Energy Technology Data Exchange (ETDEWEB)
Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail: schroedter@veritas.sao.arizona.edu, E-mail: mccann@kicp.uchicago.edu, E-mail: nepomuk.otte@gmail.com [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others
2012-12-01
We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.
Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.;
2012-01-01
We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.
VHE and UHE gamma ray astronomy: transients and sources
International Nuclear Information System (INIS)
Fegan, D.J.
1987-01-01
The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy
Simulated gamma-ray pulse profile of the Crab pulsar with the Cherenkov Telescope Array
Burtovoi, A.; Zampieri, L.
2016-07-01
We present simulations of the very high energy (VHE) gamma-ray light curve of the Crab pulsar as observed by the Cherenkov Telescope Array (CTA). The CTA pulse profile of the Crab pulsar is simulated with the specific goal of determining the accuracy of the position of the interpulse. We fit the pulse shape obtained by the Major Atmospheric Gamma-Ray Imaging Cherenkov (MAGIC) telescope with a three-Gaussian template and rescale it to account for the different CTA instrumental and observational configurations. Simulations are performed for different configurations of CTA and for the ASTRI (Astrofisica con Specchi a Tecnologia Replicante Italiana) mini-array. The northern CTA configuration will provide an improvement of a factor of ˜3 in accuracy with an observing time comparable to that of MAGIC (73 h). Unless the VHE spectrum above 1 TeV behaves differently from what we presently know, unreasonably long observing times are required for a significant detection of the pulsations of the Crab pulsar with the high-energy-range sub-arrays. We also found that an independent VHE timing analysis is feasible with Large Size Telescopes. CTA will provide a significant improvement in determining the VHE pulse shape parameters necessary to constrain theoretical models of the gamma-ray emission of the Crab pulsar. One of such parameters is the shift in phase between peaks in the pulse profile at VHE and in other energy bands that, if detected, may point to different locations of the emission regions.
Early warning for VHE gamma-ray flares with the ARGO-YBJ detector
Energy Technology Data Exchange (ETDEWEB)
Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others
2011-12-11
Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.
Very high-energy gamma rays from gamma-ray bursts.
Chadwick, Paula M
2007-05-15
Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.
International Nuclear Information System (INIS)
Fuessling, Matthias
2012-01-01
This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.
Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.
Energy Technology Data Exchange (ETDEWEB)
Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)
2010-07-01
The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.
VHE Gamma-ray Supernova Remnants
Energy Technology Data Exchange (ETDEWEB)
Funk, Stefan; /KIPAC, Menlo Park
2007-01-22
Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.
A SEARCH FOR VERY HIGH ENERGY GAMMA RAYS FROM THE MISSING LINK BINARY PULSAR J1023+0038 WITH VERITAS
Energy Technology Data Exchange (ETDEWEB)
Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail: ester.aliu.fuste@gmail.com, E-mail: gtrichards@gatech.edu, E-mail: masha.chernyakova@dcu.ie, E-mail: malloryr@gmail.com [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others
2016-11-10
The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.
Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981
International Nuclear Information System (INIS)
Lamb, R.C.
1981-04-01
Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June
Very high energy gamma ray astronomy from Hanle
International Nuclear Information System (INIS)
Chitnis, Varsha R.
2015-01-01
Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)
PULSED VERY HIGH ENERGY γ-RAY EMISSION CONSTRAINTS FOR PSR B1951+32 FROM STACEE OBSERVATIONS
International Nuclear Information System (INIS)
Zweerink, J.; Ball, J.; Carson, J. E.; Jarvis, A.; Ong, R. A.; Kildea, J.; Hanna, D. S.; Lindner, T.; Mueller, C.; Ragan, K.; Covault, C. E.; Driscoll, D. D.; Fortin, P.; Mukherjee, R.; Gingrich, D. M.; Williams, D. A.
2009-01-01
The Solar Tower Atmospheric Cherenkov Effect Experiment (STACEE) is a ground-based telescope that uses the wave-front-sampling technique to detect very high energy (VHE) gamma rays. STACEE's sensitivity in the energy range near 100 GeV permits useful observations of pulsars with the potential to discriminate between various proposed mechanisms for pulsed gamma-ray emission. Based on the 11.3 hr of data taken during the 2005 and 2006 observing seasons, we derive an upper limit on the pulsed gamma-ray emission from PSR B1951+32 of -11 photons cm -2 s -1 above an energy threshold of 117 GeV.
Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar
Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.
2018-05-01
The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.
A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514
Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.
2005-01-01
The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...
THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.
2012-01-01
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...
THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others
2012-02-20
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL
Modeling of Pulses in Terrestrial Gamma-ray Flashes
Xu, Wei; Celestin, Sebastien; Pasko, Victor
2015-04-01
Terrestrial Gamma-ray Flashes (TGFs) are high-energy photon bursts originating from the Earth's atmosphere that are associated with lightning activities. After their discovery in 1994 by the Burst and Transient Source Experiment (BATSE) detector aboard the Compton Gamma-Ray Observatory [Fishman et al., Science, 264, 1313, 1994], this phenomenon has been further observed by the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI) [Smith et al., Science, 307, 1085, 2005], the Fermi Gamma-ray Space Telescope [Briggs et al., JGR, 115, A07323, 2010] and the Astrorivelatore Gamma a Immagini Leggero (AGILE) satellite [Marisaldi et al., JGR, 115, A00E13, 2010]. Photon spectra corresponding to the mechanism of relativistic runaway electron avalanches (RREAs) usually provide a very good agreement with satellite observations [Dwyer and Smith, GRL, 32, L22804, 2005]. On the other hand, Celestin and Pasko [JGR, 116, A03315, 2011] have shown theoretically that the large flux of thermal runaway electrons generated by streamers during the negative corona flash stage of stepping lightning leaders in intracloud lightning flashes could be responsible for TGFs. Recently, based on analysis of the temporal profiles of 278 TGF events observed by the Fermi Gamma-Ray Burst Monitor, Foley et al. [JGR, 119, 5931, 2014] have suggested that 67% of TGF pulses detected are asymmetric and these asymmetric pulses are consistent with the production mechanism of TGFs by relativistic feedback discharges. In the present work, we employ a Monte Carlo model to study the temporal distribution of photons at low-orbit satellite altitudes during TGF events. Using the pulse fitting method described in [Foley et al., 2014], we further investigate the characteristics of TGF pulses. We mainly focus on the effects of Compton scattering on the symmetry properties and the rise and fall times of TGF pulses.
VERITAS OBSERVATIONS OF GAMMA-RAY BURSTS DETECTED BY SWIFT
International Nuclear Information System (INIS)
Acciari, V. A.; Benbow, W.; Aliu, E.; Errando, M.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Collins-Hughes, E.; Cesarini, A.; Connolly, M. P.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.
2011-01-01
We present the results of 16 Swift-triggered Gamma-ray burst (GRB) follow-up observations taken with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) telescope array from 2007 January to 2009 June. The median energy threshold and response time of these observations were 260 GeV and 320 s, respectively. Observations had an average duration of 90 minutes. Each burst is analyzed independently in two modes: over the whole duration of the observations and again over a shorter timescale determined by the maximum VERITAS sensitivity to a burst with a t –1.5 time profile. This temporal model is characteristic of GRB afterglows with high-energy, long-lived emission that have been detected by the Large Area Telescope on board the Fermi satellite. No significant very high energy (VHE) gamma-ray emission was detected and upper limits above the VERITAS threshold energy are calculated. The VERITAS upper limits are corrected for gamma-ray extinction by the extragalactic background light and interpreted in the context of the keV emission detected by Swift. For some bursts the VHE emission must have less power than the keV emission, placing constraints on inverse Compton models of VHE emission.
Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC
Directory of Open Access Journals (Sweden)
López-Coto Rubén
2016-01-01
Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.
Research of pulse gamma ray radiation effect on microcontroller system
International Nuclear Information System (INIS)
Yang Shanchao; Ma Qiang; Jin Xiaoming; Li Ruibin; Lin Dongsheng; Chen Wei; Liu Yan
2012-01-01
An experimental result of power chip LM7805 and microcontroller EE80C196KC20 based on the EE80C196KC20 testing system was presented. The pulse gamma ray radiation effect was investigated using 'Qiangguang-Ⅰ' accelerator. Latchup threshold of the microcontroller was obtained, and the relationship of supply current and I/O output with the transient dose rate was observed. The result shows that the restrainability of power chip on pulse gamma ray radiation induces microcontroller latchup effect. (authors)
SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others
2012-10-01
Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.
Event-sequence time series analysis in ground-based gamma-ray astronomy
International Nuclear Information System (INIS)
Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.
2008-01-01
The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.
Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.
Terrestrial gamma ray flash production by lightning current pulses
İnan, Umran Savaş; Carlson, B. E.; Lehtinen, N. G.
2017-01-01
Terrestrial gamma ray flashes (TGFs) are brief bursts of gamma rays observed by satellites, typically in coincidence with detectable lightning. We incorporate TGF observations and the key physics behind current TGF production theories with lightning physics to produce constraints on TGF production mechanisms. The combined constraints naturally suggest a mechanism for TGF production by current pulses in lightning leader channels. The mechanism involves local field enhancements due to charge re...
Impact of intense x-ray pulses on a NaI(Tl)-based gamma camera
Koppert, W. J. C.; van der Velden, S.; Steenbergen, J. H. L.; de Jong, H. W. A. M.
2018-03-01
In SPECT/CT systems x-ray and γ-ray imaging is performed sequentially. Simultaneous acquisition may have advantages, for instance in interventional settings. However, this may expose a gamma camera to relatively high x-ray doses and deteriorate its functioning. We studied the NaI(Tl) response to x-ray pulses with a photodiode, PMT and gamma camera, respectively. First, we exposed a NaI(Tl)-photodiode assembly to x-ray pulses to investigate potential crystal afterglow. Next, we exposed a NaI(Tl)-PMT assembly to 10 ms LED pulses (mimicking x-ray pulses) and measured the response to flashing LED probe-pulses (mimicking γ-pulses). We then exposed the assembly to x-ray pulses, with detector entrance doses of up to 9 nGy/pulse, and analysed the response for γ-pulse variations. Finally, we studied the response of a Siemens Diacam gamma camera to γ-rays while exposed to x-ray pulses. X-ray exposure of the crystal, read out with a photodiode, revealed 15% afterglow fraction after 3 ms. The NaI(Tl)-PMT assembly showed disturbances up to 10 ms after 10 ms LED exposure. After x-ray exposure however, responses showed elevated baselines, with 60 ms decay-time. Both for x-ray and LED exposure and after baseline subtraction, probe-pulse analysis revealed disturbed pulse height measurements shortly after exposure. X-ray exposure of the Diacam corroborated the elementary experiments. Up to 50 ms after an x-ray pulse, no events are registered, followed by apparent energy elevations up to 100 ms after exposure. Limiting the dose to 0.02 nGy/pulse prevents detrimental effects. Conventional gamma cameras exhibit substantial dead-time and mis-registration of photon energies up to 100 ms after intense x-ray pulses. This is due PMT limitations and due to afterglow in the crystal. Using PMTs with modified circuitry, we show that deteriorative afterglow effects can be reduced without noticeable effects on the PMT performance, up to x-ray pulse doses of 1 nGy.
Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3
HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.
2018-03-01
Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.
Pulsed Gamma-Rays From PSR J2021 3651 with the Fermi Large Area Telescope
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Battelino, Milan; /Royal Inst. Tech., Stockholm; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bogaert, G.; /Ecole Polytechnique; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /IASF, Milan /IASF, Milan /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /LPCE, Orleans /Montpellier U. /Sonoma State U. /Royal Inst. Tech., Stockholm /Stockholm U. /ASI, Rome /NRAO, Charlottesville /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Manchester U. /Montpellier U. /Bari U. /INFN, Bari; /more authors..
2011-11-30
We report the detection of pulsed gamma-rays from the young, spin-powered radio pulsar PSR J2021+3651 using data acquired with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). The light curve consists of two narrow peaks of similar amplitude separated by 0.468 {+-} 0.002 in phase. The first peak lags the maximum of the 2 GHz radio pulse by 0.162 {+-} 0.004 {+-} 0.01 in phase. The integral gamma-ray photon flux above 100 MeV is (56 {+-} 3 {+-} 11) x 10{sup -8} cm{sup -2} s{sup -1}. The photon spectrum is well-described by an exponentially cut-off power law of the form dF/dE = kE{sup -{Gamma}}e{sup (-E/E{sub c})} where the energy E is expressed in GeV. The photon index is {Gamma} = 1.5 {+-} 0.1 {+-} 0.1 and the exponential cut-off is E{sub c} = 2.4 {+-} 0.3 {+-} 0.5 GeV. The first uncertainty is statistical and the second is systematic. The integral photon flux of the bridge is approximately 10% of the pulsed emission, and the upper limit on off-pulse gamma-ray emission from a putative pulsar wind nebula is < 10% of the pulsed emission at the 95% confidence level. Radio polarization measurements yield a rotation measure of RM = 524 {+-} 4 rad m{sup -2} but a poorly constrained magnetic geometry. Re-analysis of Chandra data enhanced the significance of the weak X-ray pulsations, and the first peak is roughly phase-aligned with the first gamma-ray peak. We discuss the emission region and beaming geometry based on the shape and spectrum of the gamma-ray light curve combined with radio and X-ray measurements, and the implications for the pulsar distance. Gamma-ray emission from the polar cap region seems unlikely for this pulsar.
Pulsed Gamma-Rays From PSR J2021 3651 with the Fermi Large Area Telescope
International Nuclear Information System (INIS)
Abdo, Aous A.; Ackermann, M.; Ajello, Marco; Atwood, William B.; Baldini, L.; Ballet, J.; Barbiellini, Guido; Bastieri, Denis; Battelino, Milan; Baughman, B.M.; Bechtol, K.; Bellazzini, Ronaldo; Berenji, Bijan; Bloom, Elliott D.; Bogaert, G.; Borgland, Anders W.; Bregeon, J.; Brez, A.; Brigida, M.; Bruel, P.; Burnett, Thompson H.
2009-01-01
We report the detection of pulsed gamma-rays from the young, spin-powered radio pulsar PSR J2021+3651 using data acquired with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). The light curve consists of two narrow peaks of similar amplitude separated by 0.468 ± 0.002 in phase. The first peak lags the maximum of the 2 GHz radio pulse by 0.162 ± 0.004 ± 0.01 in phase. The integral gamma-ray photon flux above 100 MeV is (56 ± 3 ± 11) x 10 -8 cm -2 s -1 . The photon spectrum is well-described by an exponentially cut-off power law of the form dF/dE = kE -# Gamma#e (-E/E c ) where the energy E is expressed in GeV. The photon index is Γ = 1.5 ± 0.1 ± 0.1 and the exponential cut-off is E c = 2.4 ± 0.3 ± 0.5 GeV. The first uncertainty is statistical and the second is systematic. The integral photon flux of the bridge is approximately 10% of the pulsed emission, and the upper limit on off-pulse gamma-ray emission from a putative pulsar wind nebula is -2 but a poorly constrained magnetic geometry. Re-analysis of Chandra data enhanced the significance of the weak X-ray pulsations, and the first peak is roughly phase-aligned with the first gamma-ray peak. We discuss the emission region and beaming geometry based on the shape and spectrum of the gamma-ray light curve combined with radio and X-ray measurements, and the implications for the pulsar distance. Gamma-ray emission from the polar cap region seems unlikely for this pulsar.
A detailed study of the supernova remnant RCW 86 in TeV {gamma}-rays
Energy Technology Data Exchange (ETDEWEB)
Heinz, Sebastian
2012-03-29
A detailed study of the supernova remnant RCW 86 is presented. RCW 86 encountered a shell-like structure in radio, X-rays and optical, whereas in the discovery paper of RCW 86 in the very high energy regime the structure could not be confirmed. In this thesis for the first time the shell was resolved in the very high energy gamma rays. The shell width was determined to be 0.125 {+-}0.014 , the radius to be 0.194 {+-} 0.016 and the center to be -62.433 {+-}0.014 in declination and 220.734 {+-}0.016 in rectascension. The spectral analysis was performed for the whole SNR and for the south-east part, which is more pronounced in X-rays separately. But the results were comparable within errors. Additionally a power-law with an exponential cut off described the spectra best with the parameters: an spectral index of 1.50{+-}0.28, a cut-off energy of (2.69{+-}0.99 TeV) and an integral flux above 1 TeV of (6.51{+-}2.69) . 10{sup -12} cm{sup -2}s{sup -1}. The study of the correlation of the X-ray and VHE {gamma}-ray data of RCW 86 was hampered by the poor angular resolution of the VHE data. Therefore detailed studies of the Richardson-Lucy deconvolution algorithm have been performed. The outcome is, that deconvolution techniques are applicable to strong VHE {gamma}-ray sources and that fine structure well below the angular resolution can be studied. The application to RX J1713-3946, the brightest SNR in the VHE regime, has shown, that the correlation coefficient of the X-ray data and the VHE data of is stable down to 0.01 and has a value of 0.85. On the other side the significance of the data set is not sufficient in the case of RCW 86 to apply the deconvolution technique.
Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.
2017-12-01
The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.
Timing of Pulsed Prompt Gamma Rays for Background Discrimination
International Nuclear Information System (INIS)
Hueso-Gonzalez, F.; Golnik, C.; Berthel, M.; Dreyer, A.; Kormoll, T.; Rohling, H.; Pausch, G.; Enghardt, W.; Fiedler, F.; Heidel, K.; Schoene, S.; Schwengner, R.; Wagner, A.
2013-06-01
In the context of particle therapy, particle range verification is a major challenge for the quality assurance of the treatment. One approach is the measurement of the prompt gamma rays resulting from the tissue irradiation. A Compton camera based on several planes of position sensitive gamma ray detectors, together with an imaging algorithm, is expected to reconstruct the prompt gamma ray emission density profile, which is correlated with the dose distribution. At Helmholtz- Zentrum Dresden-Rossendorf (HZDR) and OncoRay, a camera prototype has been developed consisting of two scatter planes (CdZnTe cross strip detectors) and an absorber plane (Lu 2 SiO 5 block detector). The data acquisition is based on VME electronics and handled by software developed on the ROOT platform. The prototype was tested at the linear electron accelerator ELBE at HZDR, which was set up to produce bunched bremsstrahlung photons. Their spectrum has similarities with the one expected from prompt gamma rays in the clinical case, and these are also bunched with the accelerator frequency. The time correlation between the pulsed prompt photons and the measured signals was used for background discrimination, achieving a time resolution of 3 ns (2 ns) FWHM for the CZT (LSO) detector. A time-walk correction was applied for the LSO detector and improved its resolution to 1 ns. In conclusion, the detectors are suitable for time-resolved background discrimination in pulsed clinical particle accelerators. Ongoing tasks are the test of the imaging algorithms and the quantitative comparison with simulations. Further experiments will be performed at proton accelerators. (authors)
Energy Technology Data Exchange (ETDEWEB)
Kerschhaggl, Matthias
2010-04-06
PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has
Energy Technology Data Exchange (ETDEWEB)
Kerschhaggl, Matthias
2010-04-06
PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has
The effect of pulse pile-up on discrimination between neutrons and gamma rays
International Nuclear Information System (INIS)
Whittlestone, S.
1980-01-01
Pulse pile-up lengthens the rise-time of pulses. With an organic scintillator such as NE 213, pile-up can cause a short rise-time pulse originating from gamma rays to be interpreted by a rise-time analyser as a neutron. The degradation of pulse shape analyser performance at high count rates is shown to be directly related to pulse pile-up. Using this relationship, the contribution of piled-up gamma rays and neutrons to count rate related errors is calculated for a time-dependent fast neutron energy spectrum measurement. Errors of a few per cent occur even when the probability of a count per burst is as low as 0.01. (orig.)
