fitness and its prevalence in many X. campestris pathovars suggests that the Bs2 gene may be durable in the field and provide resistance when introduced into other plant species. Employing a positional cloning strategy, the Bs2 locus was isolated and the gene was identified by coexpression with avrBs2 in an Agrobacterium-mediated transient assay. A single candidate gene, predicted to encode motifs characteristic of the nucleotide binding site-leucine-rich repeat class of resistance genes, was identified. This gene specifically controlled the hypersensitive response when transiently expressed in susceptible pepper and tomato lines and in a nonhost species, Nicotiana benthamiana, and was designated as Bs2. Functional expression of Bs2 in stable transgenic tomatoes supports its use as a source of resistance in other Solanaceous plant species.

Physicochemical and microbiological evaluation of sun dried tomatoes in comparison with fresh tomatoes

International Nuclear Information System (INIS)

Sohail, M.

2011-01-01

The present study was conducted to evaluate the quality of sun dried tomatoes in comparison with fresh tomatoes. Fresh fully ripen tomatoes were washed and cut in thin slices with sterilized stainless steel knife and divided into two lots, one was taken as control and other was dipped in 3% potassium meta bisulfite solution for 5 minutes. The samples were spread over stainless steel trays covered with muslin cloth and kept in solar dehydrator for 5 days at 55 +- 2 deg. C. The physicochemical analyses were carried out in both dried and fresh (control) tomatoes. They were also analyzed microbiologically for bacterial and fugal count. Results showed that sun dried tomatoes are microbiologically safe. The values of moisture content and vitamin C of fresh and sun dried tomatoes statistically differ from each others at probability level of 5 %. The nutrient which is highly affected by sun drying is vitamin C. In fresh tomatoes it was 32.5 mg/100 g which is reduced to 24.6 mg/100 g after sun drying and further reduced to 15.86 mg/100 g during three months storage. The moisture content of the fresh tomatoes was 94.4% which decreased to 8.15% after drying, and then slowly increased to 9.95% in the three months storage. Statistically no major difference was found in the other nutrients during storage, which indicates that sun drying is nutritionally and microbiologically safe and can be used to preserve tomatoes and other fruits and vegetables for off season use. (author)

How much electricity can we save by using direct current circuits in homes? Understanding the potential for electricity savings and assessing feasibility of a transition towards DC powered buildings

International Nuclear Information System (INIS)

Glasgo, Brock; Azevedo, Inês Lima; Hendrickson, Chris

2016-01-01

Highlights: • DC distribution systems are analyzed using monitored appliance and solar PV data. • DC-distributed PV energy generates savings under real-world load and solar profiles. • Savings from direct-DC are generally not cost-effective in current markets. • Non-technical hurdles remain before DC can be widely adopted in US homes. - Abstract: Advances in semiconductor-based power electronics and growing direct current loads in buildings have led researchers to reconsider whether buildings should be wired with DC circuits to reduce power conversions and facilitate a transition to efficient DC appliances. The feasibility, energy savings, and economics of such systems have been assessed and proven in data centers and commercial buildings, but the outcomes are still uncertain for the residential sector. In this work, we assess the technical and economic feasibility of DC circuits using data for 120 traditionally-wired AC homes in Austin, Texas to understand the effect of highly variable demand profiles on DC-powered residences, using appliance-level use and solar generation data, and performing a Monte Carlo simulation to quantify costs and benefits. Results show site energy savings between 9% and 20% when solar PV is distributed to all home appliances. When battery storage for excess solar energy is considered, these savings increase to 14–25%. At present DC equipment prices, converting all equipment to DC causes levelized annual costs of electricity to homeowners to roughly double. However, by converting only homes’ air conditioning condensing units to DC, the costs of direct-DC are greatly reduced and home site energy savings of 7–16% are generated. In addition to quantifying savings, we find major nontechnical barriers to implementing direct-DC in homes. These include a lack of standards for such systems, a relatively small market for DC appliances and components, utility programs designed for AC power, and a workforce unfamiliar with DC

Modeling and Implementing a Digitally Embedded Maximum Power Point Tracking Algorithm and a Series-Loaded Resonant DC-DC Converter to Integrate a Photovoltaic Array with a Micro-Grid

Science.gov (United States)

2014-09-01

These renewable energy sources can include solar, wind, geothermal , biomass, hydroelectric, and nuclear. Of these sources, photovoltaic (PV) arrays...renewable energy source [1]. These renewable energy sources can include solar, wind, geothermal , biomass, hydroelectric, and nuclear. Of these sources...26, May 2011. [6] H. G. Xu, J. P. He, Y. Qin, and Y. H. Li, “Energy management and control strategy for DC micro-grid in data center,” China

PV Obelisk - Information system with photovoltaics; PV-Obelisk Orientierungssystem mit Photovoltaik

Energy Technology Data Exchange (ETDEWEB)

Ruoss, D.; Rasmussen, J.

2004-07-01

This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed.

Cytogenetic and molecular studies on tomato chromosomes using diploid tomato and tomato monosomic additions in tetraploid potato

NARCIS (Netherlands)

Chang, S.B.

2004-01-01

Geneticists have studied the tomato, Lycopersicon esculentum, for several decades and now obtained a saturated linkage map on which numerous genes controlling morphological traits and disease resistances, and molecular markers have been positioned. They also investigated the chromosomes of tomato,

EFFECTIVE COMPLEX PROCESSING OF RAW TOMATOES

Directory of Open Access Journals (Sweden)

AIDA M. GADZHIEVA

2018-03-01

Full Text Available Tomatoes grown in the central and southern parts of the country, which contain 5 - 6 % of solids, including 0.13 % of pectin, 0.86 % of fat, 0.5 % of organic acids, 0.5 % minerals, etc. are used as research material. These tomatoes, grown in the mountains, on soils with high salinity, contain high amounts of valuable components and have long term preservation. For the extraction of valuable components from dried tomato pomace, the CO2 extraction method is applied. The technological and environmental feasibility of graded tomato drying in the atmosphere of an inert gas and in a solar drier is evaluated; the scheme of dried tomatoes production is improved; a system for tomato pomace drying is developed; a scheme of tomato powder production from pulp, skin and seeds is developed. The combined method of tomato pomace drying involves the simultaneous use of electromagnetic field of low and ultra-high frequency and blowing hot nitrogen on the product surface. Conducting the drying process in the atmosphere of nitrogen intensifies the process of removing moisture from tomatoes. The expediency of using tomato powder as an enriching additive is proved. Based on the study of the chemical composition of the tomato powder made from the Dagestan varieties, and on the organoleptic evaluation and physicochemical analysis of finished products, we prove the best degree of recoverability of tomato powder in the production of reconstituted juice and tomato beverages.

21 CFR 155.190 - Canned tomatoes.

Science.gov (United States)

2010-04-01

... tomatoes. (a) Identity—(1) Description. (i) Canned tomatoes is the food prepared from mature tomatoes...). Without shifting the tomatoes, so incline the sieve as to facilitate drainage of the liquid. Two minutes...

Novel Methods to Determine Feeder Locational PV Hosting Capacity and PV Impact Signatures

Energy Technology Data Exchange (ETDEWEB)

Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Coogan, Kyle [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2017-05-01

Often PV hosting capacity analysis is performed for a limited number of distribution feeders. For medium - voltage distribution feeders, previous results generally analyze less than 20 feeders, and then the results are extrapolated out to similar types of feeders. Previous hosting capacity research has often focused on determining a single value for the hosting capacity for the entire feeder, whereas this research expands previous hosting capacity work to investigate all the regions of the feeder that may allow many different hosting capacity values wit h an idea called locational hosting capacity (LHC)to determine the largest PV size that can be interconnected at different locations (buses) on the study feeders. This report discusses novel methods for analyzing PV interconnections with advanced simulati on methods. The focus is feeder and location - specific impacts of PV that determine the locational PV hosting capacity. Feeder PV impact signature are used to more precisely determine the local maximum hosting capacity of individual areas of the feeder. T he feeder signature provides improved interconnection screening with certain zones that show the risk of impact to the distribution feeder from PV interconnections.

The tomato sauce making process affects the bioaccessibility and bioavailability of tomato phenolics: a pharmacokinetic study.

Science.gov (United States)

Martínez-Huélamo, Miriam; Tulipani, Sara; Estruch, Ramón; Escribano, Elvira; Illán, Montserrat; Corella, Dolores; Lamuela-Raventós, Rosa M

2015-04-15

Tomato sauce is the most commonly consumed processed tomato product worldwide, but very little is known about how the manufacturing process may affect the phenolic composition and bioavailability after consumption. In a prospective randomised, cross-over intervention study, we analysed the plasma and urinary levels of tomato phenolic compounds and their metabolites after acute consumption of raw tomatoes and tomato sauce, enriched or not with refined olive oil during production. Respectively, eleven and four phenolic metabolites were found in urine and plasma samples. The plasma concentration and urinary excretion of naringenin glucuronide were both significantly higher after the consumption of tomato sauce than raw tomatoes. The results suggest that the mechanical and thermal treatments during tomato sauce manufacture may help to deliver these potentially bioactive phenolics from the food matrix more effectively than the addition of an oil component, thus increasing their bioavailability. Copyright © 2014 Elsevier Ltd. All rights reserved.

Energy balance of the global photovoltaic (PV) industry--is the PV industry a net electricity producer?

Science.gov (United States)

Dale, Michael; Benson, Sally M

2013-04-02

A combination of declining costs and policy measures motivated by greenhouse gas (GHG) emissions reduction and energy security have driven rapid growth in the global installed capacity of solar photovoltaics (PV). This paper develops a number of unique data sets, namely the following: calculation of distribution of global capacity factor for PV deployment; meta-analysis of energy consumption in PV system manufacture and deployment; and documentation of reduction in energetic costs of PV system production. These data are used as input into a new net energy analysis of the global PV industry, as opposed to device level analysis. In addition, the paper introduces a new concept: a model tracking energetic costs of manufacturing and installing PV systems, including balance of system (BOS) components. The model is used to forecast electrical energy requirements to scale up the PV industry and determine the electricity balance of the global PV industry to 2020. Results suggest that the industry was a net consumer of electricity as recently as 2010. However, there is a >50% that in 2012 the PV industry is a net electricity provider and will "pay back" the electrical energy required for its early growth before 2020. Further reducing energetic costs of PV deployment will enable more rapid growth of the PV industry. There is also great potential to increase the capacity factor of PV deployment. These conclusions have a number of implications for R&D and deployment, including the following: monitoring of the energy embodied within PV systems; designing more efficient and durable systems; and deploying PV systems in locations that will achieve high capacity factors.