Exploring the extreme gamma-ray sky with HESS
International Nuclear Information System (INIS)
Sol, Helene
2006-01-01
The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond
VLBI OBSERVATIONS OF THE JET IN M 87 DURING THE VERY HIGH ENERGY {gamma}-RAY FLARE IN 2010 APRIL
Energy Technology Data Exchange (ETDEWEB)
Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)
2012-11-20
We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.
Lopez-Coto, Ruben
2015-07-01
The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the
Inter-pulse high-resolution gamma-ray spectra using a 14 MeV pulsed neutron generator
Evans, L.G.; Trombka, J.I.; Jensen, D.H.; Stephenson, W.A.; Hoover, R.A.; Mikesell, J.L.; Tanner, A.B.; Senftle, F.E.
1984-01-01
A neutron generator pulsed at 100 s-1 was suspended in an artificial borehole containing a 7.7 metric ton mixture of sand, aragonite, magnetite, sulfur, and salt. Two Ge(HP) gamma-ray detectors were used: one in a borehole sonde, and one at the outside wall of the sample tank opposite the neutron generator target. Gamma-ray spectra were collected by the outside detector during each of 10 discrete time windows during the 10 ms period following the onset of gamma-ray build-up after each neutron burst. The sample was measured first when dry and then when saturated with water. In the dry sample, gamma rays due to inelastic neutron scattering, neutron capture, and decay were counted during the first (150 ??s) time window. Subsequently only capture and decay gamma rays were observed. In the wet sample, only neutron capture and decay gamma rays were observed. Neutron capture gamma rays dominated the spectrum during the period from 150 to 400 ??s after the neutron burst in both samples, but decreased with time much more rapidly in the wet sample. A signal-to-noise-ratio (S/N) analysis indicates that optimum conditions for neutron capture analysis occurred in the 350-800 ??s window. A poor S/N in the first 100-150 ??s is due to a large background continuum during the first time interval. Time gating can be used to enhance gamma-ray spectra, depending on the nuclides in the target material and the reactions needed to produce them, and should improve the sensitivity of in situ well logging. ?? 1984.
Baseline distortion effect on gamma-ray pulse-height spectra in neutron capture experiments
International Nuclear Information System (INIS)
Laptev, A.; Harada, H.; Nakamura, S.; Hori, J.; Igashira, M.; Ohsaki, T.; Ohgama, K.
2005-01-01
A baseline distortion effect due to gamma-flash at neutron time-of-flight measurement using a pulse neutron source has been investigated. Pulses from C 6 D 6 detectors accumulated by flash-ADC were processed with both standard analog-to-digital converter (ADC) and flash-ADC operational modes. A correction factor of gamma-ray yields, due to baseline shift, was quantitatively obtained by comparing the pulse height spectra of the two data-taking modes. The magnitude of the correction factor depends on the time after gamma-flash and has complex time dependence with a changing sign
Computer model for calculating gamma-ray pulse-height spectra for logging applications
International Nuclear Information System (INIS)
Evans, M.L.
1981-01-01
A generalized computer model has been devised to simulate the emission, transport, and detection of natural gamma radiation from various logging environments. The model yields high-resolution gamma-ray pulse-height spectra that can be used to correct both gross gamma and spectral gamma-ray logs. The technique can help provide corrections to airborne and surface radiometric survey logs for the effects of varying altitude, formation composition, and overburden. Applied to borehole logging, the model can yield estimates of the effects of varying borehole fluid and casing attenuations, as well as varying formation porosity and saturation
SEARCH FOR PULSED {gamma}-RAY EMISSION FROM GLOBULAR CLUSTER M28
Energy Technology Data Exchange (ETDEWEB)
Wu, J. H. K.; Kong, A. K. H.; Huang, R. H. H.; Tam, P. H. T. [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu, Taiwan (China); Hui, C. Y. [Department of Astronomy and Space Science, Chungnam National University, Daejeon (Korea, Republic of); Wu, E. M. H.; Takata, J.; Cheng, K. S., E-mail: wuhkjason@gmail.com, E-mail: cyhui@cnu.ac.kr [Department of Physics, University of Hong Kong, Pokfulam Road (Hong Kong)
2013-03-10
Using the data from the Large Area Telescope on board the Fermi Gamma-ray Space Telescope, we have searched for {gamma}-ray pulsations from the direction of the globular cluster M28 (NGC 6626). We report the discovery of a signal with a frequency consistent with that of the energetic millisecond pulsar (MSP) PSR B1821-24 in M28. A weighted H-test test statistic of 28.8 is attained, which corresponds to a chance probability of {approx}10{sup -5} (4.3{sigma} detection). With a phase-resolved analysis, the pulsed component is found to contribute {approx}25% of the total observed {gamma}-ray emission from the cluster. However, the unpulsed level provides a constraint for the underlying MSP population and the fundamental plane relations for the scenario of inverse Compton scattering. Follow-up timing observations in radio/X-ray are encouraged to further investigate this periodic signal candidate.
International Nuclear Information System (INIS)
Smith, H.D. Jr.; Smith, M.P.; Schultz, W.E.
1978-01-01
An improved pulsed neutron porosity logging system is provided in the present invention. A logging tool provided with a 14 MeV pulsed neutron source, an epithermal neutron detector and an inelastic scattering gamma ray detector is moved through a borehole. The detection of inelastic gamma rays provides a measure of the fast neutron population in the vicinity of the detector. repetitive bursts of neutrons irradiate the earth formation and, during the busts, inelastic gamma rays representative of the fast neutron population is sampled. During the interval between bursts the epithermal neutron population is sampled along with background gamma radiation due to lingering thermal neutrons. the fast and epithermal neutron population measurements are combined to provide a measurement of formation porosity
Component Analysis of Long-Lag, Wide-Pulse Gamma-Ray Burst ...
Indian Academy of Sciences (India)
Principal Component Analysis of Long-Lag, Wide-Pulse Gamma-Ray. Burst Data. Zhao-Yang Peng. ∗. & Wen-Shuai Liu. Department of Physics, Yunnan Normal University, Kunming 650500, China. ∗ e-mail: pzy@ynao.ac.cn. Abstract. We have carried out a Principal Component Analysis (PCA) of the temporal and spectral ...
TEV GAMMA-RAY OBSERVATIONS OF THE GALACTIC CENTER RIDGE BY VERITAS
Energy Technology Data Exchange (ETDEWEB)
Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Fleischhack, H. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Flinders, A. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Fortson, L., E-mail: asmith44@umd.edu [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); and others
2016-04-20
The Galactic Center ridge has been observed extensively in the past by both GeV and TeV gamma-ray instruments revealing a wealth of structure, including a diffuse component and the point sources G0.9+0.1 (a composite supernova remnant) and Sgr A* (believed to be associated with the supermassive black hole located at the center of our Galaxy). Previous very high energy (VHE) gamma-ray observations with the H.E.S.S. experiment have also detected an extended TeV gamma-ray component along the Galactic plane in the >300 GeV gamma-ray regime. Here we report on observations of the Galactic Center ridge from 2010 to 2014 by the VERITAS telescope array in the >2 TeV energy range. From these observations we (1) provide improved measurements of the differential energy spectrum for Sgr A* in the >2 TeV gamma-ray regime, (2) provide a detection in the >2 TeV gamma-ray emission from the composite SNR G0.9+0.1 and an improved determination of its multi-TeV gamma-ray energy spectrum, and (3) report on the detection of VER J1746-289, a localized enhancement of >2 TeV gamma-ray emission along the Galactic plane.
Inverse Compton gamma-rays from pulsars
International Nuclear Information System (INIS)
Morini, M.
1983-01-01
A model is proposed for pulsar optical and gamma-ray emission where relativistic electrons beams: (i) scatter the blackbody photons from the polar cap surface giving inverse Compton gamma-rays and (ii) produce synchrotron optical photons in the light cylinder region which are then inverse Compton scattered giving other gamma-rays. The model is applied to the Vela pulsar, explaining the first gamma-ray pulse by inverse Compton scattering of synchrotron photons near the light cylinder and the second gamma-ray pulse partly by inverse Compton scattering of synchrotron photons and partly by inverse Compton scattering of the thermal blackbody photons near the star surface. (author)
Random pulsing of neutron source for inelastic neutron scattering gamma ray spectroscopy
International Nuclear Information System (INIS)
Hertzog, R.C.
1981-01-01
Method and apparatus are described for use in the detection of inelastic neutron scattering gamma ray spectroscopy. Data acquisition efficiency is enhanced by operating a neutron generator such that a resulting output burst of fast neutrons is maintained for as long as practicably possible until a gamma ray is detected. Upon the detection of a gamma ray the generator burst output is terminated. Pulsing of the generator may be accomplished either by controlling the burst period relative to the burst interval to achieve a constant duty cycle for the operation of the generator or by maintaining the burst period constant and controlling the burst interval such that the resulting mean burst interval corresponds to a burst time interval which reduces contributions to the detected radiation of radiation occasioned by other than the fast neutrons
Discovery of the hard spectrum VHE γ-ray source HESS J1641-463
International Nuclear Information System (INIS)
Abramowski, A.; Ait Benkhali, F.
2014-10-01
This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
The Advanced Gamma-Ray Imaging System (AGIS)
Otte, Nepomuk
The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.
Energy Technology Data Exchange (ETDEWEB)
Kaplan, A.C., E-mail: Alexis.C.Kaplan@gmail.com [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, 2355 Bonisteel Blvd., Ann Arbor, MI 48104 (United States); Nuclear Engineering and Nonproliferation Division, Los Alamos National Laboratory, Los Alamos, NM 87544 (United States); Flaska, M.; Enqvist, A.; Dolan, J.L.; Pozzi, S.A. [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, 2355 Bonisteel Blvd., Ann Arbor, MI 48104 (United States)
2013-11-21
Measuring neutrons in the presence of high gamma-ray fluence is a challenge with multi-particle detectors. Organic liquid scintillators such as the EJ-309 are capable of accurate pulse-shape discrimination (PSD) but the chance for particle misclassification is not negligible for some applications. By varying the distance from an EJ-309 scintillator to a strong-gamma-ray source and keeping a weak-neutron source at a fixed position, various gamma-to-neutron ratios can be measured and PSD performance can be quantified. Comparing neutron pulse-height distributions allows for pulse-height specific PSD evaluation, and quantification and visualization of deviation from {sup 252}Cf alone. Even with the addition of the misclassified gamma-rays, the PSD is effective in separating particles so that neutron count rate can be predicted with less than 10% error up to a gamma-to-neutron ratio of almost 650. For applications which can afford a reduction in neutron detection efficiency, PSD can be sufficiently effective in discriminating particles to measure a weak neutron source in a high gamma-ray background. -- Highlights: •We measure neutrons in a high photon background with EJ-309 liquid scintillators. •A low threshold is used to test the limits of particle discrimination. •A weak neutron signal is detectable with a gamma/neutron ratio as high as 770. •Photon pileup most commonly adds to error in classification of neutrons. •Neutron count rates are within 10% of expected rate under high gamma background.
International Nuclear Information System (INIS)
Kaplan, A.C.; Flaska, M.; Enqvist, A.; Dolan, J.L.; Pozzi, S.A.
2013-01-01
Measuring neutrons in the presence of high gamma-ray fluence is a challenge with multi-particle detectors. Organic liquid scintillators such as the EJ-309 are capable of accurate pulse-shape discrimination (PSD) but the chance for particle misclassification is not negligible for some applications. By varying the distance from an EJ-309 scintillator to a strong-gamma-ray source and keeping a weak-neutron source at a fixed position, various gamma-to-neutron ratios can be measured and PSD performance can be quantified. Comparing neutron pulse-height distributions allows for pulse-height specific PSD evaluation, and quantification and visualization of deviation from 252 Cf alone. Even with the addition of the misclassified gamma-rays, the PSD is effective in separating particles so that neutron count rate can be predicted with less than 10% error up to a gamma-to-neutron ratio of almost 650. For applications which can afford a reduction in neutron detection efficiency, PSD can be sufficiently effective in discriminating particles to measure a weak neutron source in a high gamma-ray background. -- Highlights: •We measure neutrons in a high photon background with EJ-309 liquid scintillators. •A low threshold is used to test the limits of particle discrimination. •A weak neutron signal is detectable with a gamma/neutron ratio as high as 770. •Photon pileup most commonly adds to error in classification of neutrons. •Neutron count rates are within 10% of expected rate under high gamma background
Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field
Energy Technology Data Exchange (ETDEWEB)
Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE
2006-04-19
The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.
Science with the Advanced Gamma Ray Imaging System (AGIS)
Coppi, Paolo
2009-05-01
We present the scientific drivers for the Advanced Gamma Ray Imaging System (AGIS), a concept for the next-generation ground- based gamma-ray experiment, comprised of an array of ˜100 imaging atmospheric Cherenkov telescopes. Design requirements for AGIS include achieving a sensitivity an order of magnitude better than the current generation of space or ground-based instruments in the energy range of 40 GeV to ˜100 TeV. We present here an overview of the scientific goals of AGIS, including the prospects for understanding VHE phenomena in the vicinity of accreting black holes, particle acceleration in a variety of astrophysical environments, indirect detection of dark matter, study of cosmological background radiation fields, and particle physics beyond the standard model.
GAMMA-RAY SIGNAL FROM THE PULSAR WIND IN THE BINARY PULSAR SYSTEM PSR B1259-63/LS 2883
Energy Technology Data Exchange (ETDEWEB)
Khangulyan, Dmitry [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Aharonian, Felix A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Bogovalov, Sergey V. [National Research Nuclear University-MEPHI, Kashirskoe Shosse 31, Moscow 115409 (Russian Federation); Ribo, Marc, E-mail: khangul@astro.isas.jaxa.jp, E-mail: felix.aharonian@dias.ie, E-mail: svbogovalov@mephi.ru, E-mail: mribo@am.ub.es [Departament d' Astronomia i Meteorologia, Institut de Ciences del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain)
2011-12-01
Binary pulsar systems emit potentially detectable components of gamma-ray emission due to Comptonization of the optical radiation of the companion star by relativistic electrons of the pulsar wind, both before and after termination of the wind. The recent optical observations of binary pulsar system PSR B1259-63/LS 2883 revealed radiation properties of the companion star which differ significantly from previous measurements. In this paper, we study the implications of these observations for the interaction rate of the unshocked pulsar wind with the stellar photons and the related consequences for fluxes of high energy and very high energy (VHE) gamma rays. We show that the signal should be strong enough to be detected with Fermi close to the periastron passage, unless the pulsar wind is strongly anisotropic or the Lorentz factor of the wind is smaller than 10{sup 3} or larger than 10{sup 5}. The higher luminosity of the optical star also has two important implications: (1) attenuation of gamma rays due to photon-photon pair production and (2) Compton drag of the unshocked wind. While the first effect has an impact on the light curve of VHE gamma rays, the second effect may significantly decrease the energy available for particle acceleration after termination of the wind.
Catalogue of response spectra for unfolding in situ gamma-ray pulse-height distributions
International Nuclear Information System (INIS)
Dymke, N.
1982-01-01
To unfold in situ gamma-ray pulse-height distributions by means of a response matrix technique, the matrix must be in keeping with the measurement geometry, detector size, and energy range to be covered by the measurements. A methodology has been described for determination of standard gamma-ray spectra needed in deriving response matrices and a spectrum catalogue compiled containing graphs and data for the 0-3 MeV (4 x 4 in. NaI(Tl)) and 0-8 MeV (1.5 x 1.5 in. NaI(Tl)) ranges. (author)
Discovery of a point-like very-high-energy gamma-ray source in Monoceros
International Nuclear Information System (INIS)
Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.
2007-01-01
Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)
Pulser injection with subsequent removal for gamma-ray spectrometry
International Nuclear Information System (INIS)
Hartwell, J.K.; Goodwin, S.G.; Johnson, L.O.; Killian, E.W.
1990-01-01
This patent describes a module for use with a gamma-ray spectroscopy system. The system includes a gamma-ray detector for detecting gamma-ray events and producing a signal representing the gamma-ray events, a converter responsive to the detector and capable of converting the signal to a spectrum, a storage memory responsive to the converter and capable of storing the spectrum at address locations in memory, and a pulser capable of injecting pulses into the signal produced by the detector. The module comprises: means for generating a logic pulse for controlling the pulser, the controlling means adapted for coupling to the pulser; means for generating separation of events logic to isolate the components of a combined gamma-ray---pulse spectrum, the separation of events logic means adapted for coupling to the converter and the storage memory with the capability of storing pulses at address locations in the storage memory separate from the gamma-ray events; means for receiving an imitating signal from the converter to generate a plurality of operations by the module; means for tracking variations in a gamma-ray---pulse spectrum brought on by external parameter changes; and means for interfacing with commercially developed gamma-ray spectrometry equipment
LIMITS ON PROMPT, DISPERSED RADIO PULSES FROM GAMMA-RAY BURSTS
International Nuclear Information System (INIS)
Bannister, K. W.; Murphy, T.; Gaensler, B. M.; Reynolds, J. E.
2012-01-01
We have searched for prompt radio emission from nine gamma-ray bursts (GRBs) with a 12 m telescope at 1.4 GHz, with a time resolution of 64 μs to 1 s. We detected single dispersed radio pulses with significances >6σ in the few minutes following two GRBs. The dispersion measures of both pulses are well in excess of the expected Galactic values, and the implied rate is incompatible with known sources of single dispersed pulses. The arrival times of both pulses also coincide with breaks in the GRB X-ray light curves. A null trial and statistical arguments rule out random fluctuations as the origin of these pulses with >95% and ∼97% confidence, respectively, although a simple population argument supports a GRB origin with confidence of only 2%. We caution that we cannot rule out radio frequency interference (RFI) as the origin of these pulses. If the single pulses are not related to the GRBs, we set an upper limit on the flux density of radio pulses emitted between 200 and 1800 s after a GRB of 1.27w –1/2 Jy, where 6.4 × 10 –5 s –3 s is the pulse width. We set a limit of less than 760 Jy for long timescale (>1 s) variations. These limits are some of the most constraining at high time resolution and GHz frequencies in the early stages of the GRB phenomenon.
International Nuclear Information System (INIS)
Marshall, J.H. III.
1979-01-01
The active reduction of the number of analyzed events with pulse amplitudes which pileup has distorted improves measurement accuracy and response time in an apparatus for neutron-capture-based on-line elemental analysis of bulk substances. Within the apparatus, the analyzed bulk substance is exposed to neutrons, and neutron capture generates prompt gamma rays therefrom. A detector interacts with some of these gamma rays to produce electrical signals used to measure their energy spectrum by pulse-height analysis. Circuits associated with this pulse-height analysis also detect the pileup of the signals of two or more independent gamma rays using one or more of several techniques. These techniques include multiple outputs from a special amplifier-discriminator system, which has been optimized for low pulse-pair resolving time and may have adaptive thresholds, and the requirement that the relative amplitudes of the outputs of slow and fast amplifiers be consistent with a single event producing both outputs. Pulse-width measurements are also included in the pileup detection
Guillemot, L.; Johnson, T. J.; Venter, C.; Kerr, M.; Pancrazi, B.; Livingstone, M.; Janssen, G. H.; Jaroenjittichai, P.; Kramer, M.; Cognard, I.;
2011-01-01
We report the detection of pulsed gamma-ray emission from the fast millisecond pulsars (MSPs) B1937+21 (also known as J1939+2134) and B1957+20 (J1959+2048) using 18 months of survey data recorded by the Fermi Large Area Telescope (LAT) and timing solutions based on radio observations conducted at the Westerbork and Nancay radio telescopes. In addition, we analyzed archival RXTE and XMM-Newton X-ray data for the two MSPs, confirming the X-ray emission properties of PSR B1937+21 and finding evidence (approx. 4(sigma)) for pulsed emission from PSR B1957+20 for the first time. In both cases the gamma-ray emission profile is characterized by two peaks separated by half a rotation and are in close alignment with components observed in radio and X-rays. These two pulsars join PSRs J0034..0534 and J2214+3000 to form an emerging class of gamma-ray MSPs with phase-aligned peaks in different energy bands. The modeling of the radio and gamma-ray emission pro les suggests co-located emission regions in the outer magnetosphere.
On the Time Evolution of Gamma-Ray Burst Pulses: A Self-Consistent Description.
Ryde; Svensson
2000-01-20
For the first time, the consequences of combining two well-established empirical relations that describe different aspects of the spectral evolution of observed gamma-ray burst (GRB) pulses are explored. These empirical relations are (1) the hardness-intensity correlation and (2) the hardness-photon fluence correlation. From these we find a self-consistent, quantitative, and compact description for the temporal evolution of pulse decay phases within a GRB light curve. In particular, we show that in the case in which the two empirical relations are both valid, the instantaneous photon flux (intensity) must behave as 1&solm0;&parl0;1+t&solm0;tau&parr0;, where tau is a time constant that can be expressed in terms of the parameters of the two empirical relations. The time evolution is fully defined by two initial constants and two parameters. We study a complete sample of 83 bright GRB pulses observed by the Compton Gamma-Ray Observatory and identify a major subgroup of GRB pulses ( approximately 45%) which satisfy the spectral-temporal behavior described above. In particular, the decay phase follows a reciprocal law in time. It is unclear what physics causes such a decay phase.
Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.
2018-05-01
The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.
Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.
Time profiles and pulse structure of bright, long gamma-ray bursts using BATSE TTS data
International Nuclear Information System (INIS)
Lee, A.; Bloom, E.; Scargle, J.
1996-04-01
The time profiles of many gamma-ray bursts observed by BATSE consist of distinct pulses, which offer the possibility of characterizing the temporal structure of these bursts using a relatively small set of pulse-shape parameters. This pulse analysis has previously been performed on some bright, long bursts using binned data, and on some short bursts using BATSE Time-Tagged Event (TTE) data. The BATSE Time- to-Spill (TTS) burst data records the times required to accumulate a fixed number of photons, giving variable time resolution. The spill times recorded in the TTS data behave as a gamma distribution. We have developed an interactive pulse-fitting program using the pulse model of Norris et al. and a maximum-likelihood fitting algorithm to the gamma distribution of the spill times. We then used this program to analyze a number of bright, long bursts for which TTS data is available. We present statistical information on the attributes of pulses comprising these bursts
Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes
Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.
2017-06-01
Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.
Fermi LAT Observations of LS I +61 303: First Detection of an Orbital Modulation in GeV Gamma Rays
Energy Technology Data Exchange (ETDEWEB)
Abdo, A.A.; /Federal City Coll. /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, R.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /DAPNIA, Saclay /NASA, Goddard /CSST, Baltimore /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /SLAC /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Grenoble, CEN; /more authors..
2012-04-02
This Letter presents the first results from the observations of LS I +61{sup o}303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 {+-} 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 {+-} 0.03(stat) {+-} 0.07(syst) 10{sup -6} ph cm{sup -2} s{sup -1}, with a cutoff at 6.3 {+-} 1.1(stat) {+-} 0.4(syst) GeV and photon index {Gamma} = 2.21 {+-} 0.04(stat) {+-} 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.
Pulsed Gamma-Rays From the Millisecond Pulsar J0030+0451 with the Fermi Large Area Telescope
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M. /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Battelino, M.; /Stockholm U., OKC /Royal Inst. Tech., Stockholm; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Trieste /Hiroshima U.; /more authors..
2011-11-17
We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar PSR J0030+0451 with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second millisecond pulsar to be detected in gamma-rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma Ray Observatory. The spin-down power {dot E} = 3.5 x 10{sup 33} ergs s{sup -1} is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, respectively 0.07 {+-} 0.01 and 0.08 {+-} 0.02 wide, separated by 0.44 {+-} 0.02 in phase. The first gamma-ray peak falls 0.15 {+-} 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cut-off power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 {+-} 1.05 {+-} 1.35) x 10{sup -8} cm{sup -2} s{sup -1} with cut-off energy (1.7 {+-} 0.4 {+-} 0.5) GeV. Based on its parallax distance of (300 {+-} 90) pc, we obtain a gamma-ray efficiency L{sub {gamma}}/{dot E} {approx_equal} 15% for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.
International Nuclear Information System (INIS)
Wilson, G.V.H.; George, E.P.; Hora, H.
1976-01-01
A method is described for controlling the emission and direction of gamma rays from excited nuclei contained in a sample source of suitable geometry having its major axis parallel to the proposed direction of gamma ray emission, comprising subjecting said sample source to thermal or dynamic polarization at temperatures approaching absolute zero in the presence of a strong magnetic field, and when a pulse of coherent gamma radiation is required along said major axis rotating the active nuclei through 90 0 by employing a short pulse of radio frequency oscillations in an auxilliary coil around the sample source
The opacity of the universe for high and very high energy {gamma}-rays
Energy Technology Data Exchange (ETDEWEB)
Meyer, Manuel
2013-08-15
The flux of high energy (HE, energy 100 MeV
DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others
2014-10-10
This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
Pulsed Gamma-Rays From the Millisecond Pulsar J0030+0451 with the Fermi Large Area Telescope
International Nuclear Information System (INIS)
Abdo, Aous A.; Ackermann, M.; Atwood, W.B.; Axelsson, M.; Baldini, L.; Ballet, J.; Barbiellini, Guido; Bastieri, Denis; Battelino, M.; Baughman, B.M.; Bechtol, K.; Bellazzini, R.; Berenji, B.; Bloom, Elliott D.; Bonamente, E.; Borgland, A.W.; Bregeon, J.; Brez, A.; Brigida, M.; Bruel, P.; Burnett, Thompson H.
2009-01-01
We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar PSR J0030+0451 with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second millisecond pulsar to be detected in gamma-rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma Ray Observatory. The spin-down power (dot E) = 3.5 x 10 33 ergs s -1 is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, respectively 0.07 ± 0.01 and 0.08 ± 0.02 wide, separated by 0.44 ± 0.02 in phase. The first gamma-ray peak falls 0.15 ± 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cut-off power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 ± 1.05 ± 1.35) x 10 -8 cm -2 s -1 with cut-off energy (1.7 ± 0.4 ± 0.5) GeV. Based on its parallax distance of (300 ± 90) pc, we obtain a gamma-ray efficiency L γ /(dot E) ≅ 15% for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.
PULSED GAMMA RAYS FROM THE MILLISECOND PULSAR J0030+0451 WITH THE FERMI LARGE AREA TELESCOPE
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Battelino, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.; Bruel, P.
2009-01-01
We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar (MSP) PSR J0030+0451 with the Large Area Telescope on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second MSP to be detected in gamma rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma-Ray Observatory. The spin-down power E-dot=3.5x10 33 erg s -1 is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, 0.07 ± 0.01 and 0.08 ± 0.02 wide, respectively, separated by 0.44 ± 0.02 in phase. The first gamma-ray peak falls 0.15 ± 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cutoff power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 ± 1.05 ± 1.35) x 10 -8 cm -2 s -1 with cutoff energy (1.7 ± 0.4 ± 0.5) GeV. Based on its parallax distance of (300 ± 90) pc, we obtain a gamma-ray efficiency L γ /E-dot≅15 percent for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.
Gamma-ray pulsars: Emission zones and viewing geometries
Romani, Roger W.; Yadigaroglu, I.-A.
1995-01-01
There are now a half-dozen young pulsars detected in high-energy photons by the Compton Gamma-Ray Observatory (CGRO), showing a variety of emission efficiencies and pulse profiles. We present here a calculation of the pattern of high-energy emission on the sky in a model which posits gamma-ray production by charge-depleted gaps in the outer magnetosphere. This model accounts for the radio to gamma-ray pulse offsets of the known pulsars, as well as the shape of the high-energy pulse profiles. We also show that about one-third of emitting young radio pulsars will not be detected due to beaming effects, while approximately 2.5 times the number of radio-selected gamma-ray pulsars will be viewed only high energies. Finally we compute the polarization angle variation and find that the previously misunderstood optical polarization sweep of the Crab pulsar arises naturally in this picture. These results strongly support an outer magnetosphere location for the gamma-ray emission.
Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope
International Nuclear Information System (INIS)
Badran, H.M.
2004-01-01
Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV
Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae
Energy Technology Data Exchange (ETDEWEB)
Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)
2017-07-20
The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.
FERMI LAT OBSERVATIONS OF LS I +610303: FIRST DETECTION OF AN ORBITAL MODULATION IN GeV GAMMA RAYS
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.
2009-01-01
This Letter presents the first results from the observations of LS I +61 0 303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 ± 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 ± 0.03(stat) ± 0.07(syst) 10 -6 ph cm -2 s -1 , with a cutoff at 6.3 ± 1.1(stat) ± 0.4(syst) GeV and photon index Γ = 2.21 ± 0.04(stat) ± 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.
International Nuclear Information System (INIS)
Abbene, L; Gerardi, G; Raso, G; Brai, M; Principato, F; Basile, S
2013-01-01
New generation spectroscopy systems have advanced towards digital pulse processing (DPP) approaches. DPP systems, based on direct digitizing and processing of detector signals, have recently been favoured over analog pulse processing electronics, ensuring higher flexibility, stability, lower dead time, higher throughput and better spectroscopic performance. In this work, we present the performance of a new real time DPP system for X-ray and gamma ray semiconductor detectors. The system is based on a commercial digitizer equipped with a custom DPP firmware, developed by our group, for on-line pulse shape and height analysis. X-ray and gamma ray spectra measurements with cadmium telluride (CdTe) and germanium (Ge) detectors, coupled to resistive-feedback preamplifiers, highlight the excellent performance of the system both at low and high rate environments (up to 800 kcps). A comparison with a conventional analog electronics showed the better high-rate capabilities of the digital approach, in terms of energy resolution and throughput. These results make the proposed DPP system a very attractive tool for both laboratory research and for the development of advanced detection systems for high-rate-resolution spectroscopic imaging, recently proposed in diagnostic medicine, industrial imaging and security screening
Pulse-shape discrimination of high-energy neutrons and gamma rays in NaI(Tl)
International Nuclear Information System (INIS)
Share, G.H.; Kurfess, J.D.; Theus, R.B.
1978-01-01
Pulse-shape discrimination can be used to separate neutron and gamma-ray interactions depositing energies up to in excess of 50 MeV in NaI(Tl) crystals. The secondary alpha particles, deuterons and protons produced in the neutron interactions are also resolvable. (Auth.)
International Nuclear Information System (INIS)
Moss, C.E.; Lucas, M.C.; Tisinger, E.W.; Hamm, M.E.
1984-01-01
Our system consists of a LeCroy 3500 data acquisition system with a built-in CAMAC crate and eight bismuth-germanate detectors 7.62 cm in diameter and 7.62 cm long. Gamma-ray pulse-height distributions are acquired simultaneously for up to eight positions. The system was very carefully calibrated and characterized from 0.1 to 8.3 MeV using gamma-ray spectra from a variety of radioactive sources. By fitting the pulse-height distributions from the sources with a function containing 17 parameters, we determined theoretical repsonse functions. We use these response functions to unfold the distributions to obtain flux spectra. A flux-to-dose-rate conversion curve based on the work of Dimbylow and Francis is then used to obtain dose rates. Direct use of measured spectra and flux-to-dose-rate curves to obtain dose rates avoids the errors that can arise from spectrum dependence in simple gamma-ray dosimeter instruments. We present some gamma-ray doses for the Little Boy assembly operated at low power. These results can be used to determine the exposures of the Hiroshima survivors and thus aid in the establishment of radation exposure limits for the nuclear industry
Neutron-gamma discrimination by pulse analysis with superheated drop detector
International Nuclear Information System (INIS)
Das, Mala; Seth, S.; Saha, S.; Bhattacharya, S.; Bhattacharjee, P.
2010-01-01
Superheated drop detector (SDD) consisting of drops of superheated liquid of halocarbon is irradiated to neutrons and gamma-rays from 252 Cf fission neutron source and 137 Cs gamma source, respectively, separately. Analysis of pulse height of signals at the neutron and gamma-ray sensitive temperature provides significant information on the identification of neutron and gamma-ray induced events.
Pulse shape analysis for the gamma-ray tracking detector Agata
International Nuclear Information System (INIS)
Olariu, A.
2007-10-01
Agata is the European project for a 4π gamma-ray tracking array of 180 Ge detectors and is expected to have a detection sensitivity higher by 3 orders of magnitude than that of the present generation of gamma spectrometers. The trajectories of the photons inside a Ge crystal are reconstituted, which allows the determination of the initial energy of the incident photons as the total energy deposited along the track. The sequence of a γ-ray scattering process is too fast compared with the time resolution of the detector to be measured electronically, so tracking algorithms are necessary. Gamma-ray tracking detectors are operating in position sensitive mode it means that Ge crystal are segmented in order to facilitate the localization of the gamma interactions. It is possible to improve the position resolution by using the information conveyed by the shape of the detector signal. The task of the PSA (Pulse Shape Analysis) algorithm is to analyze this signal and extract the number of interactions, the position and the energy of each interaction. PSA algorithms rely on a basis of reference signals given by single interactions and that are obtained through an experimental characterization of the detector with scanning systems. The matrix method is a new PSA algorithm that consists in fitting linearly the detector signal with a set of calculated signals. We have tested this method with both simulated and measured signals. In the case of simulated single interactions the position resolution is 1.4 mm which is within Agata's specifications. For measured signals we have obtained mean positional errors of 3.2 mm at the front end of the detector an 4.8 mm at the back end
Properties of gamma-ray burst time profiles using pulse decomposition analysis
Energy Technology Data Exchange (ETDEWEB)
Lee, A.
2000-02-08
The time profiles of many gamma-ray bursts consist of distinct pulses, which offers the possibility of characterizing the temporal structure of these bursts using a relatively small set of pulse shape parameters. This pulse decomposition analysis has previously been performed on a small sample of bright long bursts using binned data from BATSE, which comes in several data types, and on a sample of short bursts using the BATSE Time-Tagged Event (TTE) data type. The authors have developed an interactive pulse-fitting program using the phenomenological pulse model of Norris, et. al. and a maximum-likelihood fitting routine. They have used this program to analyze the Time-to-Spill (TTS) data for all bursts observed by BATSE up through trigger number 2000, in all energy channels for which TTS data is available. They present statistical information on the attributes of pulses comprising these bursts, including relations between pulse characteristics through the course of a burst. They carry out simulations to determine the biases that their procedures may introduce. They find that pulses tend to have shorter rise times than decay times, and tend to be narrower and peak earlier at higher energies. They also find that pulse brightness, pulse width, and pulse hardness ratios do not evolve monotonically within bursts, but that the ratios of pulse rise times to decay times tends to decrease with time within bursts.
International Nuclear Information System (INIS)
Zuo Guangxia; He Bin; Xu Peng; Qiu Xiaolin; Ma Wenyan; Li Sufen
2012-01-01
In neutrons detection, it is important to discriminate the neutron signals from the gamma-ray background. In this article, simulation of neutrons and gamma pulse signals is developed based on the LabVIEW platform. Two digital algorithms of the charge comparison method and the pulse duration time method are realized using 10000 simulation signals. Experimental results show that neutron and gamma pulse signals can be discriminated by the two methods, and the pulse duration time method is better than the charge comparison method. (authors)
Gamma ray energy tracking in GRETINA
Lee, I. Y.
2011-10-01
The next generation of stable and exotic beam accelerators will provide physics opportunities to study nuclei farther away from the line of stability. However, these experiments will be more demanding on instrumentation performance. These come from the lower production rate for more exotic beams, worse beam impurities, and large beam velocity from the fragmentation and inverse reactions. Gamma-ray spectroscopy will be one of the most effective tools to study exotic nuclei. However, to fully exploit the physics reach provided by these new facilities, better gamma-ray detector will be needed. In the last 10 years, a new concept, gamma-ray energy tracking array, was developed. Tracking arrays will increase the detection sensitivity by factors of several hundred compared to current arrays used in nuclear physics research. Particularly, the capability of reconstructing the position of the interaction with millimeters resolution is needed to correct the Doppler broadening of gamma rays emitted from high velocity nuclei. GRETINA is a gamma-ray tracking array which uses 28 Ge crystals, each with 36 segments, to cover ¼ of the 4 π of the 4 π solid angle. The gamma ray tracking technique requires detailed pulse shape information from each of the segments. These pulses are digitized using 14-bit 100 MHz flash ADCs, and digital signal analysis algorithms implemented in the on-board FPGAs provides energy, time and selection of pulse traces. A digital trigger system, provided flexible trigger functions including a fast trigger output, and also allows complicated trigger decisions to be made up to 20 microseconds. Further analyzed, carried out in a computer cluster, determine the energy, time, and three-dimensional positions of all gamma-ray interactions in the array. This information is then utilized, together with the characteristics of Compton scattering and pair-production processes, to track the scattering sequences of the gamma rays. GRETINA construction is completed in
Materials testing by computerized tomography with neutrons and gamma-rays
Energy Technology Data Exchange (ETDEWEB)
El-Ghobary, A M; Bakkoush, F A; Megahid, R M [Reactor and Neutron Physics Department, Nuclear Research Center, A.E.A., Cairo (Egypt)
1997-12-31
The method of computerized tomography by fast neutrons and gamma-rays are used for inspecting and testing of materials by non-destructive technique. The transmission technique was applied using narrow collimated beams of reactor neutrons and gamma-ray. The neutron and gamma-rays transmitted through the object inspection were measured by means of a neutron gamma detector with Ne - 213 liquid organic scintillator. The undesired pulses of neutrons or gamma-rays are rejected from the transmitted beam by a discrimination technique based on the difference in the decay part of light pulse produced by recoil electrons or recoil protons. The transmitted neutrons or gamma-rays for different projections used to get the image of the section through the object investigated using the method of filtered back projection (FBP) algorithm. 8 figs.
Gamma-Ray Pulsars Models and Predictions
Harding, A K
2001-01-01
Pulsed emission from gamma-ray pulsars originates inside the magnetosphere, from radiation by charged particles accelerated near the magnetic poles or in the outer gaps. In polar cap models, the high energy spectrum is cut off by magnetic pair production above an energy that is dependent on the local magnetic field strength. While most young pulsars with surface fields in the range B = 10^{12} - 10^{13} G are expected to have high energy cutoffs around several GeV, the gamma-ray spectra of old pulsars having lower surface fields may extend to 50 GeV. Although the gamma-ray emission of older pulsars is weaker, detecting pulsed emission at high energies from nearby sources would be an important confirmation of polar cap models. Outer gap models predict more gradual high-energy turnovers at around 10 GeV, but also predict an inverse Compton component extending to TeV energies. Detection of pulsed TeV emission, which would not survive attenuation at the polar caps, is thus an important test of outer gap models. N...
$\\gamma$-Ray Pulsars: Emission Zones and Viewing Geometries
Romani, Roger W.; Yadigaroglu, I. -A.