An Original Transformer and Switched-Capacitor (T & SC-Based Extension for DC-DC Boost Converter for High-Voltage/Low-Current Renewable Energy Applications: Hardware Implementation of a New T & SC Boost Converter

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2018-03-01

Full Text Available In this article a new Transformer and Switched Capacitor-based Boost Converter (T & SC-BC is proposed for high-voltage/low-current renewable energy applications. The proposed T & SC-BC is an original extension for DC-DC boost converter which is designed by utilizing a transformer and switched capacitor (T & SC. Photovoltaic (PV energy is a fast emergent segment among the renewable energy systems. The proposed T & SC-BC combines the features of the conventional boost converter and T & SC to achieve a high voltage conversion ratio. A Maximum Power Point Tracking (MPPT controller is compulsory and necessary in a PV system to extract maximum power. Thus, a photovoltaic MPPT control mechanism also articulated for the proposed T & SC-BC. The voltage conversion ratio (Vo/Vin of proposed converter is (1 + k/(1 − D where, k is the turns ratio of the transformer and D is the duty cycle (thus, the converter provides 9.26, 13.88, 50/3 voltage conversion ratios at 78.4 duty cycle with k = 1, 2, 2.6, respectively. The conspicuous features of proposed T & SC-BC are: (i a high voltage conversion ratio (Vo/Vin; (ii continuous input current (Iin; (iii single switch topology; (iv single input source; (v low drain to source voltage (VDS rating of control switch; (vi a single inductor and a single untapped transformer are used. Moreover, the proposed T & SC-BC topology was compared with recently addressed DC-DC converters in terms of number of components, cost, voltage conversion ratio, ripples, efficiency and power range. Simulation and experimental results are provided which validate the functionality, design and concept of the proposed approach.

Maximum power point tracking for PV systems under partial shading conditions using current sweeping

International Nuclear Information System (INIS)

Tsang, K.M.; Chan, W.L.

2015-01-01

Highlights: • A novel approach for tracking the maximum power point of photovoltaic systems. • Able to handle both the uniform insolation and partial shading conditions. • Maximum power point tracking based on current sweeping. - Abstract: Partial shading on photovoltaic (PV) arrays causes multiple peaks on the output power–voltage characteristic curve and local searching technique such as perturb and observe (P&O) method could easily fail in searching for the global maximum. Moreover, existing global searching techniques are still not very satisfactory in terms of speed and implementation complexity. In this paper, a fast global maximum power point (MPPT) tracking method which is using current sweeping for photovoltaic arrays under partial shading conditions is proposed. Unlike conventional approach, the proposed method is current based rather than voltage based. The initial maximum power point will be derived based on a current sweeping test and the maximum power point can be enhanced by a finer local search. The speed of the global search is mainly governed by the apparent time constant of the PV array and the generation of a fast current sweeping test. The fast current sweeping test can easily be realized by a DC/DC boost converter with a very fast current control loop. Experimental results are included to demonstrate the effectiveness of the proposed global searching scheme

Zesty Tomato Soup

Science.gov (United States)

... https://medlineplus.gov/recipe/zestytomatosoup.html Zesty Tomato Soup To use the sharing features on this page, ... Number of Servings: 4 Not your traditional tomato soup, this quick-cooking dish can be a side ...

Transgenic tomato hybrids resistant to tomato spotted wilt virus infection.

NARCIS (Netherlands)

Haan, de P.; Ultzen, T.; Prins, M.; Gielen, J.; Goldbach, R.; Grinsven, van M.

1996-01-01

Tomato spotted wilt virus (TSWV) infections cause significant economic losses in the commercial culture of tomato (Lycopersicon esculentum). Culture practices have only been marginally effective in controlling TSWV. The ultimate way to minimize losses caused by TSWV is resistant varieties. These can

Coexistence between neighbours

DEFF Research Database (Denmark)

Shenge, K.C.; Mabagala, R.B.; Mortensen, C A Nieves Paulino

2008-01-01

Experiments were conducted under laboratory and screenhouse conditions to study the coexistence between Pseudomonas syringae pv. tomato and Xanthomonas campestris pv. vesicatoria, incitants of bacterial speck and bacterial spot diseases of tomato. Results of in vitro studies showed that when mixe...

Influence of the Preparation Method, DC and RF Sputtering, on theProperties of Thin Film

International Nuclear Information System (INIS)

Tri-Mardji-Atmono; Widdi-Usada; Agus-Purwadi; Yunanto; Edi-Suharyadi

2000-01-01

The research on the influence of preparation method DC- and RF Sputteringon the properties of Fe-thin films has been done. The measurement with EDAXshows. that the Fe-content of RF-sputtered film increased with the increasingof self-bias voltage in the range of 850 - 1000 V. The observation ofmicrostructure using SEM shows a more homogeneity of thin film and smallergrain size with the increasing of the self-bias voltage. On the other hand,thin films with inhomogeneity of the structure were produced by DC-Sputteringprocess, indicated by the non continuity and the spread of theglow-discharge. Based on the investigation with X-ray diffraction, thin filmprepared by RF-Sputtering was amorphous, while the film produced by theDC-Sputtering is known as crystal structure. Preparation using DC-voltageshows continual sputtering-process at the voltage of 3000 V betweenelectrode. (author)

CLOSED LOOP CONTROL OF EMBEDDED Z-SOURCE INVERTER WITH FUZZY CONTROLLER FOR SOLAR PV APPLICATIONS

OpenAIRE

Midde Mahesh*, K. Leleedhar Rao

2017-01-01

This paper proposes the use of Embedded Z –source inverter system with fuzzy controller for Solar Photo Voltaic (PV) applications with adjustable speed drives. Closed loop operation FUZZY control strategies of EZSI system are proposed. EZSI produces the same voltage gain as Z-source inverter (ZSI) but due to the DC sources embedded within the X- shaped impedance network, it has the added advantage of inherent source filtering capability and also reduced capacitor sizing. This can be achiev...

PV Thermal systems: PV panels supplying renewable electricity and heat

NARCIS (Netherlands)

Helden, van W.G.J.; Zolingen, van R.J.C.; Zondag, H.A.

2004-01-01

With PV Thermal panels sunlight is converted into electricity and heat simultaneously. Per unit area the total efficiency of a PVT panel is higher than the sum of the efficiencies of separate PV panels and solar thermal collectors. During the last 20 years research into PVT techniques and concepts

Module-level DC/DC conversion for photovotaic systems : the delta-conversion concept

NARCIS (Netherlands)

Bergveld, H.J.; Büthker, D.; Castello, C.; Doorn, T.S.; Jong, de A.; van Otten, R.; Waal, de K.

2013-01-01

Photovoltaic (PV) systems are increasingly used to generate electrical energy from solar irradiation incident on PV modules. PV modules are formed by placing many PV cells in series. The PV system is then formed by placing a number of PV modules in series in a string. In practical cases, differences

Enhanced Arabidopsis pattern-triggered immunity by overexpression of cysteine-rich receptor-like kinases.

Science.gov (United States)

Yeh, Yu-Hung; Chang, Yu-Hsien; Huang, Pin-Yao; Huang, Jing-Bo; Zimmerli, Laurent

2015-01-01

Upon recognition of microbe-associated molecular patterns (MAMPs) such as the bacterial flagellin (or the derived peptide flg22) by pattern-recognition receptors (PRRs) such as the FLAGELLIN SENSING2 (FLS2), plants activate the pattern-triggered immunity (PTI) response. The L-type lectin receptor kinase-VI.2 (LecRK-VI.2) is a positive regulator of Arabidopsis thaliana PTI. Cysteine-rich receptor-like kinases (CRKs) possess two copies of the C-X8-C-X2-C (DUF26) motif in their extracellular domains and are thought to be involved in plant stress resistance, but data about CRK functions are scarce. Here, we show that Arabidopsis overexpressing the LecRK-VI.2-responsive CRK4, CRK6, and CRK36 demonstrated an enhanced PTI response and were resistant to virulent bacteria Pseudomonas syringae pv. tomato DC3000. Notably, the flg22-triggered oxidative burst was primed in CRK4, CRK6, and CRK36 transgenics and up-regulation of the PTI-responsive gene FLG22-INDUCED RECEPTOR-LIKE 1 (FRK1) was potentiated upon flg22 treatment in CRK4 and CRK6 overexpression lines or constitutively increased by CRK36 overexpression. PTI-mediated callose deposition was not affected by overexpression of CRK4 and CRK6, while CRK36 overexpression lines demonstrated constitutive accumulation of callose. In addition, Pst DC3000-mediated stomatal reopening was blocked in CRK4 and CRK36 overexpression lines, while overexpression of CRK6 induced constitutive stomatal closure suggesting a strengthening of stomatal immunity. Finally, bimolecular fluorescence complementation and co-immunoprecipitation analyses in Arabidopsis protoplasts suggested that the plasma membrane localized CRK4, CRK6, and CRK36 associate with the PRR FLS2. Association with FLS2 and the observation that overexpression of CRK4, CRK6, and CRK36 boosts specific PTI outputs and resistance to bacteria suggest a role for these CRKs in Arabidopsis innate immunity.

A Single-Phase Current Source Solar Inverter with Constant Instantaneous Power, Improved Reliability, and Reduced-Size DC-Link Filter

Science.gov (United States)

Bush, Craig R.

This dissertation presents a novel current source converter topology that is primarily intended for single-phase photovoltaic (PV) applications. In comparison with the existing PV inverter technology, the salient features of the proposed topology are: a) the low frequency (double of line frequency) ripple that is common to single-phase inverters is greatly reduced; b) the absence of low frequency ripple enables significantly reduced size pass components to achieve necessary DC-link stiffness and c) improved maximum power point tracking (MPPT) performance is readily achieved due to the tightened current ripple even with reduced-size passive components. The proposed topology does not utilize any electrolytic capacitors. Instead an inductor is used as the DC-link filter and reliable AC film capacitors are utilized for the filter and auxiliary capacitor. The proposed topology has a life expectancy on par with PV panels. The proposed modulation technique can be used for any current source inverter where an unbalanced three-phase operation is desires such as active filters and power controllers. The proposed topology is ready for the next phase of microgrid and power system controllers in that it accepts reactive power commands. This work presents the proposed topology and its working principle supported by with numerical verifications and hardware results. Conclusions and future work are also presented.

Comparison of three different methods of perturbing the potential vorticity field in mesoscale forecasts of Mediterranean heavy precipitation events: PV-gradient, PV-adjoint and PV-satellite

Science.gov (United States)

Vich, M.; Romero, R.; Richard, E.; Arbogast, P.; Maynard, K.

2010-09-01

Heavy precipitation events occur regularly in the western Mediterranean region. These events often have a high impact on the society due to economic and personal losses. The improvement of the mesoscale numerical forecasts of these events can be used to prevent or minimize their impact on the society. In previous studies, two ensemble prediction systems (EPSs) based on perturbing the model initial and boundary conditions were developed and tested for a collection of high-impact MEDEX cyclonic episodes. These EPSs perturb the initial and boundary potential vorticity (PV) field through a PV inversion algorithm. This technique ensures modifications of all the meteorological fields without compromising the mass-wind balance. One EPS introduces the perturbations along the zones of the three-dimensional PV structure presenting the local most intense values and gradients of the field (a semi-objective choice, PV-gradient), while the other perturbs the PV field over the MM5 adjoint model calculated sensitivity zones (an objective method, PV-adjoint). The PV perturbations are set from a PV error climatology (PVEC) that characterizes typical PV errors in the ECMWF forecasts, both in intensity and displacement. This intensity and displacement perturbation of the PV field is chosen randomly, while its location is given by the perturbation zones defined in each ensemble generation method. Encouraged by the good results obtained by these two EPSs that perturb the PV field, a new approach based on a manual perturbation of the PV field has been tested and compared with the previous results. This technique uses the satellite water vapor (WV) observations to guide the correction of initial PV structures. The correction of the PV field intents to improve the match between the PV distribution and the WV image, taking advantage of the relation between dark and bright features of WV images and PV anomalies, under some assumptions. Afterwards, the PV inversion algorithm is applied to run

PV Array Driven Adjustable Speed Drive for a Lunar Base Heat Pump

Science.gov (United States)

Domijan, Alexander, Jr.; Buchh, Tariq Aslam

1995-01-01

A study of various aspects of Adjustable Speed Drives (ASD) is presented. A summary of the relative merits of different ASD systems presently in vogue is discussed. The advantages of using microcomputer based ASDs is now widely understood and accepted. Of the three most popular drive systems, namely the Induction Motor Drive, Switched Reluctance Motor Drive and Brushless DC Motor Drive, any one may be chosen. The choice would depend on the nature of the application and its requirements. The suitability of the above mentioned drive systems for a photovoltaic array driven ASD for an aerospace application are discussed. The discussion is based on the experience of the authors, various researchers and industry. In chapter 2 a PV array power supply scheme has been proposed, this scheme will have an enhanced reliability in addition to the other known advantages of the case where a stand alone PV array is feeding the heat pump. In chapter 3 the results of computer simulation of PV array driven induction motor drive system have been included. A discussion on these preliminary simulation results have also been included in this chapter. Chapter 4 includes a brief discussion on various control techniques for three phase induction motors. A discussion on different power devices and their various performance characteristics is given in Chapter 5.