1994-01-01
There are now a half dozen young pulsars detected in high energy photons by the Compton GRO, showing a variety of emission efficiencies and pulse profiles. We present here a calculation of the pattern of high energy emission on the sky in a model which posits $\\gamma$-ray production by charge depleted gaps in the outer magnetosphere. This model accounts for the radio to $\\gamma$-ray pulse offsets of the known pulsars, as well as the shape of the high energy pulse profiles. We also show that $...
Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cannon, A.; Cesarini, A.;
2012-01-01
Observations of radio halos and relics in galaxy clusters indicate efficient electron acceleration. Protons should likewise be accelerated and, on account of weak energy losses, can accumulate, suggesting that clusters may also be sources of very high energy (VHE; E greater than100 GeV) gamma-ray emission. We report here on VHE gamma-ray observations of the Coma galaxy cluster with the VERITAS array of imaging Cerenkov telescopes, with complementing Fermi Large Area Telescope observations at GeV energies. No significant gamma-ray emission from the Coma Cluster was detected. Integral flux upper limits at the 99 confidence level were measured to be on the order of (2-5) x 10(sup -8) photons m(sup -2) s(sup -1) (VERITAS,greater than 220 GeV) and approximately 2 x 10(sup -6) photons m(sup -2) s(sup -1) (Fermi, 1-3 GeV), respectively. We use the gamma-ray upper limits to constrain cosmic rays (CRs) and magnetic fields in Coma. Using an analytical approach, the CR-to-thermal pressure ratio is constrained to be less than 16% from VERITAS data and less than 1.7% from Fermi data (averaged within the virial radius). These upper limits are starting to constrain the CR physics in self-consistent cosmological cluster simulations and cap the maximum CR acceleration efficiency at structure formation shocks to be 50. Alternatively, this may argue for non-negligible CR transport processes such as CR streaming and diffusion into the outer cluster regions. Assuming that the radio-emitting electrons of the Coma halo result from hadronic CR interactions, the observations imply a lower limit on the central magnetic field in Coma of approximately (2-5.5)microG, depending on the radial magnetic field profile and on the gamma-ray spectral index. Since these values are below those inferred by Faraday rotation measurements in Coma (for most of the parameter space), this renders the hadronic model a very plausible explanation of the Coma radio halo. Finally, since galaxy clusters are dark
Gamma-ray Burst X-ray Flares Light Curve Fitting
Aubain, Jonisha
2018-01-01
Gamma Ray Bursts (GRBs) are the most luminous explosions in the Universe. These electromagnetic explosions produce jets demonstrated by a short burst of prompt gamma-ray emission followed by a broadband afterglow. There are sharp increases of flux in the X-ray light curves known as flares that occurs in about 50% of the afterglows. In this study, we characterized all of the X-ray afterglows that were detected by the Swift X-ray Telescope (XRT), whether with flares or without. We fit flares to the Norris function (Norris et al. 2005) and power laws with breaks where necessary (Racusin et al. 2009). After fitting the Norris function and power laws, we search for the residual pattern detected in prompt GRB pulses (Hakkila et al. 2014, 2015, 2017), that may indicate a common signature of shock physics. If we find the same signature in flares and prompt pulses, it provides insight into what causes them, as well as, how these flares are produced.
Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst
Directory of Open Access Journals (Sweden)
Julian Sitarek
2016-09-01
Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.
International Nuclear Information System (INIS)
Ozel, M.E.; Mayer-Hasselwander, H.
1985-01-01
This paper discusses the bootstrap scheme which fits well for many astronomical applications. It is based on the well-known sampling plan called ''sampling with replacement''. Digital computers make the method very practical for the investigation of various trends present in a limited set of data which is usually a small fraction of the total population. The authors attempt to apply the method and demonstrate its feasibility. The study indicates that the discrete nature of high energy gamma-ray data makes the bootstrap method especially attractive for gamma-ray astronomy. Present analysis shows that the ratio of pulse strengths is variable with a 99.8% confidence
International Nuclear Information System (INIS)
Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.
2010-01-01
We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.
The Extragalactic Background Light and the Gamma-ray Opacity of the Universe
Dwek, Eli; Krennrich, Frank
2012-01-01
The extragalactic background light (EBL) is one of the fundamental observational quantities in cosmology. All energy releases from resolved and unresolved extragalactic sources, and the light from any truly diffuse background, excluding the cosmic microwave background (CMB), contribute to its intensity and spectral energy distribution. It therefore plays a crucial role in cosmological tests for the formation and evolution of stellar objects and galaxies, and for setting limits on exotic energy releases in the universe. The EBL also plays an important role in the propagation of very high energy gamma-rays which are attenuated en route to Earth by pair producing gamma-gamma interactions with the EBL and CMB. The EBL affects the spectrum of the sources, predominantly blazars, in the approx 10 GeV to 10 TeV energy regime. Knowledge of the EBL intensity and spectrum will allow the determination of the intrinsic blazar spectrum in a crucial energy regime that can be used to test particle acceleration mechanisms and VHE gamma-ray production models. Conversely, knowledge of the intrinsic gamma-ray spectrum and the detection of blazars at increasingly higher redshifts will set strong limits on the EBL and its evolution. This paper reviews the latest developments in the determination of the EBL and its impact on the current understanding of the origin and production mechanisms of gamma-rays in blazars, and on energy releases in the universe. The review concludes with a summary and future directions in Cherenkov Telescope Array techniques and in infrared ground-based and space observatories that will greatly improve our knowledge of the EBL and the origin and production of very high energy gamma-rays.
Overview of high intensity x-ray and gamma-ray sources
International Nuclear Information System (INIS)
Prestwich, K.R.; Lee, J.R.; Ramirez, J.J.; Sanford, T.W.L.; Agee, F.J.; Frazier, G.B.; Miller, A.R.
1987-01-01
The requirements for intense x-ray and gamma-ray sources to simulate the radiation effects from nuclear weapons has led to the development of several types of terawatt-pulsed power systems. One example of a major gamma-ray source is Aurora, a 10-MV, 1.6-MA, 120-ns four-module, electron-beam generator. Recent requirements to improve the dose rate has led to the Aurora upgrade program and to the development of the 20-MV, 800-kA, 40-ns Hermes-III electron-beam accelerator. The Aurora program includes improvements to the pulsed power system and research on techniques to improve the pulse shape of the electron beam. Hermes III will feature twenty 1-MV, 800-kA induction accelerator cavities supplying energy to a magnetically insulated transmission line adder. Hermes III will become operational in 1988. Intense x-ray sources consist of pulsed power systems that operate with 1-MV to 2-MV output voltages and up to 25-TW output powers. These high powers are achieved with either low impedance electron-beam generators or multimodular pulsed power systems. The low-impedance generators have high voltage Marx generators that store the energy and then sequentially transfer this energy to pulse-forming transmission lines with lower and lower impedance until the high currents are reached. In the multimode machines, each module produces 0.7-TW to 4-TW output pulses, and all of the modules are connected together to supply energy to a single diode
Very high-energy gamma-ray signature of ultrahigh-energy cosmic-ray acceleration in Centaurus A
Joshi, Jagdish C.; Miranda, Luis Salvador; Razzaque, Soebur; Yang, Lili
2018-04-01
The association of at least a dozen ultrahigh-energy cosmic-ray (UHECR) events with energy ≳ 55 EeV detected by the Pierre Auger Observatory (PAO) from the direction of Centaurus-A, the nearest radio galaxy, supports the scenario of UHECR acceleration in the jets of radio galaxies. In this work, we model radio to very high energy (VHE,≳ 100 GeV) γ-ray emission from Cen A, including GeV hardness detected by Fermi-LAT and TeV emission detected by HESS. We consider two scenarios: (i) Two zone synchrotron self-Compton (SSC) and external-Compton (EC) models, (ii) Two zone SSC, EC and photo-hadronic emission from cosmic ray interactions. The GeV hardness observed by Fermi-LAT can be explained using these two scenarios, where zone 2 EC emission is very important. Hadronic emission in scenario (ii) can explain VHE data with the same spectral slope as obtained through fitting UHECRs from Cen A. The peak luminosity in cosmic ray proton at 1 TeV, to explain the VHE γ-ray data is ≈2.5 × 1046 erg/s. The bolometric luminosity in cosmic ray protons is consistent with the luminosity required to explain the origin of 13 UHECR signal events that are correlated with Cen A.
Neutron-gamma discrimination based on pulse shape discrimination in a Ce:LiCaAlF{sub 6} scintillator
Energy Technology Data Exchange (ETDEWEB)
Yamazaki, Atsushi, E-mail: a-yamazaki@nucl.nagoya-u.ac.jp [Department of Materials, Physics and Energy Engineering, Graduate School of Engineering, Nagoya University (Japan); Watanabe, Kenichi; Uritani, Akira [Department of Materials, Physics and Energy Engineering, Graduate School of Engineering, Nagoya University (Japan); Iguchi, Tetsuo [Department of Quantum Engineering, Graduate School of Engineering, Nagoya University (Japan); Kawaguchi, Noriaki [Tokuyama Corporation (Japan); Yanagida, Takayuki; Fujimoto, Yutaka; Yokota, Yuui; Kamada, Kei [Institute of Multidisciplinary Research for Advanced Materials (IMRAM), Tohoku University (Japan); Fukuda, Kentaro; Suyama, Toshihisa [Tokuyama Corporation (Japan); Yoshikawa, Akira [Institute of Multidisciplinary Research for Advanced Materials (IMRAM), Tohoku University (Japan); New Industry Creation Hatchery Center (NICHe), Tohoku University (Japan)
2011-10-01
We demonstrate neutron-gamma discrimination based on a pulse shape discrimination method in a Ce:LiCAF scintillator. We have tried neutron-gamma discrimination using a difference in the pulse shape or the decay time of the scintillation light pulse. The decay time is converted into the rise time through an integrating circuit. A {sup 252}Cf enclosed in a polyethylene container is used as the source of thermal neutrons and prompt gamma-rays. Obvious separation of neutron and gamma-ray events is achieved using the information of the rise time of the scintillation light pulse. In the separated neutron spectrum, the gamma-ray events are effectively suppressed with little loss of neutron events. The pulse shape discrimination is confirmed to be useful to detect neutrons with the Ce:LiCAF scintillator under an intense high-energy gamma-ray condition.
A gamma-ray discriminating neutron scintillator
International Nuclear Information System (INIS)
Eschbach, P.A.; Miller, S.D.; Cole, M.C.
1994-01-01
A neutron scintillator has been developed at Pacific Northwest Laboratory which responds directly to as little as 10 mrem/hour dose equivalent rate fast neutron fields. The scintillator is composed of CaF 2 :Eu or of NaI grains within a silicone rubber or polystyrene matrix, respectively. Neutrons colliding with the plastic matrix provide knockon protons, which in turn deposit energy within the grains of phosphor to produce pulses of light. Neutron interactions are discriminated from gamma-ray events on the basis of pulse height. Unlike NE-213 liquid scintillators, this solid scintillator requires no pulseshape discrimination and therefore requires less hardware. Neutron events are anywhere from two to three times larger than the gamma-ray exposures are compared to 0.7 MeV gamma-ray exposures. The CaF 2 :Eu/silicone rubber scintillator is nearly optically transparent, and can be made into a very sizable detector (4 cm x 1.5 cm) without degrading pulse height. This CaF 2 :Eu scintillator has been observed to have an absolute efficiency of 0.1% when exposed to 5-MeV accelerator-generated neutrons (where the absolute efficiency is the ratio of observed neutron events divided by the number of fast neutrons striking the detector)
Energy Technology Data Exchange (ETDEWEB)
Hillert, Andreas
2014-07-24
The H.E.S.S. experiment, with its high sensitivity and large field-of-view, is an ideal instrument to survey the Milky Way in VHE γ-rays. An accurate reconstruction of the γ-ray direction as well as a strong reduction of the hadronic background is essential for the analysis of the data. In this work a reconstruction algorithm is developed that applies a fit of pixel amplitudes to an expected image obtained from a Gamma Ray Air Shower Parameterisation (GRASP). This parameterisation was obtained using Monte Carlo air shower simulations by parameterising the angular Cherenkov photon distribution with suitable analytical functions. Furthermore, it provides new classifying variables to differentiate γ-ray induced air showers from hadronic ones. The reconstruction of air shower parameters is achieved by a maximum likelihood fit and improves the angular resolution by 20-30% with respect to traditional image moment analysis methods. In combination with a MVA-based background rejection method using these new classifying variables the sensitivity can be improved by about 70%. An analysis of the Pulsar Wind Nebula MSH 15-5-2 and investigation of its morphology and spectral properties show an indication of energy dependent morphology in VHE γ-rays.
Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L
2015-01-01
PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.
Pulsed neutron gama ray logging for minerals associated with uranium
International Nuclear Information System (INIS)
Jensen, D.H.; Humphreys, D.R.; Stephenson, W.A.; Weinlein, J.H.; Bivens, H.M.
1980-01-01
The tool uses a pulsed neutron generator to irradiate the nuclei in the formation surrounding the borehole, and N type, high purity, germanium detector to observe the returning gamma rays. The presence or absence of particular elements, in conjunction with information gained from other logs, is expected to predict the location of uranium deposits away from the borehole. The Proof of Principle probe has been assembled. Tests have been run using an external power supply with a resolution better than 2.6 keV. Experiments in a simulated borehole configuration with a pulsed neutron generator have established an output level of 1 x 10 5 neutrons/pulse for the detection of inelastic, capture, and activation gamma rays. Gating of the ADC was shown to improve the signal-to-noise ratio for specific gamma ray lines
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Baring, Matthew G.; /Rice U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle; Caliandro, G.A.; /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /NASA, Goddard /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Bari U. /INFN, Bari /Ecole Polytechnique /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Trieste /Hiroshima U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..
2009-05-15
Radio pulsar PSR J1028-5819 was recently discovered in a high-frequency search (at 3.1 GHz) in the error circle of the Energetic Gamma-Ray Experiment Telescope (EGRET) source 3EG J1027-5817. The spin-down power of this young pulsar is great enough to make it very likely the counterpart for the EGRET source. We report here the discovery of {gamma}-ray pulsations from PSR J1028-5819 in early observations by the Large Area Telescope (LAT) on the Fermi Gamma-Ray Space Telescope. The {gamma}-ray light curve shows two sharp peaks having phase separation of 0.460 {+-} 0.004, trailing the very narrow radio pulse by 0.200 {+-} 0.003 in phase, very similar to that of other known {gamma}-ray pulsars. The measured {gamma}-ray flux gives an efficiency for the pulsar of {approx}10-20% (for outer magnetosphere beam models). No evidence of a surrounding pulsar wind nebula is seen in the current Fermi data but limits on associated emission are weak because the source lies in a crowded region with high background emission. However, the improved angular resolution afforded by the LAT enables the disentanglement of the previous COS-B and EGRET source detections into at least two distinct sources, one of which is now identified as PSR J1028-5819.
Energy Technology Data Exchange (ETDEWEB)
Fernandes, Milton Virgilio
2014-09-15
In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the
International Nuclear Information System (INIS)
Fernandes, Milton Virgilio
2014-09-01
In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the
An extremely bright gamma-ray pulsar in the Large Magellanic Cloud.
2015-11-13
Pulsars are rapidly spinning, highly magnetized neutron stars, created in the gravitational collapse of massive stars. We report the detection of pulsed giga-electron volt gamma rays from the young pulsar PSR J0540-6919 in the Large Magellanic Cloud, a satellite galaxy of the Milky Way. This is the first gamma-ray pulsar detected in another galaxy. It has the most luminous pulsed gamma-ray emission yet observed, exceeding the Crab pulsar's by a factor of 20. PSR J0540-6919 presents an extreme test case for understanding the structure and evolution of neutron star magnetospheres. Copyright © 2015, American Association for the Advancement of Science.
A Search for bursts of TeV gamma rays with Milagro
Smith, A. J.; MILAGRO Collaboration
2001-08-01
The Very High Energy (VHE, E > 100 GeV) component of Gamma-Ray Bursts (GRBs) remains unmeasured, despite the fact that models predict that the spectrum of GRBs extends beyond 1 TeV. Satellite detectors capable of observing GRBs lack the sensitivity to detect γ-rays with energies greater than ≈ 30 GeV due to their small effective area. Air ˇCerenkov telescopes, capable of detecting TeV point sources with excellent sensitivity have limited sensitivity to GRBs due to their small fields of view and limited duty cycles. The detection of TeV emission from GRBs is further complicated by the attenuation of VHE photons by interaction with the intergalactic infrared radiation. This process limits the horizon for TeV observations of GRBs to z pond (4800 m2 ) instrumented with an array of photo-multiplier tubes. Milagro operates 24 hours a day and continuously observes the entire overhead sky (≈2 sr). Because of its wide field of view and high duty cycle Milagro is uniquely capable of searching for TeV emission from GRBs. An efficient algorithm has been developed to search the Milagro data for GRBs with durations from 250 microseconds to 40s. The search, while designed to search for the TeV component of GRBs, may also be sensitive to the evaporation of primordial black holes, or some other yet undiscovered phenomenon. The results of this search are presented.
CENTRAL ENGINE MEMORY OF GAMMA-RAY BURSTS AND SOFT GAMMA-RAY REPEATERS
International Nuclear Information System (INIS)
Zhang, Bin-Bin; Castro-Tirado, Alberto J.; Zhang, Bing
2016-01-01
Gamma-ray bursts (GRBs) are bursts of γ-rays generated from relativistic jets launched from catastrophic events such as massive star core collapse or binary compact star coalescence. Previous studies suggested that GRB emission is erratic, with no noticeable memory in the central engine. Here we report a discovery that similar light curve patterns exist within individual bursts for at least some GRBs. Applying the Dynamic Time Warping method, we show that similarity of light curve patterns between pulses of a single burst or between the light curves of a GRB and its X-ray flare can be identified. This suggests that the central engine of at least some GRBs carries “memory” of its activities. We also show that the same technique can identify memory-like emission episodes in the flaring emission in soft gamma-ray repeaters (SGRs), which are believed to be Galactic, highly magnetized neutron stars named magnetars. Such a phenomenon challenges the standard black hole central engine models for GRBs, and suggest a common physical mechanism behind GRBs and SGRs, which points toward a magnetar central engine of GRBs
gamma. -ray. Present status and problems
Energy Technology Data Exchange (ETDEWEB)
Okudaira, K [Rikkyo Univ., Tokyo (Japan). Faculty of Science
1975-01-01
As ..gamma..-ray advances straightly through space, the study on cosmic ..gamma..-ray will give the information concerning the origin directly. However, the intensity is weak, and the avoidance of background is a serious problem. The wide-spread components were studied by OSO-3. The intensity of the galactic disc component around 100 MeV was reported as (3.4+-1.0)x10/sup -5/ photons (cm/sup 2/, radian, sec)/sup -1/ by OSO-3 and 0.2x10/sup -4/ photons (cm/sup 2/, radian sec)/sup -1/ by SAS-2, and corresponds to the calculated ..gamma.. yield from ..pi../sup 0/. The strong disc component, so-called galactic center region, has been observed, and is due to the mixture of ..gamma..-ray from ..pi../sup 0/ and inverse Compton ..gamma..-ray. A peak at 476+-24 KeV was found as well as the continuous component. Special care must be taken for the observation of isotropic component, since it is hardly distinguished from the background. It is considered that the isotropic component is due to the inverse Compton scattering of 3/sup 0/K radiation in super-galactic space and the contribution from outer galaxy. The nearest point source of ..gamma..-ray is the sun. Among the other point sources, the crab nebula is the most reliable one. The energy flux of pulse component showed the spectrum of E/sup -1/. ..gamma..-ray bursts were observed by man-made satellites Vela-5 and 6. Theoretical explanation is still incomplete regarding the bursts. (Kato, T.).