COMPLEX PROCESSING TECHNOLOGY OF TOMATO RAW MATERIALS

Directory of Open Access Journals (Sweden)

A. M. Gadzhieva

2015-01-01

Full Text Available Tomatoes grown in the central and southern parts of the country, which contain 5-6 % of solids, including 0.13 % of pectin, 0.86 % of fat, 0.5 % of organic acids; 0.5 % minerals, etc. were used as a subject of research. These tomatoes, grown in the mountains, on soils with high salinity, contain high amounts of valuable components and have a long-term preservation. For the extraction of valuable components from dried tomato pomace CO2 extraction method was applied. Technological and environmental feasibility of tomatoes stage drying in the atmosphere of inert gas in solar dry kiln were evaluated; production scheme of dried tomatoes is improved; a system for tomato pomace drying is developed; a production scheme of powders of pulp, skin and seeds of tomatoes is developed. Combined method of tomato pomace drying involves the simultaneous use of the electromagnetic field of low and ultra-high frequency and blowing product surface with hot nitrogen. Conducting the drying process in an inert gas atmosphere of nitrogen intensified the process of moisture removing from tomatoes. The expediency of using tomato powder as enriching additive was proved. Based on the study of the chemical composition of the tomato powder made from Dagestan varieties of tomatoes, and on the organoleptic evaluation and physico-chemical studies of finished products, we have proved the best degree of recoverability of tomato powder during the production of reconstituted juice and tomato beverages.

Photovoltaics for Buildings Cutting-Edge PV

International Nuclear Information System (INIS)

Hayter, S. J.; Martin, R. L.

1998-01-01

Photovoltaic (PV) technology development for building-integrated applications (commonly called PV for Buildings) is one of the fastest growing areas in the PV industry. Buildings represent a huge potential market for photovoltaics because they consume approximately two-thirds of the electricity consumed in the US. The PV and buildings industries are beginning to work together to address issues including building codes and standards, integration, after-market servicing, education, and building energy efficiency. One of the most notable programs to encourage development of new PV-for-buildings products is the PV:BONUS program, supported by the US Department of Energy. Demand for these products from building designers has escalated since the program was initiated in 1993. This paper presents a range of PV-for-buildings issues and products that are currently influencing today's PV and buildings markets

Global PV Market Development

International Nuclear Information System (INIS)

Schmidt, F.

2009-01-01

The dawn of 2009 saw several events which caused major turbulence in the global photovoltaic industry. In 2008 the Spanish PV market grew beyond all expectations and even outranked Germany as the world's number one market. However, the promotion scheme was modified and a market cap was introduced in 2009, cutting back the maximum capacity to be installed to about the level of 2007. In addition, the industry is facing an oversupply of PV modules and a harsh recession which is significantly affecting the traditionally strong PV markets. International photovoltaic companies are challenged by a changing market situation: all of a sudden, competition has increased significantly, pushing the customer to the fore. As a result, a consolidation process is expected within the PV industry worldwide. However, the story is not all negative. In the U.S., the election of Barack Obama may be seen as the starting signal for a massive expansion in PV, likely to bring the country to first place globally within the next five years. Furthermore, different markets and market segments are being opened up - especially in Europe - thanks to the gradual arrival of generation parity and new PV support mechanisms. EuPD Research has observed and studied international PV markets since its foundation. The information included in the presentation is based on a wide range of quantitative and qualitative studies that EuPD Research has conducted in the key markets since 2002. Florian Schmidt, EuPD Research's Head of Product Management, will give an overview of the global PV market and how it is developing in this crucial year 2009. Aspects such as technology development, production capacities and the demand side will be included, with a special emphasis on the European PV markets. So far Chinese PV companies have often benefited from the booming PV markets in Europe, above all Germany and Spain. Due to the lack of domestic market, the Chinese industry strongly depends on the export and is

Tomato Sauce Enriched with Olive Oil Exerts Greater Effects on Cardiovascular Disease Risk Factors than Raw Tomato and Tomato Sauce: A Randomized Trial

Directory of Open Access Journals (Sweden)

Palmira Valderas-Martinez

2016-03-01

Full Text Available Epidemiological studies have observed a negative association between tomato intake and the incidence of cardiovascular disease. As tomato sauces are usually cooked with the addition of oil, some studies have pointed out that both processes may increase the bioavailability of the bioactive compounds. However, the effect of consumption of raw tomatoes and tomato sauces on inflammation biomarkers and adhesion molecules related to atherosclerosis remains unknown. The aim of this study was to test the postprandial effects of a single dose of raw tomatoes (RT, tomato sauce (TS and tomato sauce with refined olive oil (TSOO on cardiovascular disease risk factors. We performed an open, prospective, randomized, cross-over, controlled feeding trial in 40 healthy subjects who randomly received: 7.0 g of RT/kg of body weight (BW, 3.5 g of TS/kg BW, 3.5 g of TSOO/Kg BW and 0.25 g of sugar solved in water/kg BW on a single occasion on four different days. Biochemical parameters and cellular and circulating inflammatory biomarkers were assessed at baseline and 6 h after each intervention. The results indicate that, compared to control intervention, a single tomato intake in any form decreased plasma total cholesterol, triglycerides and several cellular and plasma inflammatory biomarkers, and increased plasma high density lipoproteins (HDL cholesterol and interleukine (IL 10 concentrations. However, the changes of plasma IL-6 and vascular cell adhesion molecule-1 (VCAM-1, and lymphocyte function-associated antigen-1 (LFA-1 from T-lymphocytes and CD36 from monocytes were significantly greater after TSOO than after RT and TS interventions. We concluded that tomato intake has beneficial effects on cardiovascular risk factors, especially cooked and enriched with oil.

Seleção de bactérias endofíticas de tomateiro como potenciais agentes de biocontrole e de promoção de crescimento Screening of endophytic bacteria isolated from tomato plants as potencial biocontrol agents and growth promotion

Directory of Open Access Journals (Sweden)

Patrícia Baston Barretti

2009-01-01

Full Text Available Quarenta isolados bacterianos endofíticos de plantas sadias de tomateiro foram avaliados quanto à sua potencialidade como agentes de biocontrole de doenças do tomateiro. Foi realizada, em casa de vegetação, uma seleção massal utilizando-se Pseudomonas syringae pv. tomato e Alternaria solani, como patógenos desafiantes. Com base na média do número de lesões por planta, quatro isolados foram selecionados como potenciais agentes de biocontrole dessas enfermidades fúngica e bacteriana do tomateiro. Esses isolados foram identificados, por meio do sequenciamento do gene 16S do DNA ribossômico, como Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 e Bacillus megaterium (UFV-E26. Os mesmos isolados selecionados para o biocontrole também foram avaliados quanto à sua capacidade de promover o crescimento em plantas e somente S. marcescens (UFV-E13 proporcionou aumento na altura das plantas.Forty isolates of endophytic bacteria obtained from healthy tomato plants were tested for their potential as biocontrol agents of tomato diseases. A massal screening was performed at greenhouse using Pseudomonas syringae pv. tomato and Alternaria solani as challenging pathogens. Based on the average number of lesions per plant, four isolates were selected as potential agents of biocontrol of these tomato diseases caused by fungi and bacteria. These isolates were identified by 16S ribosomal DNA sequence analysis as Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 and Bacillus megaterium (UFV-E26. The four endophytes selected for biocontrol were also evaluated for their ability of promoting plant growth and only S. marcescens (UFV-E13 presented increase in the height of the plants.

PV-hybrid and mini-grid

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-07-01

Within the 5th European PV-hybrid and mini-grid conference 29th and 30th April, 2010 in Tarragona (Spain) the following lectures were held: (1) Overview of IEA PVPS Task 11 PV-hybrid systems within mini grids; (2) Photovoltaic revolution for deployment in developing countries; (3) Legal and financial conditions for the sustainable operation of mini-grids; (4) EU instruments to promote renewable energies in developing countries; (5) PV hybridization of diesel electricity generators: Conditions of profitability and examples in differential power and storage size ranges; (6) Education suit of designing PV hybrid systems; (7) Sustainable renewable energy projects for intelligent rural electrification in Laos, Cambodia and Vietnam; (8) Techno-economic feasibility of energy supply of remote villages in Palestine by PV systems, diesel generators and electric grid (Case studies: Emnazeil and Atouf villages); (9) Technical, economical and sustainability considerations of a solar PV mini grid as a tool for rural electrification in Uganda; (10) Can we rate inverters for rural electrification on the basis of energy efficiency?; (11) Test procedures for MPPT charge controllers characterization; (12) Energy storage for mini-grid stabilization; (13) Redox flow batteries - Already an alternative storage solution for hybrid PV mini-grids?; (14) Control methods for PV hybrid mini-grids; (15) Partial AC-coupling in mini-grids; (15) Normative issues of small wind turbines in PV hybrid systems; (16) Communication solutions for PV hybrid systems; (17) Towards flexible control and communication of mini-grids; (18) PV/methanol fuel cell hybrid system for powering a highway security variable message board; (19) Polygeneration smartgrids: A solution for the supply of electricity, potable water and hydrogen as fuel for transportation in remote Areas; (20) Implementation of the Bronsbergen micro grid using FACDS; (21) A revisited approach for the design of PV wind hybrid systems; (22

DC electric springs with DC/DC converters

DEFF Research Database (Denmark)

Wang, Qingsong; Cheng, Ming; Jiang, Yunlei

2016-01-01

The concept of DC electric spring (DCES) was recently proposed to solve the stability issue caused by integrating intermittent renewable energy sources (RESs) to DC microgrids. In this paper, a new topology of DCES is proposed based on DC/DC converters. The proposed DCES consists of a bi-directio......The concept of DC electric spring (DCES) was recently proposed to solve the stability issue caused by integrating intermittent renewable energy sources (RESs) to DC microgrids. In this paper, a new topology of DCES is proposed based on DC/DC converters. The proposed DCES consists of a bi...... and/or constant discharging for batteries is adopted and four operating modes are analyzed as charging-positive, charging-negative, discharging-positive and discharging-negative modes. An additional mechanism for fast charging or fast discharging is also designed to secure normal operation...... of batteries. With the proposed DCES, the power fluctuations due to intermittent RESs can be passed to non-critical loads (NCLs) and batteries while power on critical loads (CLs) is kept stable. This is possibly the first attempt to design a DCES with only DC/DC converters. The performances of the proposed...

Sizing modelling and simulation of PV generation system feeding a 6 MW induction motor dedicated to pumping applications

Directory of Open Access Journals (Sweden)

Samir HADJERI

2017-06-01

Full Text Available This paper proposes an autonomous photovoltaic (PV pumping system for rural/remote applications especially in the large desert in northern Africa where the sun radiation is abundant. Since PV generators exhibit nonlinear I-V characteristics and their maximum power point varies with solar radiation. For this reason, the MPPT controller is used to optimize the solar energy conversion by guaranteeing fast maximum power point tracking (MPPT. This feature has an essential role in dynamic response and efficiency of the photovoltaic system, thus it maximizes the amount of extracted natural gas to be conveyed to another site for an ulterior utilization. Here a robust maximum power point tracker (MPPT using incremental conductance algorithm is applied to the duty cycle value of the DC-DC converter which acts directly on the drive speed. A DC/DC boost is used to enhance voltage up to the favourite level and the SVPWM inverter connects it to a powerful induction motor for a pumping of natural gas application, these systems are at the heart of many industrial sectors such as the oil industry, the production of thermal and nuclear energy etc. An understanding of how these systems operate is essential to increase their performance and reduce their operating costs. Furthermore, three phase voltage-fed PWM inverters are recently showing growing popularity for multi-megawatt industrial drive applications, the main purpose of these topologies is to provide a three-phase voltage source, where the amplitude, phase, and frequency of the voltages should always be controllable. The model of a three-phase voltage source inverter is modelled and discussed based on space vector modulation theory. Simulation results are obtained using MATLAB/Simulink environment for effectiveness of the proposed system.

SunShot 2030 for Photovoltaics (PV): Envisioning a Low-Cost PV Future

Energy Technology Data Exchange (ETDEWEB)

Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zuboy, Jarrett; Woodhouse, Michael A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-10-01

This presentation summarizes the findings from the report 'SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future.' This presentation was given as a webinar on September 26, 2017.

Economic PV - a shift in thinking

International Nuclear Information System (INIS)

Maycock, P.

1999-01-01

This article argues that photovoltaic (PV) technology is already economically viable contrary to current opinion. A table of world PV module shipments for 1990 to 1998 by market sector is presented, and use of PV modules in consumer electronics such as calculators, battery trickle chargers, and garden lights; in communications and signals (eg. microwave repeaters, cellular communication); and in the residential sector in fluorescent lights, radios etc. are discussed. The early adopters of PV technology, and the value placed on PV devices by consumers are considered. Details of PV manufacturing costs for 1997, and forecasts for 2000 and 2010 are tabulated

An Enhanced Inverter Controller for PV Applications Using the dSPACE Platform

Directory of Open Access Journals (Sweden)

M. A. Hannan

2010-01-01

Full Text Available This paper presents the simulation modeling and prototype development of an inverter controller for photovoltaic (PV applications using the dSPACE DS1104 controller platform. The controller platform can link the simulation model developed in the MATLAB/SIMULINK environment to its prototype hardware. In the dSPACE controller, the voltage regulator controls the inverter by employing a proportional integral (PI controller and the Park transformation method to generate sinusoidal pulse-width modulation (SPWM signals. The SPWM signals switch the insulated gate bipolar transistor (IGBT to stabilize the 50-Hz sinusoidal AC output voltages of the inverter. The simulation was performed with a DC power supply that acts as the PV generator to supply the power to the inverter. The simulation model was then translated into the inverter prototype using the dSPACE platform and tested in the laboratory to prove the efficacy of the proposed controller. The experimental results for the inverter system demonstrated the feasibility of the proposed control strategy by maintaining the THD of the output voltage at 4.6%.

Isolated high-efficiency DC/DC converter for photovoltaic applications

NARCIS (Netherlands)

Vermulst, B.J.D.; Wijnands, C.G.E.; Duarte, J.L.

2012-01-01

While an increasing number of photovoltaic (PV) systems is installed, those systems typically use central inverters. In practical cases, output-power differences between PV modules will cause these central-inverter-based systems not to achieve Maximum Power Point (MPP) for each PV module.

Predicting the presence of whiteflies and tomato yellow leaf curl virus in Florida tomato fields

Science.gov (United States)

Florida is one of the leading states for production of fresh market tomatoes. Production is severely affected by Tomato yellow leaf curl virus (TYLCV). The objective of this study was to identify landscape and climatic factors that drive whitefly populations and TYLCV incidence in commercial tomato ...

Tomato juices and tomato juice concentrates : a study of factors contributing to their gross viscosity

NARCIS (Netherlands)

Heutink, R.

1986-01-01

The gross viscosity of tomato juice and tomato juice concentrates was found to be determined primarily by the water insoluble solids (WIS) content. The serum viscosity did not contribute to gross viscosity. The WIS consisted of whole tomato cells, vascular bundles and skin fragments. In general the

Design, fabrication and performance of a hybrid photovoltaic/thermal (PV/T) active solar still

International Nuclear Information System (INIS)

Kumar, Shiv; Tiwari, Arvind

2010-01-01

Two solar stills (single slope passive and single slope photovoltaic/thermal (PV/T) active solar still) were fabricated and tested at solar energy park, IIT New Delhi (India) for composite climate. Photovoltaic operated DC water pump was used between solar still and photovoltaic (PV) integrated flat plate collector to re-circulate the water through the collectors and transfer it to the solar still. The newly designed hybrid (PV/T) active solar still is self-sustainable and can be used in remote areas, need to transport distilled water from a distance and not connected to grid, but blessed with ample solar energy. Experiments were performed for 0.05, 0.10, and 0.15 m water depth, round the year 2006-2007 for both the stills. It has been observed that maximum daily yield of 2.26 kg and 7.22 kg were obtained from passive and hybrid active solar still, respectively at 0.05 m water depth. The daily yield from hybrid active solar still is around 3.2 and 5.5 times higher than the passive solar still in summer and winter month, respectively. The study has shown that this design of the hybrid active solar still also provides higher electrical and overall thermal efficiency, which is about 20% higher than the passive solar still.

Effects of tomato variety, temperature differential and post-stem removal time on internalization of Salmonella Thompson into tomatoes

Science.gov (United States)

Tomatoes have been implicated in several Salmonellosis outbreaks due to possible contamination through bacterial infiltration into tomatoes during post-harvest handling. The aim of this study was to determine the effects of tomato variety, dump tank water to tomato pulp temperature differential, and...

Advanced DC/DC converters

CERN Document Server

Luo, Fang Lin

2003-01-01

DC/DC conversion techniques have undergone rapid development in recent decades. With the pioneering work of these authors, DC/DC converters have now moved into their sixth generation. This book offers a concise, practical presentation of DC/DC converters, summarizing the spectrum of conversion tecnologies and presentingmany new ideas and more than 100 new topologies. Nowhere else in the literature are DC/DC converters so logically sorted and systematically introduced, and nowhere else can readers find detailed information on prototype topologies that represent a major contribution to modern power engineering. More than 320 figures, 60 tables, and 500 formulae facilitate understand and provide precise data.

PV module mounting method and mounting assembly

Science.gov (United States)

Lenox, Carl J.S.; Johnson, Kurt M.

2013-04-23

A method for mounting PV modules to a deck includes selecting PV module layout pattern so that adjacent PV module edges are spaced apart. PV mounting and support assemblies are secured to the deck according to the layout pattern using fasteners extending into the deck. The PV modules are placed on the PV mounting and support assemblies. Retaining elements are located over and secured against the upper peripheral edge surfaces of the PV modules so to secure them to the deck with the peripheral edges of the PV modules spaced apart from the deck. In some examples a PV module mounting assembly, for use on a shingled deck, comprises flashing, a base mountable on the flashing, a deck-penetrating fastener engageable with the base and securable to the deck so to secure the flashing and the base to the shingled deck, and PV module mounting hardware securable to the base.

2015 South Carolina PV Soft Cost and Workforce Development Part 2: Six Month Confirmation of Anticipated Job Growth

Energy Technology Data Exchange (ETDEWEB)

Fox, Elise B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Edwards, Thomas B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2017-01-31

In 2015, a program was initiated to carefully track and monitor the growth of the solar industry in SC. Prior to then, little information was available on the costs associated with distributed photovoltaic (PV) installations in the Southeastern US. For this report, data were collected from businesses on the number of hires they had at the end of 2014 and compared with data for 2015 and June 2016. It was found that the percentage of installers within the state who serve the residential sector increased to 82% from 67%. During the same time period, the average size of initiated installations for residential, commercial, and utility scale installations all trended upwards. Where residential installations were typically 5 kW-DC in 2014, they were typically 10 kW-DC by late 2015 and in mid-2016. For commercial installations, the average size grew from 84 kW-DC in 2014 to between 136-236 kW-DC in 2015 and then 188-248 kWDC in mid-2016. An exception was seen in utility scale installations where a 2.3 MW-DC system was common in 2014, the size grew to be 5-15 MW-DC in late 2015. The average size dropped 3.1-4.4 MWDC in mid-June 2016, though individual averages up to 20 MW-DC were reported.

Numerical study of PV/T-SAHP system

Institute of Scientific and Technical Information of China (English)

Gang PEI; Jie JI; Ke-liang LIU; Han-feng HE; Ai-guo JIANG

2008-01-01

In order to utilize solar energy effectively and to achieve a higher electrical efficiency by limiting the operating temperature of the photovoltaic (PV) panel, a novel photovoltaic/thermal solar-assisted heat pump (PV/T-SAHP) system was proposed and constructed. The hybrid solar system generates electricity and thermal energy simultaneously. A distributed parameters model of the PV/T-SAHP system was developed and applied to analyze the system dynamic performance in terms of PV action, photothermal action and Rankine cycle processes. The simulation results indicated that the coefficient of performance (COP) of the proposed PV/T-SAHP can be much better than that of the conventional heat pump. Both PV-efficiency and photothermic efficiency have been improved considerably. The results also showed that the performance of this PV/T-SAHP system was strongly influenced by the evaporator area, tube pitch and tilt angle of the PV/T evaporator, which are the key factors in PV/T-SAHP system optimization and PV/T evaporator design.

A case study of utility PV economics

International Nuclear Information System (INIS)

Wenger, H.; Hoff, T.; Osborn, D.E.