Alpha/beta(gamma ray) discrimination and spillover quantification with a BaF2 scintillator
International Nuclear Information System (INIS)
DeVol, T.A.; Fjeld, R.A.
1994-01-01
A simple pulse shape discrimination technique was used to separate alpha and beta(gamma ray) interactions in a BaF 2 scintillator. The separation was not ideal, resulting in a 5.1% spillover of alpha interactions into the beta(gamma ray) channel and 11.9% spillover of beta(gamma ray) interactions into the alpha channel for a set pulse shape discriminator. The misclassification of events was reduced by post-processing the data using either a simple analytical technique or a more complex linear least squares technique. Both techniques typically reduced the difference between the expected and calculated interaction rates to <10% when the ratio of beta(gamma ray) to alpha count rate was less than 100 : 1. ((orig.))
Janus probe, a detection system for high energy reactor gamma-ray spectrometry
International Nuclear Information System (INIS)
Gold, R.; Kaiser, B.J.
1980-03-01
In reactor environments, gamma-ray spectra are continuous and the absolute magnitude as well as the general shape of the gamma continuum are of paramount importance. Consequently, conventional methods of gamma-ray detection are not suitable for in-core gamma-ray spectrometry. To meet these specific needs, a method of continuous gamma-ray spectrometry, namely Compton Recoil Gamma-Ray Spectrometry, was developed for in-situ observations of reactor environments. A new gamma-ray detection system has been developed which extends the applicability of Compton Recoil Gamma-Ray Spectrometry up to roughly 7 MeV. This detection system is comprised of two separate Si(Li) detectors placed face-to-face. Hence this new detection system is called the Janus probe. Also shown is the block diagram of pulse processing instrumentation for the Janus probe. This new gamma probe not only extends the upper energy limit of in-core gamma-ray spectrometry, but in addition possesses other fundamental advantages
Gamma ray imager on the DIII-D tokamak
Energy Technology Data Exchange (ETDEWEB)
Pace, D. C., E-mail: pacedc@fusion.gat.com; Taussig, D.; Eidietis, N. W.; Van Zeeland, M. A.; Watkins, M. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Cooper, C. M. [Oak Ridge Associated Universities, Oak Ridge, Tennessee 37830 (United States); Hollmann, E. M. [University of California-San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Riso, V. [State University of New York-Buffalo, 12 Capen Hall, Buffalo, New York 14260-1660 (United States)
2016-04-15
A gamma ray camera is built for the DIII-D tokamak [J. Luxon, Nucl. Fusion 42, 614 (2002)] that provides spatial localization and energy resolution of gamma flux by combining a lead pinhole camera with custom-built detectors and optimized viewing geometry. This diagnostic system is installed on the outer midplane of the tokamak such that its 123 collimated sightlines extend across the tokamak radius while also covering most of the vertical extent of the plasma volume. A set of 30 bismuth germanate detectors can be secured in any of the available sightlines, allowing for customizable coverage in experiments with runaway electrons in the energy range of 1–60 MeV. Commissioning of the gamma ray imager includes the quantification of electromagnetic noise sources in the tokamak machine hall and a measurement of the energy spectrum of background gamma radiation. First measurements of gamma rays coming from the plasma provide a suitable testbed for implementing pulse height analysis that provides the energy of detected gamma photons.
H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.
2010-02-01
Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.
Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes
International Nuclear Information System (INIS)
Mirzoyan, R.
2000-01-01
The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV
Detection of gamma rays using scintillation optical fibers
International Nuclear Information System (INIS)
Park, J. W.; Hong, S. B.
2002-01-01
Scintillating optical fibers have several advantages over other conventional materials used for radiation detection. We have used glass and plastic scintillating fibers to detect gamma rays emitted from 60 Co and 137 Cs, and beta rays from 90 Sr. The sensors are constructed of single strand or multi-strand fibers of 1 mm diameter. The glass scintillating fiber used contains cerium-activated lithium-silicate as scintillating material and the plastic scintillating fiber used is Bicron model BCF-12. In this paper, we report the pulse-height spectra obtained by both sensor types, and analyze them in the aspect of their usability for radiation detectors. Our investigation suggests that the glass fiber can be used to develop gamma ray detectors which will function in high and low gamma ray flux environments. Use of the sensor for the beta ray detection was not satisfactory. The plastic fiber sensor did not work satisfactorily for the weak gamma sources, but did produce somewhat promising results. The scintillating plastic fiber offers some feasibility as beta ray sensor material
Scanning of Cargo Containers by Gamma-Ray and Fast Neutron Radiography
International Nuclear Information System (INIS)
Yousri, A.M.; Bashter, I.I.; Megahid, M.R.; Osman, A.M.; Kansouh, W.A.; Reda, A.M.
2011-01-01
This paper describes the combined systems which were installed and tested to detect contraband smuggled in cargo containers. These combined systems are based on radiographers work by gamma-rays emitted from point source 60 Co with 0.5 Ci activity and neutrons emitted from point isotopic sources of Pu-α-Be as well as 14 MeV neutrons emitted from sealed tube neutron generator. The transmitted gamma ray through the inspected object was measured by gamma detection system with NaI(Tl) detector while the transmitted fast neutron beam was measured by a neutron gamma detection system with stilbene organic scintillator. The later possess the capability of discrimination between between gamma and neutron pulses using a discrimination system based on pulse shape discrimination method. The measured intensities of primary incident and transmitted beams of gamma-rays and fast neutrons were used to construct 2D cross-sectional images of the inspected objects hidden directly within benign materials of the container and for object screened by high dense material to stop object detection by gamma or X-rays. The constructed images for the inspected objects show the good capability and effectiveness of the installed gamma and neutron radiographers to detect illicit materials hidden in air cargo containers and sea containers of med size. They have also indicated that the developed scanning systems possess the ease of mobility and low cost of scanning
Miniature gamma-ray camera for tumor localization
International Nuclear Information System (INIS)
Lund, J.C.; Olsen, R.W.; James, R.B.; Cross, E.
1997-08-01
The overall goal of this LDRD project was to develop technology for a miniature gamma-ray camera for use in nuclear medicine. The camera will meet a need of the medical community for an improved means to image radio-pharmaceuticals in the body. In addition, this technology-with only slight modifications-should prove useful in applications requiring the monitoring and verification of special nuclear materials (SNMs). Utilization of the good energy resolution of mercuric iodide and cadmium zinc telluride detectors provides a means for rejecting scattered gamma-rays and improving the isotopic selectivity in gamma-ray images. The first year of this project involved fabrication and testing of a monolithic mercuric iodide and cadmium zinc telluride detector arrays and appropriate collimators/apertures. The second year of the program involved integration of the front-end detector module, pulse processing electronics, computer, software, and display
Technology Development for AGIS (Advanced Gamma-ray Imaging System).
Krennrich, Frank
2008-04-01
Next-generation arrays of atmospheric Cherenkov telescopes are at the conceptual planning stage and each could consist of on the order of 100 telescopes. The two currently-discussed projects AGIS in the US and CTA in Europe, have the potential to achieve an order of magnitude better sensitivity for Very High Energy (VHE) gamma-ray observations over state-to-the-art observatories. These projects require a substantial increase in scale from existing 4-telescope arrays such as VERITAS and HESS. The optimization of a large array requires exploring cost reduction and research and development for the individual elements while maximizing their performance as an array. In this context, the technology development program for AGIS will be discussed. This includes developing new optical designs, evaluating new types of photodetectors, developing fast trigger systems, integrating fast digitizers into highly-pixilated cameras, and reliability engineering of the individual components.
Energy Technology Data Exchange (ETDEWEB)
Abdo, A.A.; /Naval Research Lab, Wash., D.C. /Federal City Coll.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U. /Stockholm U., OKC; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Baring, M.G.; /Rice U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U. /Stockholm U., OKC /INFN, Trieste /Bari U. /INFN, Bari /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Montpellier U. /Bari U. /INFN, Bari /INFN, Trieste /Arecibo Observ. /Hiroshima U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Bari U. /INFN, Bari /INFN, Bari /NASA, Goddard /Maryland U. /INFN, Perugia /Perugia U.; /more authors..
2012-03-29
We report the detection of {gamma}-ray pulsations ({ge}0.1 GeV) from PSR J2229+6114 and PSR J1048-5832, the latter having been detected as a low-significance pulsar by EGRET. Data in the {gamma}-ray band were acquired by the Large Area Telescope (LAT) aboard the Fermi Gamma-ray Space Telescope, while the radio rotational ephemerides used to fold the {gamma}-ray light curves were obtained using the Green Bank Telescope, the Lovell telescope at Jodrell Bank, and the Parkes Telescope. The two young radio pulsars, located within the error circles of the previously unidentified EGRET sources 3EG J1048-5840 and 3EG J2227+6122, present spin-down characteristics similar to the Vela pulsar. PSR J1048-5832 shows two sharp peaks at phases 0.15 {+-} 0.01 and 0.57 {+-} 0.01 relative to the radio pulse confirming the EGRET light curve, while PSR J2229+6114 presents a very broad peak at phase 0.49 {+-} 0.01. The {gamma}-ray spectra above 0.1 GeV of both pulsars are fit with power laws having exponential cutoffs near 3 GeV, leading to integral photon fluxes of (2.19 {+-} 0.22 {+-} 0.32) x 10{sup -7} cm{sup -2} s{sup -1} for PSR J1048-5832 and (3.77 {+-} 0.22 {+-} 0.44) x 10{sup -7} cm{sup -2} s{sup -1} for PSR J2229+6114. The first uncertainty is statistical and the second is systematic. PSR J1048-5832 is one of the two LAT sources which were entangled together as 3EG J1048-5840. These detections add to the growing number of young {gamma}-ray pulsars that make up the dominant population of GeV {gamma}-ray sources in the Galactic plane.
Energy Technology Data Exchange (ETDEWEB)
Andola, Sanjay; Niranjan, Ram [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kaushik, T.C., E-mail: tckk@barc.gov.in [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Rout, R.K. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kumar, Ashwani; Paranjape, D.B.; Kumar, Pradeep; Tomar, B.S.; Ramakumar, K.L. [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Gupta, S.C. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)
2014-07-01
A pulsed neutron source based on plasma focus device has been used for active interrogation and assay of {sup 235}U by monitoring its delayed high energy γ-rays. The method involves irradiation of fissile material by thermal neutrons obtained after moderation of a burst of neutrons emitted upon fusion of deuterium in plasma focus (PF) device. The delayed gamma rays emitted from the fissile material as a consequence of induced fission were detected by a large volume sodium iodide (NaI(Tl)) detector. The detector is coupled to a data acquisition system of 2k input size with 2k ADC conversion gain. Counting was carried out in pulse height analysis mode for time integrated counts up to 100 s while the temporal profile of delayed gamma has been obtained by counting in multichannel scaling mode with dwell time of 50 ms. To avoid the effect of passive (natural) and active (from surrounding materials) backgrounds, counts have been acquired for gamma energy between 3 and 10 MeV. The lower limit of detection of {sup 235}U in the oxide samples with this set-up is estimated to be 14 mg.
Firestone, Richard B; Reijonen, Jani
2014-05-27
An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.
HETEROGENEITY IN SHORT GAMMA-RAY BURSTS
International Nuclear Information System (INIS)
Norris, Jay P.; Gehrels, Neil; Scargle, Jeffrey D.
2011-01-01
We analyze the Swift/BAT sample of short gamma-ray bursts, using an objective Bayesian Block procedure to extract temporal descriptors of the bursts' initial pulse complexes (IPCs). The sample is comprised of 12 and 41 bursts with and without extended emission (EE) components, respectively. IPCs of non-EE bursts are dominated by single pulse structures, while EE bursts tend to have two or more pulse structures. The medians of characteristic timescales-durations, pulse structure widths, and peak intervals-for EE bursts are factors of ∼2-3 longer than for non-EE bursts. A trend previously reported by Hakkila and colleagues unifying long and short bursts-the anti-correlation of pulse intensity and width-continues in the two short burst groups, with non-EE bursts extending to more intense, narrower pulses. In addition, we find that preceding and succeeding pulse intensities are anti-correlated with pulse interval. We also examine the short burst X-ray afterglows as observed by the Swift/X-Ray Telescope (XRT). The median flux of the initial XRT detections for EE bursts (∼6x10 -10 erg cm -2 s -1 ) is ∼>20x brighter than for non-EE bursts, and the median X-ray afterglow duration for EE bursts (∼60,000 s) is ∼30x longer than for non-EE bursts. The tendency for EE bursts toward longer prompt-emission timescales and higher initial X-ray afterglow fluxes implies larger energy injections powering the afterglows. The longer-lasting X-ray afterglows of EE bursts may suggest that a significant fraction explode into denser environments than non-EE bursts, or that the sometimes-dominant EE component efficiently powers the afterglow. Combined, these results favor different progenitors for EE and non-EE short bursts.
A method for synthesizing response functions of NaI detectors to gamma rays
International Nuclear Information System (INIS)
Sie, S.H.
1978-08-01
A simple method of parametrizing the response function of NaI detectors to gamma rays is described, based on decomposition of the pulse-height spectrum into components associated with the actual detection processes. Smooth dependence of the derived parameters on the gamma-ray energy made it possible to generate a lineshape for any gamma-ray energy by suitable interpolation techniques. The method is applied in analysis of spectra measured with a 7.6 x 7.6 cm NaI detector in continuum gamma-ray study following (HI,xn) reaction
Operations manual for the megachannel gamma-ray coincidence system
International Nuclear Information System (INIS)
Ruhter, W.
1977-01-01
To aid in the study of nuclear structures, a megachannel pulse-height coincidence analysis system on a PDP-8 computer was constructed. The system digitizes the energies of coincident gamma-rays and stores the resultant information on a moving-head disk. The system uses a minicomputer to sort and store gamma-gamma coincident information on line. The megachannel system and how to use it are described
The Dawn of Nuclear Photonics with Laser-based Gamma-rays
International Nuclear Information System (INIS)
Barty, C.J.
2011-01-01
A renaissance in nuclear physics is occurring around the world because of a new kind of incredibly bright, gamma-ray light source that can be created with short pulse lasers and energetic electron beams. These highly Mono-Energetic Gamma-ray (MEGa-ray) sources produce narrow, laser-like beams of incoherent, tunable gamma-rays and are enabling access and manipulation of the nucleus of the atom with photons or so called 'Nuclear Photonics'. Just as in the early days of the laser when photon manipulation of the valence electron structure of the atom became possible and enabling to new applications and science, nuclear photonics with laser-based gamma-ray sources promises both to open up wide areas of practical isotope-related, materials applications and to enable new discovery-class nuclear science. In the United States, the development of high brightness and high flux MEGa-ray sources is being actively pursued at the Lawrence Livermore National Laboratory in Livermore (LLNL), California near San Francisco. The LLNL work aims to create by 2013 a machine that will advance the state of the art with respect to source the peak brightness by 6 orders of magnitude. This machine will create beams of 1 to 2.3 MeV photons with color purity matching that of common lasers. In Europe a similar but higher photon energy gamma source has been included as part of the core capability that will be established at the Extreme Light Infrastructure Nuclear Physics (ELI-NP) facility in Magurele, Romania outside of Bucharest. This machine is expected to have an end point gamma energy in the range of 13 MeV. The machine will be co-located with two world-class, 10 Petawatt laser systems thus allowing combined intense-laser and gamma-ray interaction experiments. Such capability will be unique in the world. In this talk, Dr. Chris Barty from LLNL will review the state of the art with respect to MEGa-ray source design, construction and experiments and will describe both the ongoing projects
Wu, J.; Clark, C. J.; Pletsch, H. J.; Guillemot, L.; Johnson, T. J.; Torne, P.; Champion, D. J.; Deneva, J.; Ray, P. S.; Salvetti, D.; Kramer, M.; Aulbert, C.; Beer, C.; Bhattacharyya, B.; Bock, O.; Camilo, F.; Cognard, I.; Cuéllar, A.; Eggenstein, H. B.; Fehrmann, H.; Ferrara, E. C.; Kerr, M.; Machenschalk, B.; Ransom, S. M.; Sanpa-Arsa, S.; Wood, K.
2018-02-01
We report on the analysis of 13 gamma-ray pulsars discovered in the Einstein@Home blind search survey using Fermi Large Area Telescope (LAT) Pass 8 data. The 13 new gamma-ray pulsars were discovered by searching 118 unassociated LAT sources from the third LAT source catalog (3FGL), selected using the Gaussian Mixture Model machine-learning algorithm on the basis of their gamma-ray emission properties being suggestive of pulsar magnetospheric emission. The new gamma-ray pulsars have pulse profiles and spectral properties similar to those of previously detected young gamma-ray pulsars. Follow-up radio observations have revealed faint radio pulsations from two of the newly discovered pulsars and enabled us to derive upper limits on the radio emission from the others, demonstrating that they are likely radio-quiet gamma-ray pulsars. We also present results from modeling the gamma-ray pulse profiles and radio profiles, if available, using different geometric emission models of pulsars. The high discovery rate of this survey, despite the increasing difficulty of blind pulsar searches in gamma rays, suggests that new systematic surveys such as presented in this article should be continued when new LAT source catalogs become available.
Separation of gamma and hadron initiated air showers with energies between 20 and 500 TeV
Energy Technology Data Exchange (ETDEWEB)
Arqueros, F. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Karle, A. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Lorenz, E. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Martinez, S. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Plaga, R. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Rozanska, M. [Institute of Nuclear Physics, Cracow (Poland)
1994-04-24
The discrimination between air showers initiated by {gamma} rays and by hadrons is one of the fundamental problems in experimental cosmic-ray physics. The physics of this `{gamma}/hadron separation` is discussed in this paper. We restrict ourselves to the energy range from about 20 to 500 TeV, and take only the information contained in the lateral Cerenkov light distribution and the number of electrons at the detector level into consideration. An understanding of the differences between air showers generated by {gamma} rays and those due to hadrons leads us to formulate suitable observables for the separation process. Angle integrating Cerenkov arrays (AICA) offer a promising new approach to ground-based {gamma}-ray astronomy in the energy region from about 20 to 500 TeV. In order to establish this technique, an efficient suppression of the overwhelming hadronic background radiation is required. As an example for our general discussion, we present one method for {gamma}/hadron separation in AICAs called ``LES``. It is based on the simultaneous determination of the shower size and some characteristic parameters of the lateral distribution of the Cerenkov light. The potential inherent within this technique is demonstrated in quantitative detail for the existing ``AIROBICC`` AICA. We also propose an objective measure of the intrinsic sensitivity of a detection scheme in ground-based {gamma}-ray astronomy, the ``reduced quality factor``. It is shown that AICAs may reach a sensitivity to {gamma}-ray point sources in the high VHE range similar to that of the Cerenkov-telescope imaging technique in the low VHE region. (orig.)
Gamma-ray Emission from Globular Clusters
Directory of Open Access Journals (Sweden)
Pak-Hin T. Tam
2016-03-01
Full Text Available Over the last few years, the data obtained using the Large Area Telescope (LAT aboard the Fermi Gamma-ray Space Telescope has provided new insights on high-energy processes in globular clusters, particularly those involving compact objects such as MilliSecond Pulsars (MSPs. Gamma-ray emission in the 100 MeV to 10 GeV range has been detected from more than a dozen globular clusters in our galaxy, including 47 Tucanae and Terzan 5. Based on a sample of known gammaray globular clusters, the empirical relations between gamma-ray luminosity and properties of globular clusters such as their stellar encounter rate, metallicity, and possible optical and infrared photon energy densities, have been derived. The measured gamma-ray spectra are generally described by a power law with a cut-off at a few gigaelectronvolts. Together with the detection of pulsed γ-rays from two MSPs in two different globular clusters, such spectral signature lends support to the hypothesis that γ-rays from globular clusters represent collective curvature emission from magnetospheres of MSPs in the clusters. Alternative models, involving Inverse-Compton (IC emission of relativistic electrons that are accelerated close to MSPs or pulsar wind nebula shocks, have also been suggested. Observations at >100 GeV by using Fermi/LAT and atmospheric Cherenkov telescopes such as H.E.S.S.-II, MAGIC-II, VERITAS, and CTA will help to settle some questions unanswered by current data.