1997-01-01

This paper presents selected results from a detailed study of grid-connected photovoltaic (PV) applications within the service area of the Sacramento Municipal Utility District. The intent is to better understand the economics and markets for grid-connected PV systems in a utility setting. Research results include: Benefits calculations for utility-owned PV systems at transmission and distribution voltages; How the QuickScreen software package can help utilities investigate the viability of distributed PV; Energy production and capacity credit estimates for fixed and tracking PV systems; Economics and rate impacts of net metering residential PV systems; Market potential estimates for residential rooftop PV systems; and Viability and timing of grid-connected PV commercialization paths

Solar PV. Innovators talking; Zon PV. Innovators aan het woord

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-02-15

Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

Solar PV. Innovators talking; Zon PV. Innovators aan het woord

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-02-15

Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

A Unidirectional DC-DC Autotransformer for DC Grid Application

Directory of Open Access Journals (Sweden)

Meng Zhou

2018-03-01

Full Text Available Conventional unidirectional DC-DC converters for DC grid application employ DC-AC-DC two-stage conversion technology and suffer from high converter cost and power loss. To solve these issues, a unidirectional step-up DC-DC autotransformer (UUDAT and a unidirectional step-down DC-DC autotransformer (DUDAT are studied. The UUDAT and DUDAT are composed of a series connection of diode bridges and voltage source converters. Topologies of UUDAT and DUDAT are detailed. The harmonic and un-controllability issues are discussed. Control and possible application scenarios for UUDAT and DUDAT are depicted. DC fault isolation mechanism and the methods of dimensioning the voltage and power ratings of the components in UUDAT and DUDAT are studied. Extensive simulations on power system level and experiments on a UUDAT and DUDAT prototype verified their technical feasibility.

Grid integrated distributed PV (GridPV).

Energy Technology Data Exchange (ETDEWEB)

Reno, Matthew J.; Coogan, Kyle

2013-08-01

This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functions are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in the OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function in the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

PV/T slates - Pilot project in Steinhausen; PV/T-Schiefer. Pilotprojekt Steinhausen

Energy Technology Data Exchange (ETDEWEB)

Kropf, S.

2003-07-01

This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with a ventilated PV-tile system (PV/T-Slates) mounted on a garden shed in Steinhausen, Switzerland. The installation provides power and heat to the main house. The report describes the construction and operation of this pilot project and the results of measurements made on its electrical and thermal performance. The results of measurements made are presented in detail in graphical form and compared with the results of simulation. Suggestions are made for the optimisation of the system. Figures are presented on energy production and energy flows in graphical form.

Photovoltaics: PV takes off the UK

International Nuclear Information System (INIS)

Noble, Ray; Gregory, Jenny

2000-01-01

Despite historical ups and downs, there is still ambition to bring increasingly efficient photovoltaic (PV) systems to the market. PV for major remote telecommunications systems is now an established part of the market, many mobile phone systems are powered by PV and there is potential for increased use of home solar systems, especially in developing countries. Over the past few years, building-integrated PV (BIPV) has been on the increase. In 1999, global production from PV exceeded 200 MW and the UK installed capacity was greater than 1 MW. BIPV is a fast growing market and its characteristics and advantages are discussed. PV installations at Nottingham University, Greenwich Pavilion, BP Amoco Sunbury, Baglan Bay, BP filling stations, and Sainsbury's are described

INTEGRATED WEED MANAGEMENT ON THE PROCESSING TOMATO CROP AND TOMATO FOR CONSUMPTION IN NATURA

Directory of Open Access Journals (Sweden)

Y. O. Castro

2016-11-01

Full Text Available Weeds cause direct and indirect damage to processing tomato and tomato for consumption in natura. The coexistence period is decisive for the intensity of damage, although the economic cost is also considered for decision making when to control the weeds. There are similarities between processing tomato and tomato for consumption in natura cropping system and peculiarities. This causes the management has adopted its common applications and its variables within each system. As control alternative, the farmer has basically the preventive control, mechanical, cultural, biological and chemical. The application of a single method is not recommended. Ideally, the methods needs to be integrated in order to combat weeds, highly evolved populations and resistant to unfavorable conditions. Consider weed management taking only one control measure is to underestimate the evolutionary ability of such species. Therefore, it is necessary to integrate the various methods available to the weed interference not impede the tomato production.

Performance of PV panels for solar energy conversion at the South Pole

Science.gov (United States)

Peeran, Syed M.

Expanding research facilities at the Amundson-Scott South pole station require increased electric power generation. Presently, electric power generation is by diesel generators using the JP8 fuel. As the station is accessible only for a short supply period during the austral summer, there are limitations upon the supply of fuel for power generation. This makes it necessary to seriously consider the use of the renewable energy sources. Although there is no sunlight for six months in the year, abundant solar energy is available during the remaining 6 months because of the clear skies, the clarity of air and the low humidity at the south pole. As the buildings at the south pole are built either without windows or with only porthole type windows, large areas on the walls and the roof are available for mounting the photovoltaic (PV) panels. In addition there is unlimited space around the station for constructing a PV panel 'farm'. In this paper four types of PV panels are evaluated; the 2-axis tracking panels, vertical 1-axis tracking panels, fixed vertical panels on the walls of buildings and mounted outdoors, and fixed horizontal panels on the roofs of the buildings. Equations are developed for the power output in KW/sq. ft and annual energy in kWh/sq. ft for each type of panel. The equations include the effects of the inclination of the sun above the horizon, the movement of the sun around the horizon, the direct, reflected and diffused components of the solar radiation, the characteristics of the solar cells and the types of dc/ac inverters used to interface the output of the cells with the existing ac power. A conceptual design of a 150-kW PV generation system suitable for the south pole is also discussed in this paper.

Competitiveness of tomato production in punjab, pakistan

International Nuclear Information System (INIS)

Akhtar, W.; Qureshi, A.H.; Khan, M.A.

2016-01-01

The study measures competitiveness at farm level and economic efficiency at country level of tomato production in relation to tomato trade by using Policy Analysis Matrix (PAM) framework in Punjab, Pakistan. The province was divided into two tomato production regions i.e., Central and Southern Punjab for analysis purpose under importable scenario by using import parity price. Results of PAM model revealed that tomato production in both regions of Punjab has competitiveness under prevailing market situation as indicated by positive private profitability and private cost ratio (PCR) which is less than 1. Competitiveness difference in two regions indicated that Central Punjab has more competitiveness at farm level in tomato production. Economic efficiency results i.e. Domestic Resource Cost (DRC) ratio remained 0.39 and 0.51 in Central and Southern Punjab, respectively with positive social profitability indicating strong comparative advantage under importable scenario. The above results implied that Central Punjab has greater economic efficiency than Southern Punjab in domestic resources use for production of tomato as import substitute commodity. Results of Nominal Protection Coefficient (NPC) and Effective Protection Coefficient (EPC) indicated that combine effects of policies on output and tradable input market did not pass any protection to tomato farmers in the study area. Net effect of policy or market failure is reducing the profitability of tomato producers at farm level which indicates lack of motivation from policies for farmers to expand tomato production as import substitute crop. Present study recommended competitiveness and economic efficiency analysis in other tomato producing regions of the country for year round tomato supply on the basis of resource efficiency and to curtail tomato imports to save the precious foreign exchange. To enhance the competitiveness there is need to increase farmer's incentives through increase of farm level price up to

PV-BUK: Operating and maintenance costs of photovoltaic installations; PV-BUK - Betriebs- und Unterhaltskosten von PV-Anlagen - Schlussbericht

Energy Technology Data Exchange (ETDEWEB)

Stettler, S.; Toggweiler, P. [Enecolo AG, Moenchaltorf (Switzerland); Ruoss, D.; Schudel, P. [Envision, Lucerne (Switzerland); Kottmann, A.; Steinle, F. [BE Netz AG, Lucerne (Switzerland)

2008-03-15

This final report elaborated for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a project carried out to determine the costs for facility management, to estimate future cost development and to propose activities for the further reduction of the operation and maintenance costs of photovoltaic systems. Information on the cost situation was collected by literature study, as well as in interviews and surveys with photovoltaic (PV) experts and the owners of PV installations. The discussion of the results at a workshop with about 20 Swiss PV experts is noted. The results are presented and discussed. These show that operating costs per kWh decrease with the size of the PV system. Figures are quoted. The major part of the costs are quoted as being those for spare parts, especially for the inverter. The authors are of the opinion that, in future, costs for facility management will further decrease, as they are partly linked to capital and insurance costs. Potential for optimisation is said to exist in several areas of facility management such as, for example, in system monitoring and fast reaction in the case of malfunctions.

All SiC Grid-Connected PV Supply with HF Link MPPT Converter: System Design Methodology and Development of a 20 kHz, 25 kVA Prototype

Directory of Open Access Journals (Sweden)

Serkan Öztürk

2018-05-01

Full Text Available Design methodology and implementation of an all SiC power semiconductor-based, grid-connected multi-string photovoltaic (PV supply with an isolated high frequency (HF link maximum power point tracker (MPPT have been described. This system configuration makes possible the use of a simple and reliable two-level voltage source inverter (VSI topology for grid connection, owing to the galvanic isolation provided by the HF transformer. This topology provides a viable alternative to the commonly used non-isolated PV supplies equipped with Si-based boost MPPT converters cascaded with relatively more complex inverter topologies, at competitive efficiency figures and a higher power density. A 20 kHz, 25 kVA prototype system was designed based on the dynamic model of the multi-string PV panels obtained from field tests. Design parameters such as input DC link capacitance, switching frequencies of MPPT converter and voltage source inverter, size and performance of HF transformer with nanocrystalline core, DC link voltage, and LCL filter of the VSI were optimized in view of the site dependent parameters such as the variation ranges of solar insolation, module surface temperature, and grid voltage. A modified synchronous reference frame control was implemented in the VSI by applying the grid voltage feedforward to the reference voltages in abc axes directly, so that zero-sequence components of grid voltages are taken into account in the case of an unbalanced grid. The system was implemented and the proposed design methodology verified satisfactorily in the field on a roof-mounted 23.7 kW multi-string PV system.

Gamma-irradiation of tomatoes

International Nuclear Information System (INIS)

Tencheva, S.; Todorov, S.

1975-01-01

The influence of gamma-ray on tomatoes picked in a pink-red ripening stage, good for consumption, is studied. For that purpose tomatoes of ''Pioneer 2'' variety packed in perforated 500 g plastic bags were irradiated on a gamma device (Cobalt-60) at a dose power of 1900 rad/min with doses 200 or 300 krad. Samples were stored after irradiation at room temperature (20 - 22sup(o)C). Microbiological studies demonstrated that 44 resp. 99.96 per cent of the initial number of microorganisms was destroyed after irradiation with 200 resp. 300 krad. The time required for the number of microorganisms to be restored was accordingly increased. Irradiation delayed tomato ripening by 4 to 6 days, demonstrable by the reduced content of the basic staining substances - carotene and licopine. Immediately after irradiation the ascorbic acid content was reduced by an average of 13 per cent. After 18 days the amount of ascorbic acid in irradiated tomatoes was increased to a higher than the starting level, this is attributed to reductone formation during irradiation. The elevated total sugar content shown to be invert sugar was due to further tomato ripening. (Ch.K.)

New Multiphase Hybrid Boost Converter with Wide Conversion Ratio for PV System

Directory of Open Access Journals (Sweden)

Ioana-Monica Pop-Calimanu

2014-01-01

Full Text Available A new multiphase hybrid boost converter, with wide conversion ratio as a solution for photovoltaic energy system, is presented in this paper. To ensure that all the phases of the converter operate at the same switching frequency we use interleaving topology. The proposed converter can be used as an interface between the PV system and the DC load/inverter. This multiphase converter has the advantage of reduced value and physical size of the input and output capacitor as well as the effort for the inductors. To validate the operation of the converter we provide the analyses and the simulation results of the converter.

A quick and robust method for quantification of the hypersensitive response in plants

Directory of Open Access Journals (Sweden)

Oskar N. Johansson

2015-12-01

Full Text Available One of the most studied defense reactions of plants against microbial pathogens is the hypersensitive response (HR. The HR is a complex multicellular process that involves programmed cell death at the site of infection. A standard method to quantify plant defense and the HR is to measure the release of cellular electrolytes into water after infiltration with pathogenic bacteria. In this type of experiment, the bacteria are typically delivered into the plant tissue through syringe infiltration. Here we report the development of a vacuum infiltration protocol that allows multiple plant lines to be infiltrated simultaneously and assayed for defense responses. Vacuum infiltration did not induce more wounding response in Arabidopsis leaf tissue than syringe inoculation, whereas throughput and reproducibility were improved. The method was used to study HR-induced electrolyte loss after treatment with the bacterium Pseudomonas syringae pv. tomato DC3000 harboring the effector AvrRpm1, AvrRpt2 or AvrRps4. Specifically, the influence of bacterial titer on AvrRpm1-induced HR was investigated. Not only the amplitude, but also the timing of the maximum rate of the HR reaction was found to be dose-dependent. Finally, using vacuum infiltration, we were able quantify induction of phospholipase D activity after AvrRpm1 recognition in leaves labeled with 33PO4.

ZmGns, a maize class I b-1,3-glucanase, is induced by biotic stresses and possesses strong antimicrobial activity

Institute of Scientific and Technical Information of China (English)

Yu-Rong Xie; Yenjit Raruang; Zhi-Yuan Chen; Robert L Brown; Thomas E Cleveland

2015-01-01

Plant b‐1,3‐glucanases are members of the patho-genesis‐related protein 2 (PR‐2) family, which is one of the 17 PR protein families and plays important roles in biotic and abiotic stress responses. One of the differential y expressed proteins (spot 842) identified in a recent proteomic comparison between five pairs of closely related maize (Zea mays L.) lines differing in aflatoxin resistance was further investigated in the present study. Here, the corresponding cDNA was cloned from maize and designated as ZmGns. ZmGns encodes a protein of 338 amino acids containing a potential signal peptide. The expression of ZmGns was detectible in al tissues studied with the highest level in silks. ZmGns was significantly induced by biotic stresses including three bacteria and the fungus Aspergillus flavus. ZmGns was also induced by most abiotic stresses tested and growth hormones including salicylic acid. In vivo, ZmGns showed a significant inhibitory activity against the bacterial pathogen Pseudomonas syringae pv. tomato DC3000 and fungal pathogen Botrytis cinerea when it overexpressed in Arabidopsis. Its high level of expression in the silk tissue and its induced expression by phytohormone treatment, as wel as by bacterial and fungal infections, suggest it plays a complex role in maize growth, development, and defense.

Power and Energy Management Strategy for Solid State Transformer Interfaced DC Microgrid

Science.gov (United States)

Yu, Xunwei

between DC MG and SST, State of Charge (SOC) for battery, are both considered in the system energy management strategy. Then the DC MG output power is controllable and the battery is autonomous charged and discharged based on its SOC and system information without communication. The system operation modes are defined, analyzed and the simulation results verify the strategy. The second power and energy management strategy is the hierarchical control. In this control strategy, three-layer control structure is presented and defined. The first layer is the primary control for the DC MG in islanding mode, which is to guarantee the DC MG system power balance without communication to increase the system reliability. The second control layer is to implement the seamless switch for DC MG system from islanding mode to SST-enabled mode. The third control layer is the tertiary control for the system energy management and the communication is also involved. The tertiary layer not only controls the whole DC MG output power, but also manages battery module charge and discharge statuses based on its SOC. The simulation and experimental results verify the methods. Some practical issues for the SST interfaced DC MG are also investigated. Power unbalance issue of SST is analyzed and a distributed control strategy is presented to solve this problem. Simulation and experimental results verify it. Furthermore, the control strategy for SST interfaced DC MG blackout is presented and the simulation results are shown to valid it. Also a plug and play SST interfaced DC MG is constructed and demonstrated. Several battery and PV modules construct a typical DC MG and a DC source is adopted to simulate the SST. The system is in distributed control and can operate in islanding mode and SST-enabled mode. The experimental results verify that individual module can plug into and unplug from the DC MG randomly without affecting the system stability. Furthermore, the communication ports are embedded into the

Nutritional evaluation of dried tomato seeds.

Science.gov (United States)

Persia, M E; Parsons, C M; Schang, M; Azcona, J

2003-01-01

Two samples of tomato seeds, a by-product of the tomato canning industry were evaluated to determine proximate analysis, amino acid content, and digestibility, TMEn, and protein efficiency ratio. Tomato seeds were also used to replace corn and soybean meal (SBM) in a chick diet on an equal true amino acid digestibility and TMEn basis. Tomato seeds were found to contain 8.5% moisture, 25% CP, 20.0% fat, 3.1% ash, 35.1% total dietary fiber, 0.12% Ca, 0.58% P, and 3,204 kcal/kg of TMEn. The total amounts of methionine, cystine, and lysine in the tomato seeds were 0.39, 0.40, and 1.34%, respectively, and their true digestibility coefficients, determined in cecectomized roosters, were 75, 70, and 54%, respectively. The protein efficiency ratio (weight gain per unit of protein intake) value when fed to chicks at 9% CP was 2.5 compared to 3.6 for SBM (P seeds could replace corn and SBM without any adverse affects on chick weight gain, feed intake, or gain:feed ratio from 8 to 21 d posthatch. Tomato seeds at any level in the diet did not significantly affect skin pigmentation. Although the protein quality of tomato seeds may not be as high as SBM, tomato seeds do contain substantial amounts of digestible amino acids and TMEn. When formulating diets on a true digestible amino acid and TMEn basis, tomato seeds can be supplemented into chick rations at up to 15% without any adverse affects on growth performance.

Temperature Dependences on Various Types of Photovoltaic (PV) Panel

International Nuclear Information System (INIS)

Audwinto, I A; Leong, C S; Sopian, K; Zaidi, S H

2015-01-01

Temperature is one of the key roles in PV technology performance, since with the increases of temperature the open-circuit voltage will drop accordingly so do the electrical efficiency and power output generation. Different types of Photovoltaic (PV) panels- silicon solar panels and thin film solar panels; mono-crystalline, poly-crystalline, CIS, CIGS, CdTe, back-contact, and bi-facial solar panel under 40°C to 70°C approximately with 5°C interval have been comparatively analyzed their actual performances with uniformly distribution of light illumination from tungsten halogen light source, ±500W/m 2 . DC-Electronic Load and Data Logger devices with “Lab View” data program interface were used to collect all the necessary parameters in this study. Time needed to achieve a certain degree of temperature was recorded. Generally, each of the panels needed 15 minutes to 20 minutes to reach 70°C. Halogen based light source is not compatible in short wave-length in response to thin-film solar cell. Within this period of times, all the panels are facing a performance loss up to 15%. Other parameters; P max , V max , I max , V oc , I sc , R serries , R shunt , Fillfactor were collected as study cases. Our study is important in determining Photovoltaic type selection and system design as for study or industrial needed under different temperature condition. (paper)

Optimization of PV-based energy production by dynamic PV-panel/inverter configuration

DEFF Research Database (Denmark)

Paasch, Kasper; Nymand, Morten; Haase, Frerk

This paper investigates the possible increase in annual energy production of a PV system with more than one MPPT (maximum power point tracker) input channels under Nordic illumination conditions, in case a concept of dynamic switching of the PV panels is used at the inputs of the inverters....

PV integration into a CSP plant

Science.gov (United States)

Carvajal, Javier López; Barea, Jose M.; Barragan, Jose; Ortega, Carlos

2017-06-01

This paper describes a preliminary techno-economic analysis of the integration of a PV plant into an optimized Parabolic Trough Plant in order to reduce the online consumptions and thus, increase the net electricity injected into the grid. The idea is to assess the feasibility of such project and see what configuration would be the optimal. An extra effort has been made in terms of modelling as the analysis has to be done to the integrated CSP + PV plant instead of analyzing them independently. Two different technologies have been considered for the PV plant, fix and one-axis tracking. Additionally three different scenarios have been considered for the CSP plant auxiliary consumptions as they are essential for determining the optimal PV plant (the higher the auxiliary consumption the higher the optimal PV plant). As could be expected, the results for all cases with PV show an improvement in terms of electricity generation and also in terms of LCOE with respect to the CSP plant. Such improvement is slightly higher with tracking technology for this specific study. Although this exercise has been done to an already designed CSP plant (so only the PV plant had to be optimized), the methodology could be applied for the optimization of an integrated CSP + PV plant during the design phase.

Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance.

Science.gov (United States)

Ma, Hao; Song, Congfeng; Borth, Wayne; Sether, Diane; Melzer, Michael; Hu, John

2011-10-20

Tomato spotted wilt virus (TSWV) has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX) in tomato and petunia is related to TSWV resistance. The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.

Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance

Directory of Open Access Journals (Sweden)

Ma Hao

2011-10-01

Full Text Available Abstract Background Tomato spotted wilt virus (TSWV has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX in tomato and petunia is related to TSWV resistance. Results The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. Conclusion In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.

Managing thrips and tospoviruses in tomato

Science.gov (United States)

Tomato spotted wilt virus and more recently emerged Tomato chlorotic spot virus and Groundnut ringspot virus are all transmitted by thrips, making managment complex. All three viruses and the thrips vector are major pests of tomato in Florida. Current management tools for these viruses and the th...

Projecting of PV facades in consideration of PV-specific operating conditions; Besonderheiten bei der Projektierung von Photovoltaik-Fassadenanlagen

Energy Technology Data Exchange (ETDEWEB)

Decker, B.; Grimmig, B.; Mencke, D. [Institut fuer Solarenergieforschung GmbH Hameln/Emmerthal (ISFH), Emmerthal (Germany). Gruppe Photovoltaik-Systeme; Stellbogen, D. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany). Fachgebiet Photovoltaische Anlagentechnik

1998-02-01

PV facades can provide several additional functions such as weather protection, thermal insulation, daylighting or sun protection. On the other hand, specific operating conditions for PV facades must be taken into account when selecting components and designing the system. Depending on ventilation conditions, there is a large range of maximum module temperatures. South-oriented PV facades receive about 30% less yearly irradiation than an optimally inclined PV generator, hence reflection losses are approximately 4% higher. The maximum of yearly irradiation lies only in the 400-600 W/m{sup 2} range. Surrounding buildings and/or vegetation can impair performance of the PV-facades. For a south-oriented PV facade an annual yield in the range of 470-560 kwh/kW{sub p}.a has been prodicted which was verified by operating results of eight PV facades. (orig.) [Deutsch] Photovoltaik (PV) Fassaden ermoeglichen neben der Stromerzeugung zusaetzliche Funktionen wie Wetterschutz bzw. Waermedaemmung des Gebaeudes oder Tageslichtnutzung bzw. Sonnenschutz der Innenraeume. Allerdings muessen fassadenspezifische Betriebsbedingungen, bei der Komponentenauswahl und Systemauslegung beruecksichtigt werden. Unterschiedliche Hinterlueftungsbedingungen fuehren zu einer grossen Bandbreite der maximalen Modultemperatur. PV-Suedfassaden empfangen etwa 30% weniger Jahreseinstrahlung als ein optimal geneigter PV-Generator. Die Haelfte der jaehrlichen Einstrahlung trifft mit Einfallswinkeln groesser 50 auf die vertikal angeordneten Module wodurch die Reflexionsverluste um ca. 4% hoeher sind. Das Maximum der Jahreseinstrahlung liegt nur um 400-600 W/m{sup 2} und erreicht selten Werte ueber 800 W/m{sup 2}. Umliegende Gebaeude oder Vegetation koennen zu Teilabschattungen des Generators fuehren. Fuer eine vertikale PV-Suedfassade wird ein Jahresenergieertrag in Hoehe von 470-560 kWh/kW{sub p}.a prognostiziert, der anhand der Betriebsergebnisse von acht PV-Fassadenanlagen verifiziert werden konnte