Multi-messenger Light Curves from Gamma-Ray Bursts in the Internal Shock Model
Energy Technology Data Exchange (ETDEWEB)
Bustamante, Mauricio [Center for Cosmology and AstroParticle Physics (CCAPP), The Ohio State University, Columbus, OH 43210 (United States); Heinze, Jonas; Winter, Walter [Deutsches Elektronen-Synchrotron (DESY), Platanenallee 6, D-15738 Zeuthen (Germany); Murase, Kohta, E-mail: bustamanteramirez.1@osu.edu, E-mail: walter.winter@desy.de, E-mail: jonas.heinze@desy.de, E-mail: murase@psu.edu [Center for Particle and Gravitational Astrophysics, The Pennsylvania State University, University Park, PA16802 (United States)
2017-03-01
Gamma-ray bursts (GRBs) are promising as sources of neutrinos and cosmic rays. In the internal shock scenario, blobs of plasma emitted from a central engine collide within a relativistic jet and form shocks, leading to particle acceleration and emission. Motivated by present experimental constraints and sensitivities, we improve the predictions of particle emission by investigating time-dependent effects from multiple shocks. We produce synthetic light curves with different variability timescales that stem from properties of the central engine. For individual GRBs, qualitative conclusions about model parameters, neutrino production efficiency, and delays in high-energy gamma-rays can be deduced from inspection of the gamma-ray light curves. GRBs with fast time variability without additional prominent pulse structure tend to be efficient neutrino emitters, whereas GRBs with fast variability modulated by a broad pulse structure can be inefficient neutrino emitters and produce delayed high-energy gamma-ray signals. Our results can be applied to quantitative tests of the GRB origin of ultra-high-energy cosmic rays, and have the potential to impact current and future multi-messenger searches.
Multi-messenger light curves from gamma-ray bursts in the internal shock model
Energy Technology Data Exchange (ETDEWEB)
Bustamante, Mauricio [Ohio State Univ., Columbus, OH (United States). Center for Cosmology and AstroParticle Physics (CCAPP); Ohio State Univ., Columbus, OH (United States). Dept. of Physics; Murase, Kohta [Pennsylvania State Univ., University Park, PA (United States). Center for Particle and Gravitational Astrophysics; Pennsylvania State Univ., University Park, PA (United States). Dept. of Astronomy and Astrophysics; Winter, Walter [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)
2016-06-15
Gamma-ray bursts (GRBs) are promising as sources of neutrinos and cosmic rays. In the internal shock scenario, blobs of plasma emitted from a central engine collide within a relativistic jet and form shocks, leading to particle acceleration and emission. Motivated by present experimental constraints and sensitivities, we improve the predictions of particle emission by investigating time-dependent effects from multiple shocks. We produce synthetic light curves with different variability timescales that stem from properties of the central engine. For individual GRBs, qualitative conclusions about model parameters, neutrino production efficiency, and delays in high-energy gamma rays can be deduced from inspection of the gamma-ray light curves. GRBs with fast time variability without additional prominent pulse structure tend to be efficient neutrino emitters, whereas GRBs with fast variability modulated by a broad pulse structure tend to be inefficient neutrino emitters and produce delayed high-energy gamma-ray signals. Our results can be applied to quantitative tests of the GRB origin of ultra-high-energy cosmic rays, and have the potential to impact current and future multi-messenger searches.
Measurements of keV-neutron capture {gamma} rays of fission products. 3
Energy Technology Data Exchange (ETDEWEB)
Igashira, Masayuki [Tokyo Inst. of Tech. (Japan). Research Lab. for Nuclear Reactors
1997-03-01
{gamma} rays from the keV-neutron capture reactions by {sup 143,145}Nd and {sup 153}Eu have been measured in a neutron energy region of 10 to 80 keV, using a large anti-Compton NaI(Tl) {gamma}-ray spectrometer and the {sup 7}Li(p,n){sup 7}Be pulsed neutron source with a 3-MV Pelletron accelerator. The preliminary results for the capture cross sections and {gamma}-ray spectra of those nuclei are presented and discussed. (author)
Attenuation of neutrons and gamma-rays in homogeneous and multilayered shields
International Nuclear Information System (INIS)
Abdo, A.E.; Megahid, R.M.
1997-01-01
Measurements were carried-out to compare the attenuation properties of homogeneous shields and shields of two layers and three layers for fast neutrons and total gamma-rays. These were performed by measuring the fast neutron and total gamma-ray spectra behind homogeneous shields of magnetite-limonite, ilmenite-ilmenite and magnetite-magnetite concretes. The two layers assembly consists of iron and one of the above mentioned concretes, while the three layers shield consists of water, iron and one of the previously mentioned concretes. All measurements were carried-out using a neutron-gamma spectrometer with stilbene scintillator coupled to a fast photo multi player tube. Separation between pulses of recoil protons and recoil electrons was achieved by a pulse shape discrimination technique. 3 tabs., 10 figs., 13 refs
Heterogeneity in Short Gamma-Ray Bursts
Norris, Jay P.; Gehrels Neil; Scargle, Jeffrey D.
2011-01-01
We analyze the Swift/BAT sample of short gamma-ray bursts, using an objective Bayesian Block procedure to extract temporal descriptors of the bursts' initial pulse complexes (IPCs). The sample comprises 12 and 41 bursts with and without extended emission (EE) components, respectively. IPCs of non-EE bursts are dominated by single pulse structures, while EE bursts tend to have two or more pulse structures. The medians of characteristic timescales - durations, pulse structure widths, and peak intervals - for EE bursts are factors of approx 2-3 longer than for non-EE bursts. A trend previously reported by Hakkila and colleagues unifying long and short bursts - the anti-correlation of pulse intensity and width - continues in the two short burst groups, with non-EE bursts extending to more intense, narrower pulses. In addition we find that preceding and succeeding pulse intensities are anti-correlated with pulse interval. We also examine the short burst X-ray afterglows as observed by the Swift/XRT. The median flux of the initial XRT detections for EE bursts (approx 6 X 10(exp -10) erg / sq cm/ s) is approx > 20 x brighter than for non-EE bursts, and the median X-ray afterglow duration for EE bursts (approx 60,000 s) is approx 30 x longer than for non-EE bursts. The tendency for EE bursts toward longer prompt-emission timescales and higher initial X-ray afterglow fluxes implies larger energy injections powering the afterglows. The longer-lasting X-ray afterglows of EE bursts may suggest that a significant fraction explode into more dense environments than non-EE bursts, or that the sometimes-dominant EE component efficiently p()wers the afterglow. Combined, these results favor different progenitors for EE and non-EE short bursts.
Pocket PC-based portable gamma-ray spectrometer
Directory of Open Access Journals (Sweden)
Kamontip Ploykrachang
2011-04-01
Full Text Available A portable gamma-ray spectrometer based on a Pocket PC has been developed. A 12-bit pipeline analog-to-digitalconverter (ADC associated with an implemented pulse height histogram function on field programmable gate array (FPGAoperating at 15 MHz is employed for pulse height analysis from built-in pulse amplifier. The system, which interfaces withthe Pocket PC via an enhanced RS-232 serial port under the microcontroller facilitation, is utilized for spectrum acquisition,display and analysis. The pulse height analysis capability of the system was tested and it was found that the ADC integralnonlinearity of ±0.45% was obtained with the throughput rate at 160 kcps. The overall system performance was tested usinga PIN photodiode-CsI(Tl crystal coupled scintillation detector and gamma standard radioactive sources of Cs-137 andCo-60. Low cost and the compact system size as a result of the implemented logical function are also discussed.
Observations of the highest energy gamma-rays from gamma-ray bursts
International Nuclear Information System (INIS)
Dingus, Brenda L.
2001-01-01
EGRET has extended the highest energy observations of gamma-ray bursts to GeV gamma rays. Such high energies imply the fireball that is radiating the gamma-rays has a bulk Lorentz factor of several hundred. However, EGRET only detected a few gamma-ray bursts. GLAST will likely detect several hundred bursts and may extend the maximum energy to a few 100 GeV. Meanwhile new ground based detectors with sensitivity to gamma-ray bursts are beginning operation, and one recently reported evidence for TeV emission from a burst
International Nuclear Information System (INIS)
Vo, D.T.; Russo, P.A.; Sampson, T.E.
1998-03-01
Safeguards isotopic measurements require the best spectrometer systems with excellent resolution, stability and throughput. Up until about a year ago, gamma ray spectroscopy has always been done using the analog amplifier, which processes the pulses from the preamplifier to remove the noise, reject the pile up signals, and shape the signals into some desirable form before sending them to the analog to digital converter (ADC) to be digitized. In late 1996, EG and G Ortec introduced a digital gamma ray spectrometer (DSPec) which uses digital technology to analyze the preamplifiers' pulses from all types of germanium and silicon detectors. Considering its performance, digital based spectroscopy may become the way of future gamma ray spectroscopy
International Nuclear Information System (INIS)
Rajput, M.U.
2007-01-01
Random coincidence summing of gamma rays is a potential source of errors in gamma ray spectrometry. The effect has a little significance at low counting rates but becomes increasingly important at high counting rates. Careful corrections are required to avoid the introduction of errors in quantitative based measurements. Several correction methods have been proposed. The most common is the pulser method that requires a precision Pulse Generator in the electronic circuitry to provide reference peak. In this work, a comparative study has been carried out both by using pulser method and utilizing radioactive source based method. This study makes the use of 137 Cs radionuclide as a fixed source and the 241 Am as a varied source. The dead time of the system has been varied and the acquisition of the spectra at each position yielded the resulted peak areas with pulsed pile up losses. The linear regression of the data has been carried out. The study has resulted in establishing a consistent factor that can be used as the characteristic of the detector and thereby removes the need of the calibrated or precise Pulse Generator. (author)
Gamma-ray tracking: Characterisation of the AGATA symmetric prototype detectors
International Nuclear Information System (INIS)
Boston, A.J.; Boston, H.C.; Cresswell, J.R.; Dimmock, M.R.; Nelson, L.; Nolan, P.J.; Rigby, S.; Lazarus, I.; Simpson, J.; Medina, P.; Santos, C.; Parisel, C.
2007-01-01
Each major technical advance in gamma-ray detection devices has resulted in significant new insights into the structure of atomic nuclei. The next major step in gamma-ray spectroscopy involves achieving the goal of a 4pi ball of Germanium detectors by using the technique of gamma-ray energy tracking in electrically segmented Germanium crystals. The resulting spectrometer will have an unparalleled level of detection power for nuclear electromagnetic radiation. Collaborations have been established in Europe (AGATA) [J. Simpson, Acta Phys. Pol. B 36 (2005) 1383. ] and the USA (GRETA/GRETINA) to build gamma-ray tracking spectrometers. This paper discusses the performance of the AGATA (Advanced Gamma Tracking Array) symmetric prototype detectors that have been tested at University of Liverpool. The use of a fully digital data acquisition system has allowed detector charge pulse shapes from a selection of well defined photon interaction positions to be analysed, yielding important information on the position sensitivity of the detector
Gamma-ray tracking: Characterisation of the AGATA symmetric prototype detectors
Energy Technology Data Exchange (ETDEWEB)
Boston, A.J. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom)]. E-mail: ajboston@liv.ac.uk; Boston, H.C. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Cresswell, J.R. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Dimmock, M.R. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Nelson, L. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Nolan, P.J. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Rigby, S. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Lazarus, I. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Simpson, J. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Medina, P. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France); Santos, C. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France); Parisel, C. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France)
2007-08-15
Each major technical advance in gamma-ray detection devices has resulted in significant new insights into the structure of atomic nuclei. The next major step in gamma-ray spectroscopy involves achieving the goal of a 4pi ball of Germanium detectors by using the technique of gamma-ray energy tracking in electrically segmented Germanium crystals. The resulting spectrometer will have an unparalleled level of detection power for nuclear electromagnetic radiation. Collaborations have been established in Europe (AGATA) [J. Simpson, Acta Phys. Pol. B 36 (2005) 1383. ] and the USA (GRETA/GRETINA) to build gamma-ray tracking spectrometers. This paper discusses the performance of the AGATA (Advanced Gamma Tracking Array) symmetric prototype detectors that have been tested at University of Liverpool. The use of a fully digital data acquisition system has allowed detector charge pulse shapes from a selection of well defined photon interaction positions to be analysed, yielding important information on the position sensitivity of the detector.
THE SECOND FERMI LARGE AREA TELESCOPE CATALOG OF GAMMA-RAY PULSARS
Energy Technology Data Exchange (ETDEWEB)
Abdo, A. A. [Center for Earth Observing and Space Research, College of Science, George Mason University, Fairfax, VA 22030 (United States); Ajello, M. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Allafort, A.; Bloom, E. D.; Bottacini, E. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Baldini, L. [Università di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Baring, M. G. [Rice University, Department of Physics and Astronomy, MS-108, P.O. Box 1892, Houston, TX 77251 (United States); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Belfiore, A. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Bellazzini, R.; Bregeon, J. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bhattacharyya, B. [National Centre for Radio Astrophysics, Tata Institute of Fundamental Research, Pune 411 007 (India); Bissaldi, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, and Università di Trieste, I-34127 Trieste (Italy); Bonamente, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Perugia, I-06123 Perugia (Italy); Brandt, T. J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brigida, M., E-mail: hartog@stanford.edu [Dipartimento di Fisica ' ' M. Merlin' ' dell' Università e del Politecnico di Bari, I-70126 Bari (Italy); and others
2013-10-01
This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.
The second FERMI large area telescope catalog of gamma-ray pulsars
Energy Technology Data Exchange (ETDEWEB)
Abdo, A. A.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; Belfiore, A.; Bellazzini, R.; Bhattacharyya, B.; Bissaldi, E.; Bloom, E. D.; Bonamente, E.; Bottacini, E.; Brandt, T. J.; Bregeon, J.; Brigida, M.; Bruel, P.; Buehler, R.; Burgay, M.; Burnett, T. H.; Busetto, G.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Camilo, F.; Caraveo, P. A.; Casandjian, J. M.; Cecchi, C.; Çelik, Ö.; Charles, E.; Chaty, S.; Chaves, R. C. G.; Chekhtman, A.; Chen, A. W.; Chiang, J.; Chiaro, G.; Ciprini, S.; Claus, R.; Cognard, I.; Cohen-Tanugi, J.; Cominsky, L. R.; Conrad, J.; Cutini, S.; D' Ammando, F.; de Angelis, A.; DeCesar, M. E.; De Luca, A.; den Hartog, P. R.; de Palma, F.; Dermer, C. D.; Desvignes, G.; Digel, S. W.; Di Venere, L.; Drell, P. S.; Drlica-Wagner, A.; Dubois, R.; Dumora, D.; Espinoza, C. M.; Falletti, L.; Favuzzi, C.; Ferrara, E. C.; Focke, W. B.; Franckowiak, A.; Freire, P. C. C.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Germani, S.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gotthelf, E. V.; Grenier, I. A.; Grondin, M. -H.; Grove, J. E.; Guillemot, L.; Guiriec, S.; Hadasch, D.; Hanabata, Y.; Harding, A. K.; Hayashida, M.; Hays, E.; Hessels, J.; Hewitt, J.; Hill, A. B.; Horan, D.; Hou, X.; Hughes, R. E.; Jackson, M. S.; Janssen, G. H.; Jogler, T.; Jóhannesson, G.; Johnson, R. P.; Johnson, A. S.; Johnson, T. J.; Johnson, W. N.; Johnston, S.; Kamae, T.; Kataoka, J.; Keith, M.; Kerr, M.; Knödlseder, J.; Kramer, M.; Kuss, M.; Lande, J.; Larsson, S.; Latronico, L.; Lemoine-Goumard, M.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Lyne, A. G.; Manchester, R. N.; Marelli, M.; Massaro, F.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; McLaughlin, M. A.; Mehault, J.; Michelson, P. F.; Mignani, R. P.; Mitthumsiri, W.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Morselli, A.; Moskalenko, I. V.; Murgia, S.; Nakamori, T.; Nemmen, R.; Nuss, E.; Ohno, M.; Ohsugi, T.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Panetta, J. H.; Parent, D.; Perkins, J. S.; Pesce-Rollins, M.; Pierbattista, M.; Piron, F.; Pivato, G.; Pletsch, H. J.; Porter, T. A.; Possenti, A.; Rainò, S.; Rando, R.; Ransom, S. M.; Ray, P. S.; Razzano, M.; Rea, N.; Reimer, A.; Reimer, O.; Renault, N.; Reposeur, T.; Ritz, S.; Romani, R. W.; Roth, M.; Rousseau, R.; Roy, J.; Ruan, J.; Sartori, A.; Saz Parkinson, P. M.; Scargle, J. D.; Schulz, A.; Sgrò, C.; Shannon, R.; Siskind, E. J.; Smith, D. A.; Spandre, G.; Spinelli, P.; Stappers, B. W.; Strong, A. W.; Suson, D. J.; Takahashi, H.; Thayer, J. G.; Thayer, J. B.; Theureau, G.; Thompson, D. J.; Thorsett, S. E.; Tibaldo, L.; Tibolla, O.; Tinivella, M.; Torres, D. F.; Tosti, G.; Troja, E.; Uchiyama, Y.; Usher, T. L.; Vandenbroucke, J.; Vasileiou, V.; Venter, C.; Vianello, G.; Vitale, V.; Wang, N.; Weltevrede, P.; Winer, B. L.; Wolff, M. T.; Wood, D. L.; Wood, K. S.; Wood, M.; Yang, Z.
2013-09-19
This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.
The second fermi large area telescope catalog of gamma-ray pulsars
Energy Technology Data Exchange (ETDEWEB)
Abdo, A. A.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; Belfiore, A.; Bellazzini, R.; Bhattacharyya, B.; Bissaldi, E.; Bloom, E. D.; Bonamente, E.; Bottacini, E.; Brandt, T. J.; Bregeon, J.; Brigida, M.; Bruel, P.; Buehler, R.; Burgay, M.; Burnett, T. H.; Busetto, G.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Camilo, F.; Caraveo, P. A.; Casandjian, J. M.; Cecchi, C.; Çelik, Ö.; Charles, E.; Chaty, S.; Chaves, R. C. G.; Chekhtman, A.; Chen, A. W.; Chiang, J.; Chiaro, G.; Ciprini, S.; Claus, R.; Cognard, I.; Cohen-Tanugi, J.; Cominsky, L. R.; Conrad, J.; Cutini, S.; D' Ammando, F.; de Angelis, A.; DeCesar, M. E.; De Luca, A.; den Hartog, P. R.; de Palma, F.; Dermer, C. D.; Desvignes, G.; Digel, S. W.; Di Venere, L.; Drell, P. S.; Drlica-Wagner, A.; Dubois, R.; Dumora, D.; Espinoza, C. M.; Falletti, L.; Favuzzi, C.; Ferrara, E. C.; Focke, W. B.; Franckowiak, A.; Freire, P. C. C.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Germani, S.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gotthelf, E. V.; Grenier, I. A.; Grondin, M. -H.; Grove, J. E.; Guillemot, L.; Guiriec, S.; Hadasch, D.; Hanabata, Y.; Harding, A. K.; Hayashida, M.; Hays, E.; Hessels, J.; Hewitt, J.; Hill, A. B.; Horan, D.; Hou, X.; Hughes, R. E.; Jackson, M. S.; Janssen, G. H.; Jogler, T.; Jóhannesson, G.; Johnson, R. P.; Johnson, A. S.; Johnson, T. J.; Johnson, W. N.; Johnston, S.; Kamae, T.; Kataoka, J.; Keith, M.; Kerr, M.; Knödlseder, J.; Kramer, M.; Kuss, M.; Lande, J.; Larsson, S.; Latronico, L.; Lemoine-Goumard, M.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Lyne, A. G.; Manchester, R. N.; Marelli, M.; Massaro, F.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; McLaughlin, M. A.; Mehault, J.; Michelson, P. F.; Mignani, R. P.; Mitthumsiri, W.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Morselli, A.; Moskalenko, I. V.; Murgia, S.; Nakamori, T.; Nemmen, R.; Nuss, E.; Ohno, M.; Ohsugi, T.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Panetta, J. H.; Parent, D.; Perkins, J. S.; Pesce-Rollins, M.; Pierbattista, M.; Piron, F.; Pivato, G.; Pletsch, H. J.; Porter, T. A.; Possenti, A.; Rainò, S.; Rando, R.; Ransom, S. M.; Ray, P. S.; Razzano, M.; Rea, N.; Reimer, A.; Reimer, O.; Renault, N.; Reposeur, T.; Ritz, S.; Romani, R. W.; Roth, M.; Rousseau, R.; Roy, J.; Ruan, J.; Sartori, A.; Saz Parkinson, P. M.; Scargle, J. D.; Schulz, A.; Sgrò, C.; Shannon, R.; Siskind, E. J.; Smith, D. A.; Spandre, G.; Spinelli, P.; Stappers, B. W.; Strong, A. W.; Suson, D. J.; Takahashi, H.; Thayer, J. G.; Thayer, J. B.; Theureau, G.; Thompson, D. J.; Thorsett, S. E.; Tibaldo, L.; Tibolla, O.; Tinivella, M.; Torres, D. F.; Tosti, G.; Troja, E.; Uchiyama, Y.; Usher, T. L.; Vandenbroucke, J.; Vasileiou, V.; Venter, C.; Vianello, G.; Vitale, V.; Wang, N.; Weltevrede, P.; Winer, B. L.; Wolff, M. T.; Wood, D. L.; Wood, K. S.; Wood, M.; Yang, Z.
2013-09-19
This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.
Programs for the automatic gamma-ray measurement with CANBERRA 8100/QUANTA system
International Nuclear Information System (INIS)
Yoshida, Hiroshi; Sakai, Eiji; Kubo, Katsumi.
1982-07-01
Some programs have been prepared for the automatic operation of the CANBERRA 8100/QUANTA System for the gamma-ray spectrum measurement. The main parts of these programs are: (1) to collect and record on magnetic disks the data of gamma-ray spectra automatically, while the recorded data are analyzed to estimate the nuclides which generate photopeaks of spectra and to calculate those concentrations; (2) to draw plotted diagrams of pulse height distributions of gamma-ray spectra data and other data by the additional digital plotter; and etc. (author)
EBL Inhomogeneity and Hard-Spectrum Gamma-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
Abdalla, Hassan; Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa)
2017-02-01
The unexpectedly hard very-high-energy (VHE; E > 100 GeV) γ -ray spectra of a few distant blazars have been interpreted as evidence of a reduction of the γγ opacity of the universe due to the interaction of VHE γ -rays with the extragalactic background light (EBL) compared to the expectation from current knowledge of the density and cosmological evolution of the EBL. One of the suggested solutions to this problem involves the inhomogeneity of the EBL. In this paper, we study the effects of such inhomogeneity on the energy density of the EBL (which then also becomes anisotropic) and the resulting γγ opacity. Specifically, we investigate the effects of cosmic voids along the line of sight to a distant blazar. We find that the effect of such voids on the γγ opacity, for any realistic void size, is only of the order of ≲1% and much smaller than expected from a simple linear scaling of the γγ opacity with the line-of-sight galaxy underdensity due to a cosmic void.
The 2017 Periastron Passage of PSR B1259-63 in Gamma-rays and X-rays
Wood, Kent S.; Johnson, Tyrel; Ray, Paul S.; Kerr, Matthew T.; Chernyakova, Masha; Fermi LAT Collaboration
2018-01-01
PSR B1259‑ 63 is a 48-ms radio pulsar in a highly eccentric 3.4-yr orbit with a Be star LS 2883. While the pulsed emission has been detected only in radio, un-pulsed radio, X-ray and gamma-ray emission are regularly observed from the binary system around the periastron. It is likely that the collision of the pulsar wind with the anisotropic wind of the Be star plays a crucial role in the generation of the observed non-thermal emission. The spectral energy distribution observed near periastron peaks in GeV gamma-rays, reaching maximum flux several weeks past periastron. In September 2017 it is being observed for a third periastron passage by the Fermi satellite. Here we present first results of the 2017 multi-wavelength campaign. The 2017 observations are compared to the two previous cycles, and used to test current models. Until recently there was no similar source known in the Galaxy but now a near-twin to it, PSR J2032+4127 , (Pspin=143 ms, Porbit ~50 yr, detectable radio to gamma rays) has been found, and is also undergoing periastron passage in Nov 2017. Gamma-ray and X-ray phenomena in the two sources are compared and discussed. These objects may represent a transitional phase, with possible later phases being accreting pulsars, and eventually perhaps NS-BH or NS-NS binary systems. Portions of this research performed at the US Naval Research Laboratory are sponsored by NASA DPR S-15633-Y.
Relation between gamma-ray emission, radio bursts, and proton fluxes from solar flares
International Nuclear Information System (INIS)
Fomichev, V.V.; Chertok, I.M.
1985-01-01
Data on solar gamma-ray flares, including 24 flares with gamma-ray lines, recorded up to June 1982, are analyzed. It is shown that from the point of view of radio emission the differences between flares with and without gamma-ray lines has a purely quantitative character: the former are accompanied by the most intense microwave bursts. Meter type II bursts are not a distinctive feature of flares with gamma-ray lines. Pulsed flares, regardless of the presence or absence of gamma-ray lines, are not accompanied by significant proton fluxes at the earth. On the whole, contrary to the popular opinion in the literature, flares with gamma-ray lines do not display a deficit of proton flux in interplanetary space in comparison with similar flares without gamma-ray lines. The results of quantitative diagnostics of proton flares based on radio bursts are not at variance with the presence of flares without detectable gamma-ray emission in lines but with a pronounced increase in the proton flux at the earth. 23 references
Precision linac and laser technologies for nuclear photonics gamma-ray sources
Energy Technology Data Exchange (ETDEWEB)
Albert, F.; Hartemann, F. V.; Anderson, S. G.; Cross, R. R.; Gibson, D. J.; Hall, J.; Marsh, R. A.; Messerly, M.; Wu, S. S.; Siders, C. W.; Barty, C. P. J. [Lawrence Livermore National Laboratory, NIF and Photon Science, 7000 East Avenue, Livermore, California 94550 (United States)
2012-05-15
Tunable, high precision gamma-ray sources are under development to enable nuclear photonics, an emerging field of research. This paper focuses on the technological and theoretical challenges related to precision Compton scattering gamma-ray sources. In this scheme, incident laser photons are scattered and Doppler upshifted by a high brightness electron beam to generate tunable and highly collimated gamma-ray pulses. The electron and laser beam parameters can be optimized to achieve the spectral brightness and narrow bandwidth required by nuclear photonics applications. A description of the design of the next generation precision gamma-ray source currently under construction at Lawrence Livermore National Laboratory is presented, along with the underlying motivations. Within this context, high-gradient X-band technology, used in conjunction with fiber-based photocathode drive laser and diode pumped solid-state interaction laser technologies, will be shown to offer optimal performance for high gamma-ray spectral flux, narrow bandwidth applications.
Arons, Jonathan
electric current that separate regions of differing magnetization into the domain of highly relativistic magnetic fields - those with energy density large compared to the rest mass energy of the charged particles - the plasma - caught in that field. The investigators will create theoretical and computational models of the magnetic dissipation - a form of viscous flow in the thin sheets of electric current that form in the magnetized regions around the rotating stars - using Particle in-Cell plasma simulations. These simulations use a large computer to solve the equations of motion of many charged particles - millions to billions in the research that will be pursued - to unravel the dissipation of those fields and the acceleration of beams of particles in the thin sheets. The results will be incorporated into macroscopic MHD models of the magnetic structures around the stars which determine the location and strength of the current sheets, so as to model and analyze the pulsed gamma ray emission seen from hundreds of Rotation Powered Pulsars. The computational models will be assisted by ``pencil and paper'' theoretical modeling designed to motivate and interpret the computer simulations, and connect them to the observations.
Detection of 16 Gamma-Ray Pulsars Through Blind Frequency Searches Using the Fermi LAT
International Nuclear Information System (INIS)
Anderson, B.; Atwood, W.B.; Dormody, M.; Johnson, R.P.; Porter, T.A.; Primack, J.R.; Sadrozinski, H.F.W.; Parkinson, P.M.S.; Ziegler, M.; Abdo, A.A.; Dermer, C.D.; Grove, J.E.; Gwon, C.; Johnson, W.N.; Lovellette, M.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wolff, M.T.; Wood, K.S.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Funk, S.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Axelsson, M.; Conrad, J.; Meurer, C.; Ryde, F.; Ylinen, T.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Spandre, G.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Pierbattista, M.; Starck, J.L.
2009-01-01
Pulsars are rapidly rotating, highly magnetized neutron stars emitting radiation across the electromagnetic spectrum. Although there are more than 1800 known radio pulsars, until recently only seven were observed to pulse in gamma rays, and these were all discovered at other wavelengths. The Fermi Large Area Telescope (LAT) makes it possible to pinpoint neutron stars through their gamma-ray pulsations. We report the detection of 16 gamma-ray pulsars in blind frequency searches using the LAT. Most of these pulsars are coincident with previously unidentified gamma-ray sources, and many are associated with supernova remnants. Direct detection of gamma-ray pulsars enables studies of emission mechanisms, population statistics, and the energetics of pulsar wind nebulae and supernova remnants. (authors)
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict
Analyzing power of AGATA triple clusters for gamma-ray linear polarization
Energy Technology Data Exchange (ETDEWEB)
Bizzeti, P.G.; Sona, P.; Melon, B.; Bizzeti-Sona, A.M.; Perego, A. [Universita di Firenze, Dipartimento di Fisica, Firenze (Italy); INFN, Firenze (Italy); Michelagnoli, C.; Lunardi, S.; Mengoni, D.; Recchia, F. [INFN, Padova (Italy); Universita di Padova, Dipartimento di Fisica, Padova (Italy); Bazzacco, D.; Farnea, E.; Menegazzo, R.; Ur, C.A. [INFN, Padova (Italy); De Angelis, G.; Gottardo, A.; Napoli, D.R.; Sahin, E.; Valiente-Dobon, J.J. [Laboratori Nazionali di Legnaro, INFN, Padova (Italy); Gadea, A. [University of Valencia, IFIC, CSIC, Valencia (Spain); Nannini, A. [INFN, Firenze (Italy)
2015-04-01
We have investigated the ability of AGATA triple clusters to measure the linear polarization of gamma rays, exploiting the azimuthal-angle dependence of the Compton scattering differential cross section. To this aim, partially polarized gamma rays have been produced by Coulomb excitation of the first excited state of {sup 104}Pd and {sup 108}Pd, which decay to the ground state by emission of gamma rays of 555.8 keV and 433.9 keV, respectively. Pulse-shape analysis and gamma-ray tracking techniques have been used to determine the position and time sequence of the interaction points inside the germanium crystals. Anisotropies in the detection efficiency have been taken into account using 661.6 keV gammas from a {sup 137}Cs radioactive source. We obtain an average analyzing power of 0.451(34) at 433.9 keV and 0.484(24) at 555.8 keV. (orig.)
X-Ray Study of Variable Gamma-Ray Pulsar PSR J2021+4026
Wang, H. H.; Takata, J.; Hu, C.-P.; Lin, L. C. C.; Zhao, J.
2018-04-01
PSR J2021+4026 showed a sudden decrease in the gamma-ray emission at the glitch that occurred around 2011 October 16, and a relaxation of the flux to the pre-glitch state at around 2014 December. We report X-ray analysis results of the data observed by XMM-Newton on 2015 December 20 in the post-relaxation state. To examine any change in the X-ray emission, we compare the properties of the pulse profiles and spectra at the low gamma-ray flux state and at the post-relaxation state. The phase-averaged spectra for both states can be well described by a power-law component plus a blackbody component. The former is dominated by unpulsed emission and probably originated from the pulsar wind nebula as reported by Hui et al. The emission property of the blackbody component is consistent with the emission from the polar cap heated by the back-flow bombardment of the high-energy electrons or positrons that were accelerated in the magnetosphere. We found no significant change in the X-ray emission properties between two states. We suggest that the change of the X-ray luminosity is at an order of ∼4%, which is difficult to measure with the current observations. We model the observed X-ray light curve with the heated polar cap emission, and we speculate that the observed large pulsed fraction is owing to asymmetric magnetospheric structure.
Qin, Zhang-jian; Chen, Chuan; Luo, Jun-song; Xie, Xing-hong; Ge, Liang-quan; Wu, Qi-fan
2018-04-01
It is a usual practice for improving spectrum quality by the mean of designing a good shaping filter to improve signal-noise ratio in development of nuclear spectroscopy. Another method is proposed in the paper based on discriminating pulse-shape and discarding the bad pulse whose shape is distorted as a result of abnormal noise, unusual ballistic deficit or bad pulse pile-up. An Exponentially Decaying Pulse (EDP) generated in nuclear particle detectors can be transformed into a Mexican Hat Wavelet Pulse (MHWP) and the derivation process of the transform is given. After the transform is performed, the baseline drift is removed in the new MHWP. Moreover, the MHWP-shape can be discriminated with the three parameters: the time difference between the two minima of the MHWP, and the two ratios which are from the amplitude of the two minima respectively divided by the amplitude of the maximum in the MHWP. A new type of nuclear spectroscopy was implemented based on the new digital shaping filter and the Gamma-ray spectra were acquired with a variety of pulse-shape discrimination levels. It had manifested that the energy resolution and the peak-Compton ratio were both improved after the pulse-shape discrimination method was used.
International Nuclear Information System (INIS)
Currie, G.D.; Marshall, M.
1989-03-01
The feasibility of developing a computer program suitable for evaluating the pulse-height spectrum in a gamma-ray detector from a complex geometry source has been examined. A selection of relevant programs, Monte Carlo radiation transport codes, have been identified and their applicability to this study discussed. It is proposed that the computation be performed in two parts: the evaluation of the photon fluence at the detector using a photon transport code, and calculation of the pulse-height distribution from this spectrum using response functions determined with an electron-photon transport code. The two transport codes selected to perform this procedure are MCNP (Monte Carlo Neutron Photon code), and EGS4 (Electron Gamma Shower code). (Author)
Energy Technology Data Exchange (ETDEWEB)
Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..
2012-04-05
We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.
Pulsed neutron logging system for inelastic scattering gamma rays with gain compensation
International Nuclear Information System (INIS)
Schultz, W.E.; Smith, H.D. Jr.
1976-01-01
An illustrative embodiment of the invention includes methods for linearizing the gain of borehole gamma ray energy measurement apparatus. A known energy peak (or peaks) which is prominent in the gamma ray energy spectra of borehole measurements is monitored and any drift in its apparent location in the energy spectrum is used to generate an error voltage. The error voltage is applied in an inverse feedback manner to control the gain of system amplifiers to cancel the drift
Gamma-ray lasing by free nuclei and by matter-antimatter beams
International Nuclear Information System (INIS)
Rivlin, L.A.
1997-01-01
I discuss the possibilities to induce the gamma-ray emission departing from attempts to use the Moessbauer effect. Three separate approaches are considered: (A) Stimulated radiative transitions in deeply cooled nuclear beams with hidden inversion; (B) external two-photon ignition of nuclear lasing accompanied by gamma-ray giant pulse emission; and (C) burst-like radiative annihilation of relativistic beams of electrons and positrons or parapositronium atoms ignited by an external beam of soft photons
Discovery of Hard Nonthermal Pulsed X-Ray Emission from the Anomalous X-Ray Pulsar 1E 1841-045
Kuiper, L.; Hermsen, W.; Méndez, R.M.
2004-01-01
We report the discovery of nonthermal pulsed X-ray/soft gamma-ray emission up to ~150 keV from the anomalous 11.8 s X-ray pulsar AXP 1E 1841-045 located near the center of supernova remnant Kes 73 using Rossi X-Ray Timing Explorer (RXTE) Proportional Counter Array and High Energy X-Ray Timing
International Nuclear Information System (INIS)
Peng, Z. Y.; Ma, L.; Yin, Y.; Zhao, X. H.; Fang, L. M.; Bao, Y. Y.
2009-01-01
Employing two samples containing of 56 and 59 well-separated fast rise and exponential decay gamma-ray burst pulses whose spectra are fitted by the Band spectrum and Compton model, respectively, we have investigated the evolutionary slope of E p (where E p is the peak energy in the νFν spectrum) with time during the pulse decay phase. The bursts in the samples were observed by the Burst and Transient Source Experiment on the Compton Gamma Ray Observatory. We first test the E p evolutionary slope during the pulse decay phase predicted by Lu et al. based on the model of highly symmetric expanding fireballs in which the curvature effect of the expanding fireball surface is the key factor concerned. It is found that the evolutionary slopes are normally distributed for both samples and concentrated around the values of 0.73 and 0.76 for Band and Compton model, respectively, which is in good agreement with the theoretical expectation of Lu et al.. However, the inconsistency with their results is that the intrinsic spectra of most of bursts may bear the Comptonized or thermal synchrotron spectrum, rather than the Band spectrum. The relationships between the evolutionary slope and the spectral parameters are also checked. We show that the slope is correlated with E p of time-integrated spectra as well as the photon flux but anticorrelated with the lower energy index α. In addition, a correlation between the slope and the intrinsic E p derived by using the pseudo-redshift is also identified. The mechanisms of these correlations are unclear currently and the theoretical interpretations are required.
A gamma-ray spectrometer system for fusion applications
Esposito, B; Kaschuck, Y A; Martin-Solis, J R; Portnov, D V
2002-01-01
A NaI scintillator spectrometer system for the measurement of gamma-ray spectra in tokamak discharges has been developed and installed on the Frascati Tokamak Upgrade. Two NaI scintillators are viewing the plasma at two different angles with respect to the equatorial plane. The main features of the spectrometer system (energy range: 0.3-23 MeV) and of the unfolding technique used to restore physical spectra from the pulse-height distributions are described: a method of solution with regularisation for matrix equations of large size, allowing to process count distributions with significant statistical noise, has been developed. A dedicated software, portable to any platform, has been written both for the acquisition and the analysis of the spectra. The typical gamma-ray spectra recorded in hydrogen and deuterium discharges, also with additional heating, are presented and discussed; two components have been observed: (a) thick-target Bremsstrahlung gamma-rays produced by runaway electrons hitting the Inconel po...
Are we observing Lorentz violation in gamma ray bursts?
International Nuclear Information System (INIS)
Pavlopoulos, Theodore G.