Rheological Behavior of Tomato Fiber Suspensions Produced by High Shear and High Pressure Homogenization and Their Application in Tomato Products

Science.gov (United States)

Sun, Ping; Adhikari, Benu P.; Li, Dong

2018-01-01

This study investigated the effects of high shear and high pressure homogenization on the rheological properties (steady shear viscosity, storage and loss modulus, and deformation) and homogeneity in tomato fiber suspensions. The tomato fiber suspensions at different concentrations (0.1%–1%, w/w) were subjected to high shear and high pressure homogenization and the morphology (distribution of fiber particles), rheological properties, and color parameters of the homogenized suspensions were measured. The homogenized suspensions were significantly more uniform compared to unhomogenized suspension. The homogenized suspensions were found to better resist the deformation caused by external stress (creep behavior). The apparent viscosity and storage and loss modulus of homogenized tomato fiber suspension are comparable with those of commercial tomato ketchup even at the fiber concentration as low as 0.5% (w/w), implying the possibility of using tomato fiber as thickener. The model tomato sauce produced using tomato fiber showed desirable consistency and color. These results indicate that the application of tomato fiber in tomato-based food products would be desirable and beneficial. PMID:29743890

A resonant dc-dc power converter assembly

DEFF Research Database (Denmark)

2015-01-01

The present invention relates to a resonant DC-DC power converter assembly comprising a first resonant DC-DC power converter and a second resonant DC-DC power converter having identical circuit topologies. A first inductor of the first resonant DC-DC power converter and a second inductor of the s......The present invention relates to a resonant DC-DC power converter assembly comprising a first resonant DC-DC power converter and a second resonant DC-DC power converter having identical circuit topologies. A first inductor of the first resonant DC-DC power converter and a second inductor...... of the second resonant DC-DC power converter are configured for magnetically coupling the first and second resonant DC-DC power converters to each other to forcing substantially 180 degrees phase shift, or forcing substantially 0 degree phase shift, between corresponding resonant voltage waveforms of the first...

Advanced Copper Composites Against Copper-Tolerant Xanthomonas perforans and Tomato Bacterial Spot.

Science.gov (United States)

Strayer-Scherer, A; Liao, Y Y; Young, M; Ritchie, L; Vallad, G E; Santra, S; Freeman, J H; Clark, D; Jones, J B; Paret, M L

2018-02-01

Bacterial spot, caused by Xanthomonas spp., is a widespread and damaging bacterial disease of tomato (Solanum lycopersicum). For disease management, growers rely on copper bactericides, which are often ineffective due to the presence of copper-tolerant Xanthomonas strains. This study evaluated the antibacterial activity of the new copper composites core-shell copper (CS-Cu), multivalent copper (MV-Cu), and fixed quaternary ammonium copper (FQ-Cu) as potential alternatives to commercially available micron-sized copper bactericides for controlling copper-tolerant Xanthomonas perforans. In vitro, metallic copper from CS-Cu and FQ-Cu at 100 μg/ml killed the copper-tolerant X. perforans strain within 1 h of exposure. In contrast, none of the micron-sized copper rates (100 to 1,000 μg/ml) from Kocide 3000 significantly reduced copper-tolerant X. perforans populations after 48 h of exposure compared with the water control (P copper-based treatments killed the copper-sensitive X. perforans strain within 1 h. Greenhouse studies demonstrated that all copper composites significantly reduced bacterial spot disease severity when compared with copper-mancozeb and water controls (P copper composites significantly reduced disease severity when compared with water controls, using 80% less metallic copper in comparison with copper-mancozeb in field studies (P copper composites have the potential to manage copper-tolerant X. perforans and tomato bacterial spot.

Functional genomics of tomato

Indian Academy of Sciences (India)

2014-10-20

Oct 20, 2014 ... 1Repository of Tomato Genomics Resources, Department of Plant Sciences, School .... Due to its position at the crossroads of Sanger's sequencing .... replacement for the microarray-based expression profiling. .... during RNA fragmentation step prior to library construction, ...... tomato pollen as a test case.

3000 Area Phase 1 environmental assessment

International Nuclear Information System (INIS)

Ranade, D.G.

1995-09-01

The US Department of Energy (DOE) is planning to sell the 3000 Area to prospective buyers. Environmental Services was requested by the WHC Economic Transition group to assess potential environmental liabilities in the area. Historical review of the area indicated that the site was the location of ''Camp Hanford'' in 1951 and has been used for a variety of purposes since then. The activities in the area have changed over the years. A number of Buildings from the area have been demolished and at least 15 underground storage tanks (USTs) have been removed. Part of the 3000 Area was identified as Operable Unit 1100-EM-3 in the Tri-Party Agreement and was cleaned up by the US Army Corps of Engineers (USACE). The cleanup included removal of contaminated soil and USTS. WHC and ICF KH had also performed sampling and analysis at some locations in the 3000 Area prior to USACE's work on the Operable Unit 1100-EM-3. They removed a number of USTs and performed remediation

The case for better PV forecasting

DEFF Research Database (Denmark)

Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio

2016-01-01

Rising levels of PV penetration mean increasingly sophisticated forecasting technologies are needed to maintain grid stability and maximise the economic value of PV systems. The Grid Integration working group of the European Technology and Innovation Platform – Photovoltaics (ETIP PV) shares the ...

Development of a GIS Tool for High Precision PV Degradation Monitoring and Supervision: Feasibility Analysis in Large and Small PV Plants

Directory of Open Access Journals (Sweden)

Miguel de Simón-Martín

2017-06-01

Full Text Available It is well known that working photovoltaic (PV plants show several maintenance needs due to wiring and module degradation, mismatches, dust, and PV cell defects and faults. There are a wide range of theoretical studies as well as some laboratory tests that show how these circumstances may affect the PV production. Thus, it is mandatory to evaluate the whole PV plant performance and, then, its payback time, profitability, and environmental impact or carbon footprint. However, very few studies include a systematic procedure to quantify and supervise the real degradation effects and fault impacts on the field. In this paper, the authors first conducted a brief review of the most frequent PV faults and the degradation that can be found under real conditions of operation of PV plants. Then, they proposed and developed an innovative Geographic Information System (GIS application to locate and supervise them. The designed tool was applied to both a large PV plant of 108 kWp and a small PV plant of 9 kWp installed on a home rooftop. For the large PV plant, 24 strings of PV modules were modelized and introduced into the GIS application and every module in the power plant was studied including voltage, current, power, series and parallel resistances, fill factor, normalized PV curve to standard test conditions (STC, thermography and visual analysis. For the small PV installation three strings of PV panels were studied identically. It must be noted that PV modules in this case included power optimizers. The precision of the study enabled the researchers to locate and supervise up to a third part of every PV cell in the system, which can be adequately georeferenced. The developed tool allows both the researchers and the investors to increase control of the PV plant performance, to lead to better planning of maintenance actuations, and to evaluate several PV module replacement strategies in a preventive maintenance program. The PV faults found include hot

Adiabatic Rearrangement of Hollow PV Towers

Directory of Open Access Journals (Sweden)

Eric A Hendricks

2010-10-01

Full Text Available Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV. This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with significant vortex structural and intensity change. The three-dimensional adiabatic rearrangements of two prototypical hurricane-like hollow PV towers (one thick and one thin are examined in an idealized framework. For both hollow towers, dynamic instability causes air parcels with high PV to be mixed into the eye preferentially at lower levels, where unstable PV wave growth rates are the largest. Little or no mixing is found to occur at upper levels. The mixing at lower and middle levels is most rapid for the breakdown of the thin hollow tower, consistent with previous barotropic results. For both hollow towers, this advective rearrangement of PV affects the tropical cyclone structure and intensity in a number of ways. First, the minimum central pressure and maximum azimuthal mean velocity simultaneously decrease, consistent with previous barotropic results. Secondly, isosurfaces of absolute angular momentum preferentially shift inward at low levels, implying an adiabatic mechanism by which hurricane eyewall tilt can form. Thirdly, a PV bridge, similar to that previously found in full-physics hurricane simulations, develops as a result of mixing at the isentropic levels where unstable PV waves grow most rapidly. Finally, the balanced mass field resulting from the PV rearrangement is warmer in the eye between 900 and 700 hPa. The location of this warming is consistent with observed warm anomalies in the eye, indicating that in certain instances the hurricane

Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T system against conventional photovoltaic (PV system

Directory of Open Access Journals (Sweden)

Peng Xu

2015-11-01

Full Text Available Photovoltaic (PV semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the overall field system involved 15 stand-alone PV panels and 15 retrofitted PV/T panels. The laboratory testing results demonstrated the PV/T panel could achieve the electrical efficiency of about 16.8% (relatively 5% improvement comparing with the stand-alone PV panel, and yield an extra amount of heat with thermal efficiency of nearly 65%. The field testing results indicated that the hybrid PV/T panel could enhance the electrical return of PV panels by nearly 3.5%, and increase the overall energy output by nearly 324.3%. Further opportunities and challenges were then discussed from aspects of different PV/T stakeholders to accelerate the development. It is expected that such technology could become a significant solution to yield more electricity, offset heating load freely and reduce carbon footprint in contemporary energy environment.

Step-Up DC-DC converters

DEFF Research Database (Denmark)

Forouzesh, Mojtaba; Siwakoti, Yam P.; Gorji, Saman A.

2017-01-01

on the general law and framework of the development of next-generation step-up dc-dc converters, this paper aims to comprehensively review and classify various step-up dc-dc converters based on their characteristics and voltage-boosting techniques. In addition, the advantages and disadvantages of these voltage......DC-DC converters with voltage boost capability are widely used in a large number of power conversion applications, from fraction-of-volt to tens of thousands of volts at power levels from milliwatts to megawatts. The literature has reported on various voltage-boosting techniques, in which......-boosting techniques and associated converters are discussed in detail. Finally, broad applications of dc-dc converters are presented and summarized with comparative study of different voltage-boosting techniques....

Fabrication and electrorotation of a novel epoxy based micromotor working in a uniform DC electric field

Science.gov (United States)

Bauer, Rita A.; Kelemen, Lóránd; Nakano, Masami; Totsuka, Atsushi; Zrínyi, Miklós

2015-10-01

We have presented the first direct observation of electric field induced rotation of epoxy based polymer rotors. Polymer disks, hollow cylinders and gears were prepared in few micrometer dimensions as rotors. Electrorotation of these sub-millimeter sized tools was studied under uniform dc electric field. The effects of shape, size and thickness were investigated. The novel epoxy based micro devices show intensive spinning in a uniform dc electric field. The rotational speed of micron-sized polymer rotors can be conveniently tuned in a wide range (between 300 and 3000 rpm) by the electric field intensity, opening new perspectives for their use in several MEMS applications.

Fabrication and electrorotation of a novel epoxy based micromotor working in a uniform DC electric field

International Nuclear Information System (INIS)

Bauer, Rita A; Zrínyi, Miklós; Kelemen, Lóránd; Nakano, Masami; Totsuka, Atsushi

2015-01-01

We have presented the first direct observation of electric field induced rotation of epoxy based polymer rotors. Polymer disks, hollow cylinders and gears were prepared in few micrometer dimensions as rotors. Electrorotation of these sub-millimeter sized tools was studied under uniform dc electric field. The effects of shape, size and thickness were investigated. The novel epoxy based micro devices show intensive spinning in a uniform dc electric field. The rotational speed of micron-sized polymer rotors can be conveniently tuned in a wide range (between 300 and 3000 rpm) by the electric field intensity, opening new perspectives for their use in several MEMS applications. (paper)

A resonant dc-dc power converter assembly

OpenAIRE

Madsen, Mickey Pierre

2015-01-01

The present invention relates to a resonant DC-DC power converter assembly comprising a first resonant DC-DC power converter and a second resonant DC-DC power converter having identical circuit topologies. A first inductor of the first resonant DC-DC power converter and a second inductor of the second resonant DC-DC power converter are configured for magnetically coupling the first and second resonant DC-DC power converters to each other to forcing substantially 180 degrees phase shift, or fo...

Economic Sustainability of Italian Greenhouse Cherry Tomato

Directory of Open Access Journals (Sweden)

Riccardo Testa

2014-11-01

Full Text Available Greenhouse tomato cultivation plays an important role in Sicily, being the primary production area in Italy, due to its favorable pedo-climatic conditions that permit extra-seasonal productions. In Sicily, more than half of greenhouse tomato production is derived from the Province of Ragusa on the southeastern coast, where especially cherry tomato typologies are cultivated. Over the last decade, the Ragusa Province has registered a decrease both in terms of greenhouse tomato area and harvested production due to several structural problems that would require restructuring of the tomato supply chain. Thus, since recognition of real costs and profitability of tomato growing is a vital issue, both from the perspective of the farm, as well as from that of the entrepreneur, the aim of this paper was to analyze the economic sustainability of Sicilian greenhouse cherry tomato cultivated in the Ragusa Province. In particular, an economic analysis on 30 representative farms was conducted in order to estimate production costs and profits of greenhouse cherry tomato. According to our results, the lack of commercial organization, which characterizes the small farms we surveyed, determines low contractual power for farmers and, consequently, low profitability.

The market for photovoltaic (PV) technology

International Nuclear Information System (INIS)

Frantzis, L.; Vejtasa, K.M.

1993-01-01

This paper describes a study that was intended to provide the Electric Power Research Institute (EPRI) with a market analysis for photovoltaic (PV) technologies under development by EPRI and others. The analysis was to focus on markets and factors leading to significant incremental growth for PV demand, large enough to support more efficient scale PV manufacturing capacity. EPRI anticipates that PV ultimately could provide grid-connected power, however, the 1995--2010 market dynamics are uncertain. The specific objectives of this study, therefore, were to: determine what major future domestic US markets for PV technologies will emerge and provide enough volume to support significant improvements in manufacturing costs through manufacturing economies of scale; provide insight on what is needed to gain acceptance of PV technologies for electric power generation in those major markets; provide insight on when investments in demonstration and manufacturing facilities should be made and what is needed to be successful in each element of the business that these markets could support (e.g., technology development, manufacturing, sales, installation, and service); and provide key insights on the requirements for commercial success of PV in the utility sector

Mineral Content in Leaves of Tomato Plants Grafted on Solanum Rootstocks

OpenAIRE

松添, 直隆; 間, 浩美; 花田, 勝美; モハメド, アリ; 大久保, 敬; 藤枝, 國光

1995-01-01

Nutrient uptake of tomato plants cv. Momotaro grafted on Solanum sisymbriifoliulm, S. torvum and S. toxicarium which are resistant to soil-born disease were compared with tomato grafted on its own root, a tomato/tomato, scion/rootstock combination. Mineral content in leaves of tomato/S. sisymbriifoliulm was nearly equal to that of tomato/tomato. In leaves of tomato/S. torvum, nitrogen content was higher, and magnesium content was lower than those of tomato/tomato. Furthermore, phosphorus and ...

Clinical evaluation of the Keeler Pulsair 3000 non-contact tonometer.

Science.gov (United States)

Lawson-Kopp, Wendy; DeJong, Amy; Yudcovitch, Lorne; Williams, Salisa; Kohl, Paul; Yolton, Robert L

2002-02-01

The Keeler Pulsair 3000 is a recently introduced non-contact tonometer that is especially useful for children and those for whom sitting at a slit-lamp or table-mounted unit would be difficult. In this project, intraocular pressures (IOPs) measured by Keeler Pulsair 3000 and Goldmann tonometers were compared to assess validity and reliability of the Pulsair 3000 data. Two Pulsair 3000 IOPs (each the mean of four individual air-puff readings) and two Goldmann IOPs were measured for each eye of 113 subjects. Subjects were also asked which measurement technique they preferred. IOPs ranged from 9 to 28 mmHg. Correlations between the two Goldmann IOPs measured for the right and left eyes were 0.98 and 0.97, respectively. These values are higher than correlations between Pulsair and Goldmann measurements (0.86 to 0.91). Pulsair 3000 IOPs were slightly above Goldmann values for pressures of less than 15 mmHg and slightly below for IOPs greater than 15 mmHg. Extrapolation to a Goldmann IOP of 30 mmHg suggests the Pulsair 3000 would read about 6% (1.7 mmHg) too low at this IOP. Eight eyes (7%) had differences between Pulsair 3000 and Goldmann IOP readings of 5.0 mmHg or more. Single outlier pressures accounted for these differences in three out of the eight eyes. In the range of 10 to 24 mmHg, the Pulsair 3000 tonometer produced IOP readings that corresponded well with Goldmann values for most eyes and was preferred by the majority of subjects who indicated a preference. The Pulsair 3000 is relatively easy to use by technicians and has numerous special applications in optometric practice (e.g. measuring IOPs for pediatric patients and those with compromised corneas).

Plastid and Stromule Morphogenesis in Tomato

Science.gov (United States)

PYKE, KEVIN A.; HOWELLS, CAROLINE A.

2002-01-01

By using green fluorescent protein targeted to the plastid organelle in tomato (Lycopersicon esculentum Mill.), the morphology of plastids and their associated stromules in epidermal cells and trichomes from stems and petioles and in the chromoplasts of pericarp cells in the tomato fruit has been revealed. A novel characteristic of tomato stromules is the presence of extensive bead‐like structures along the stromules that are often observed as free vesicles, distinct from and apparently unconnected to the plastid body. Interconnections between the red pigmented chromoplast bodies are common in fruit pericarp cells suggesting that chromoplasts could form a complex network in this cell type. The potential implications for carotenoid biosynthesis in tomato fruit and for vesicles originating from beaded stromules as a secretory mechanism for plastids in glandular trichomes of tomato is discussed. PMID:12466096

Development of immunofluorescence colony staining (IFC) for detection of Xanthomonas campestris pv. vesicatoria and Clavibacter michiganensis subsp michiganensis in tomato seeds

NARCIS (Netherlands)

Nemeth, J.; Vuurde, van J.W.L.

2006-01-01

Immunofluorescence colony-staining (IFC) is based on sample pour plating in combination with immunofluorescence staining for recognition of the target colony. IFC was optimised for detecting Xanthomonas campestris pv. vesicatoria (Xcv) and Clavibacter michiganensis subsp. michiganensis (Cmm) in

Modular AC Nano-Grid with Four-Quadrant Micro-Inverters and High-Efficiency DC-DC Conversion

Science.gov (United States)

Poshtkouhi, Shahab

A significant portion of the population in developing countries live in remote communities, where the power infrastructure and the required capital investment to set up local grids do not exist. This is due to the fuel shipment and utilization costs required for fossil fuel based generators, which are traditionally used in these local grids, as well as high upfront costs associated with the centralized Energy Storage Systems (ESS). This dissertation targets modular AC nano-grids for these remote communities developed at minimal capital cost, where the generators are replaced with multiple inverters, connected to either Photovoltaic (PV) or battery modules, which can be gradually added to the nano-grid. A distributed droop-based control architecture is presented for the PV and battery Micro-Inverters (MIV) in order to achieve frequency and voltage stability, as well as active and reactive power sharing. The nano-grid voltage is regulated collectively in either one of four operational regions. Effective load sharing and transient handling are demonstrated experimentally by forming a nano-grid which consists of two custom 500 W MIVs. The MIVs forming the nano-grid have to meet certain requirements. A two-stage MIV architecture and control scheme with four-quadrant power-flow between the nano-grid, the PV/battery and optional short-term storage is presented. The short-term storage is realized using high energy-density Lithium-Ion Capacitor (LIC) technology. A real-time power smoothing algorithm utilizing LIC modules is developed and tested, while the performance of the 100 W MIV is experimentally verified under closed-loop dynamic conditions. Two main limitations of the DAB topology, as the core of the MIV architecture's dc-dc stage, are addressed: 1) This topology demonstrates poor efficiency and limited regulation accuracy at low power. These are improved by introducing a modified topology to operate the DAB in Flyback mode, achieving up to an 8% increase in

AP2/ERF Transcription Factors Involved in Response to Tomato Yellow Leaf Curly Virus in Tomato

Directory of Open Access Journals (Sweden)

Ying Huang

2016-07-01

Full Text Available Tomato yellow leaf curly virus (TYLCV, transmitted by the whitefly (, causes leaf curling and yellowing, plant dwarfism, and growth inhibition in tomato ( L.. The APETALA2 (AP2 and ethylene response factor (ERF transcription factor (TF family, the largest plant-specific TF family, was identified to function in plant development and pathogen defense. Our study aimed to analyze the mechanism underlying the function of ERF (SlERF TFs in response to TYLCV infection and improve useful information to increase the resistance to TYLCV in tomato. A total of 22 tomato AP2/ERF TFs in response to TYLCV were identified according to transcriptome database. Five ERF-B3 TFs were identified in cultivars Hongbeibei (highly resistant, Zheza-301, Zhefen-702 (both resistant, Jinpeng-1, and Xianke-6 (both susceptible. Interaction network indicated that SlERF TFs could interact with mitogen-activated protein kinase (MAPK. Expression profiles of five ERF-B3 genes (, , , , and were detected by quantitative real-time–polymerase chain reaction (qRT-PCR after TYLCV infection in five tomato cultivars. expression was upregulated in five tomato cultivars. The expressions of three genes (, , and were upregulated in Zheza-301 and Zhefen-702. and expressions were downregulated in Hongbeibei and Xianke-6, respectively. Yeast one-hybrid showed that the GCC-box binding ability of ERF-B3 TFs differed in resistant and susceptible tomato cultivars. Expression profiles were related to the GCC-box binding ability of SlERF TFs in resistant and susceptible tomato cultivars. The defense mechanism underlying the tomato’s response to TYLCV involved a complicated network, which provided important information for us in breeding and genetic analysis.