2005-01-01
From recent observations of gamma-ray bursts (GRBs), it appears that spectral time lags between higher-energy gamma rays photons and lower-energy photons vary with energy difference and time (distance) traveled. These lags appear to be smaller for the most luminous (close) bursts but larger for the fainter (farther away) bursts. From this observation, it has been suggested that it might be possible to determine the distance (L) these bursts have traveled from these time lags alone, without performing any red-shift measurements. These observed spreads (dispersion) of high-energy electromagnetic pulses of different energies with time contradict the special theory of relativity (STR). However, extended theories (ET) of the STR have been developed that contain a dispersive term, predicting the above observations. An example of such an ET is presented, allowing us to derive a relationship between time lags of gamma rays of different energies and distance L traveled from their origin. In addition, this theory predicts the origin of X-ray flashes
X-RAY PULSATIONS FROM THE RADIO-QUIET GAMMA-RAY PULSAR IN CTA 1
International Nuclear Information System (INIS)
Caraveo, P. A.; De Luca, A.; Marelli, M.; Bignami, G. F.; Ray, P. S.; Saz Parkinson, P. M.; Kanbach, G.
2010-01-01
Prompted by the Fermi-LAT discovery of a radio-quiet gamma-ray pulsar inside the CTA 1 supernova remnant, we obtained a 130 ks XMM-Newton observation to assess the timing behavior of this pulsar. Exploiting both the unprecedented photon harvest and the contemporary Fermi-LAT timing measurements, a 4.7σ single-peak pulsation is detected, making PSR J0007+7303 the second example, after Geminga, of a radio-quiet gamma-ray pulsar also seen to pulsate in X-rays. Phase-resolved spectroscopy shows that the off-pulse portion of the light curve is dominated by a power-law, non-thermal spectrum, while the X-ray peak emission appears to be mainly of thermal origin, probably from a polar cap heated by magnetospheric return currents, pointing to a hot spot varying throughout the pulsar rotation.
International Nuclear Information System (INIS)
Fichtel, C.E.
1975-01-01
The first certain detection of celestial high energy gamma rays came from a satellite experiment flown on the third Orbiting Solar Observatory (OSO-111). A Gamma ray spark chamber telescope with substantively greater sensitivity and angular resolution (a few degrees) flown on the second Small Astronomy Satellite (SAS-II) has now provided a better picture of the gamma ray sky, and particularly the galactic plane and pulsars. This paper will summarize the present picture of gamma ray astronomy as it has developed at this conference from measurements made with experiments carried out on balloons, those remaining on the ground, and ones flown on satellites. (orig.) [de
Are 0.1%-accurate gamma-ray assays possible for 235U solutions
International Nuclear Information System (INIS)
Parker, J.L.
1983-01-01
The factors influencing the accuracy of passive gamma-ray assay of uniform, homogeneous solution samples have been studied in some detail, particularly for the assay of 235 U in uranium solutions. Factors considered are the overall long-term electronic stability, the information losses caused by the rate-related electronic processes of pulse pileup and dead-time, and the self-attenuation of gamma rays within the samples. Both experimental and computational studies indicate that gamma-ray assay procedures for solution samples of moderate size (from approx. 10 to perhaps a few hundred milliliters) are now capable of accuracies approaching 0.1% in many practical cases
International Nuclear Information System (INIS)
Phan Van Chuan; Nguyen Duc Hoa; Nguyen Xuan Hai; Nguyen Ngoc Anh; Tuong Thi Thu Huong; Nguyen Nhi Dien; Pham Dinh Khang
2016-01-01
A small detector with EJ-301 liquid scintillation was manufactured for the study on the neutron-gamma pulse shape discrimination. In this research, four algorithms, including Threshold crossing time (TCT), Pulse gradient analysis (PGA), Charge comparison method (CCM), and Correlation pattern recognition (CPR) were developed and compared in terms of their discrimination effectiveness between neutrons and gamma rays. The figures of merits (FOMs) obtained for 100 ÷ 2000 keVee (keV energy electron equivalent) neutron energy range show the charge comparison method was the most efficient of the four algorithms. (author)
Energy Technology Data Exchange (ETDEWEB)
Stinnett, Jacob [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Venkataraman, Ram [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-09-13
The objective of this training is to explain the origin of x-rays and gamma rays, gamma ray interactions with matter, detectors and electronics used in gamma ray-spectrometry, and features of a gamma-ray spectrum for nuclear material that is safeguarded.
International Nuclear Information System (INIS)
Kheymits, M D; Leonov, A A; Zverev, V G; Galper, A M; Arkhangelskaya, I V; Arkhangelskiy, A I; Yurkin, Yu T; Bakaldin, A V; Suchkov, S I; Topchiev, N P; Dalkarov, O D
2016-01-01
The GAMMA-400 gamma-ray space-based telescope has as its main goals to measure cosmic γ-ray fluxes and the electron-positron cosmic-ray component produced, theoretically, in dark-matter-particles decay or annihilation processes, to search for discrete γ-ray sources and study them in detail, to examine the energy spectra of diffuse γ-rays — both galactic and extragalactic — and to study gamma-ray bursts (GRBs) and γ-rays from the active Sun. Scientific goals of GAMMA-400 telescope require fine angular resolution. The telescope is of a pair-production type. In the converter-tracker, the incident gamma-ray photon converts into electron-positron pair in the tungsten layer and then the tracks are detected by silicon- strip position-sensitive detectors. Multiple scattering processes become a significant obstacle in the incident-gamma direction reconstruction for energies below several gigaelectronvolts. The method of utilising this process to improve the resolution is proposed in the presented work. (paper)
Lightning leader models of terrestrial gamma-ray flashes
Dwyer, J. R.; Liu, N.; Ihaddadene, K. M. A.
2017-12-01
Terrestrial gamma-ray flashes (TGFs) are bright sub-millisecond bursts of gamma rays that originate from thunderstorms. Because lightning leaders near the ground have been observed to emit x-rays, presumably due to runaway electron production in the high-field regions near the leader tips, models of TGFs have been developed by several groups that assume a similar production mechanism of runaway electrons from lightning leaders propagating through thunderclouds. However, it remains unclear exactly how and where these runaway electrons are produced, since lightning propagation at thunderstorm altitudes remains poorly understood. In addition, it is not obvious how to connect the observed behavior of the x-ray production from lightning near the ground with the properties of TGFs. For example, it is not clear how to relate the time structure of the x-ray emission near the ground to that of TGFs, since x-rays from stepped leaders near the ground are usually produced in a series of sub-microsecond bursts, but TGFs are usually observed as much longer pulses without clear substructures, at sub-microsecond timescales or otherwise. In this presentation, spacecraft observations of TGFs, ground-based observations of x-rays from lightning and laboratory sparks, and Monte Carlo and PIC simulations of runaway electron and gamma ray production and propagation will be used to constrain the lightning leader models of TGFs.
Energy Technology Data Exchange (ETDEWEB)
Ichimiya, Tsutomu [Japan Radioisotope Association, Tokyo (Japan); Narita, Tsutomu; Kitao, Kensuke
1998-03-01
A quick index to {gamma}-rays and X-rays from natural radionuclides is presented. In the list, {gamma}-rays are arranged in order of increasing energy. The list also contains {gamma}-rays from radioactive nuclides produced in a germanium detector and its surrounding materials by interaction with cosmic neutrons, as well as direct {gamma}-rays from interaction with the neutrons. Artificial radioactive nuclides emitting {gamma}-rays with same or near energy value as that of the natural {gamma}-rays and X-rays are also listed. In appendix, {gamma}-ray spectra from a rock, uranium ore, thorium, monazite and uraninite and also background spectra obtained with germanium detectors placed in iron or lead shield have been given. The list is designed for use in {gamma}-ray spectroscopy under the conditions of highly natural background, such as in-situ environmental radiation monitoring or low-level activity measurements, with a germanium detector. (author)
Neutron and gamma-ray dose-rates from the Little Boy replica
International Nuclear Information System (INIS)
Plassmann, E.A.; Pederson, R.A.
1984-01-01
We report dose-rate information obtained at many locations in the near vicinity of, and at distances out to 0.64 km from, the Little Boy replica while it was operated as a critical assembly. The measurements were made with modified conventional dosimetry instruments that used an Anderson-Braun detector for neutrons and a Geiger-Mueller tube for gamma rays with suitable electronic modules to count particle-induced pulses. Thermoluminescent dosimetry methods provide corroborative data. Our analysis gives estimates of both neutron and gamma-ray relaxation lengths in air for comparison with earlier calculations. We also show the neutron-to-gamma-ray dose ratio as a function of distance from the replica. Current experiments and further data analysis will refine these results. 7 references, 8 figures
Selective Beta and Gamma-ray Discrimination by CdWO{sub 4} and PlasticScintillator
Energy Technology Data Exchange (ETDEWEB)
Bae, Jun Woo; Kim, Hee Reyoung [Dept. of Nuclear Engineering, Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)
2017-04-15
Radiation monitoring technique has been used for monitoring of decommissioning site of nuclear facility, radioactive waste disposal site, or in case of radioactivity accident. For rapid measurement of gamma-ray and beta-ray, many portable radiation detectors were developed but they are sensitive to specific radiation type. For example, portable detectors using NaI(Tl) or high purity germanium (HPGe) are suitable to detect gamma-ray. Otherwise, Geiger-müller (GM) tube or ionization chamber are suitable to detect all-types of radiation but it is hard to determine which particle is detected in the detector. In this reason, phoswich detectors for discrimination of beta-ray and gamma-ray were developed by using pulse shape discrimination. In this study, another approach to discriminate the beta-ray and gamma-ray is carried out. Two scintillators are used, cadmium tungstate (CdWO{sub 4}) and plastic scintillator. They have huge difference in their effective atomic number and mass density, thus they have huge difference in their gamma-ray sensitivity while the sensitivity of beta-ray is similar. The characterization of beta-ray and gamma-ray discrimination by using this characteristics is include. A technique of discrimination between beta-ray and gamma-ray was suggested. The method was verified by Monte Carlo simulation and experiment. This work showed feasibility on in field measurement of radiation with discrimination of beta-ray and gamma-ray.
Liu, Juntao; Zhang, Feng; Wang, Xinguang; Han, Fei; Yuan, Zhelong
2014-12-01
Formation porosity can be determined using the boron capture gamma ray counting ratio with a near to far detector in a pulsed neutron-gamma element logging tool. The thermal neutron distribution, boron capture gamma spectroscopy and porosity response for formations with different water salinity and wellbore diameter characteristics were simulated using the Monte Carlo method. We found that a boron lining improves the signal-to-noise ratio and that the boron capture gamma ray counting ratio has a higher sensitivity for determining porosity than total capture gamma. Copyright © 2014 Elsevier Ltd. All rights reserved.
X-ray echoes from gamma-ray bursts
International Nuclear Information System (INIS)
Dermer, C.D.; Hurley, K.C.; Hartmann, D.H.
1991-01-01
The identification of an echo of reflected radiation in time histories of gamma-ray burst spectra can provide important information about the existence of binary companions or accretion disks in gamma-ray burst systems. Because of the nature of Compton scattering, the spectrum of the echo will be attenuated at gamma-ray energies compared with the spectrum of the primary burst emission. The expected temporal and spectral signatures of the echo and a search for such echoes are described, and implications for gamma-ray burst models are discussed. 35 refs
Distribution of iron and titanium on the lunar surface from lunar prospector gamma ray spectra
International Nuclear Information System (INIS)
Prettyman, T.H.; Feldman, W.C.; Lawrence, David J.; Elphic, R.C.; Gasnault, O.M.; Maurice, S.; Moore, K.R.; Binder, A.B.
2001-01-01
Gamma ray pulse height spectra acquired by the Lunar Prospector (LP) Gamma-Ray Spectrometer (GRS) contain information on the abundance of major elements in the lunar surface, including O, Si, Ti, Al, Fe, Mg, Ca, K, and Th. With the exception of Th and K, prompt gamma rays produced by cosmic ray interactions with surface materials are used to determine elemental abundance. Most of these gamma rays are produced by inelastic scattering of fast neutrons and by neutron capture. The production of neutron-induced gamma rays reaches a maximum deep below the surface (e.g. ∼140 g/cm 2 for inelastic scattering and ∼50 g/cm 2 for capture). Consequently, gamma rays sense the bulk composition of lunar materials, in contrast to optical methods (e.g. Clementine Spectral Reflectance (CSR)), which only sample the top few microns. Because most of the gamma rays are produced deep beneath the surface, few escape unscattered and the continuum of scattered gamma rays dominates the spectrum. In addition, due to the resolution of the spectrometer, there are few well-isolated peaks and peak fitting algorithms must be used to deconvolve the spectrum in order to determine the contribution of individual elements.
Method and apparatus for neutron induced gamma ray logging for lithology identificaion
International Nuclear Information System (INIS)
Oliver, D.W.; Culver, R.B.
1979-01-01
A pulsed neutron generator in a well logging instrument is pulsed at a clock frequency of 20 KHz. Inelastic scatter gamma rays are detected during a first time interval coinciding with the neutron source being on and capture gamma rays are measured during a second interval subsequent to the end of each neutron burst. Only a single detected pulse, assuming detection occurs, is transmitted during each of the two detection intervals. Sync pulses are generated in the well logging instrument scaled down to a frequency of 200 Hz for transmission to the earth's surface. At the earth's surface, the scaled-down sync pulses are applied to a phase-locked loop system for regenerating the sync pulses to the same frequency as that of the clock frequency used to pulse the neutron source and to open the detection gates in the borehole instrument. The regenerated sync pulses are used in the surface instrumentation to route the pulses occurring in the inelastic interval into one section of a multichannel analyzer memory and the pulses occurring in the capture interval into another section of the multichannel analyzer. The use of memory address decoders, subtractors and ratio circuits enables both a carbon/oxygen ratio and a silicon/calcium ratio to be struck, substantially independent of the chlorine content of the borehole and formation
Fast Fourier transformation results from gamma-ray burst profiles
Kouveliotou, Chryssa; Norris, Jay P.; Fishman, Gerald J.; Meegan, Charles A.; Wilson, Robert B.; Paciesas, W. S.
1992-01-01
Several gamma-ray bursts in the BATSE data have sufficiently long durations and complex temporal structures with pulses that appear to be spaced quasi-periodically. In order to test and quantify these periods we have applied fast Fourier transformations (FFT) to all these events. We have also performed cross spectral analyses of the FFT of the two extreme (high-low) energy bands in each case to determine the lead/lag of the pulses in different energies.
Thompson, David
2012-01-01
Gamma rays reveal extreme, nonthermal conditions in the Universe. The Fermi Gamma-ray Space Telescope has been exploring the gamma-ray sky for more than four years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge gamma-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.
Applied gamma-ray spectrometry
Dams, R; Crouthamel, Carl E
1970-01-01
Applied Gamma-Ray Spectrometry covers real life application of the gamma-ray and the devices used in their experimental studies. This book is organized into 9 chapters, and starts with discussions of the various decay processes, the possible interaction mechanisms of gamma radiation with matter, and the intrinsic and extrinsic variables, which affect the observed gamma-ray and X-ray spectra. The subsequent chapters deal with the properties and fabrication of scintillation detectors, semiconductor detectors, and proportional gas counters. These chapters present some of the most widely utilized
Collimatorless imaging of gamma rays with help of gamma-ray tracking
Marel, J V D
2001-01-01
In many gamma-ray detector systems that are built for imaging purposes Compton scattered photons are suppressed as much as possible. However, the information from photons that scattered inside a detector system can be used to reconstruct the tracks of the photons with help of gamma-ray tracking. Estimates of the incident directions of the photons can be made and an image can be created. Examples of potential applications for this technique are the use as a gamma-camera in medical imaging (e.g. SPECT) or as a detector for PET. Due to the omission of collimators, much higher detection efficiencies can be achieved, reducing the doses required for an image. A gamma-ray tracking method, called backtracking, has been developed for nuclear spectroscopy. The method tracks gamma-rays originating from a point source in the center of a spherical detector system consisting of position-sensitive germanium detectors. This method can also be used as a tracking technique for imaging of an unknown source distribution. With he...
Inhomogeneity of neutron and gamma-ray attenuation in biological shields
Energy Technology Data Exchange (ETDEWEB)
El-bakkoush, F A; El-Ghobary, A M; Megahid, R M [Reactor and Neutron physics Department, Nuclear Research Center, A.E.A., Cairo (Egypt)
1997-12-31
Measurements have been carried-out to investigate the attenuation properties of some materials which are used as biological shields around nuclear radiation sources. Investigation was performed by measuring the transmitted fast neutron and gamma-spectra through cylindrical samples of magnetite- limonite, steel and cellulose shields. The neutron and gamma spectra were measured by a neutron-gamma spectrometer with stilbene scintillator. Discrimination between neutron and gamma pulses was achieved by a discrimination method. The obtained results are displayed in the form of neutron and gamma spectra and attenuation relations which are used to derive the total macroscopic cross-sections for neutrons and total linear attenuation coefficients for gamma-rays. The values of neutron and gamma relaxation lengths are also derived for the investigated materials. 10 figs., 1 tabs.
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, Roger D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bouvier, A.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /NASA, Goddard /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Manchester U. /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..
2011-12-01
We report the discovery of {gamma}-ray pulsations ({ge}0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the {gamma}-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold {gamma}-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 {+-} 0.01 {+-} 0.01 cycles which are aligned with the X-ray peaks. The first {gamma}-ray peak trails the radio pulse by 0.08 {+-} 0.01 {+-} 0.01, while its amplitude decreases with increasing energy as for the other {gamma}-ray pulsars. Spectral analysis of the pulsed {gamma}-ray emission suggests a simple power law of index -2.1 {+-} 0.1 {+-} 0.2 with an exponential cutoff at 3.0{sub -0.7}{sup +1.1} {+-} 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral {gamma}-ray photon flux above 0.1 GeV is (13.7 {+-} 1.4 {+-} 3.0) x 10{sup -8} cm{sup -2} s{sup -1}, which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10{sup 34} erg s{sup -1} and an efficiency {eta} of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10{sup -8} cm{sup -2} s{sup -1} for off-pulse emission from the object.
Optical observations of Gamma-Ray Bursts
International Nuclear Information System (INIS)
Hjorth, J.; Pian, E.; Fynbo, J.P.U.
2004-01-01
We briefly review the status and recent progress in the field of optical observations of gamma-ray burst afterglows. We will focus on the fundamental observational evidence for the relationship between gamma-ray bursts and the final evolutionary phases of massive stars. In particular, we will address (i) gamma-ray burst host galaxies, (ii) optically dark gamma-ray burst afterglows, (iii) the gamma-ray burst-supernova connection, and (iv) the relation between X-ray flashes, gamma-ray bursts, and supernovae
Gamma-ray spectroscopy of neutron-rich products of heavy-ion collisions
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Janssens, R.V.F.; Ahmad, I. [and others
1995-08-01
Thick-target {gamma}{gamma} coincidence techniques are being used to explore the spectroscopy of otherwise hard-to-reach neutron-rich products of deep-inelastic heavy ion reactions. Extensive {gamma}{gamma} coincidence measurements were performed at ATLAS using pulsed beams of {sup 80}Se, {sup 136}Xe, and {sup 238}U on lead-backed {sup 122,124}Sn targets with energies 10-15% above the Coulomb barrier. Gamma-ray coincidence intensities were used to map out yield distributions with A and Z for even-even product nuclei around the target and around the projectile. The main features of the yield patterns are understandable in terms of N/Z equilibration. We had the most success in studying the decays of yrast isomers. Thus far, more than thirty new {mu}s isomers in the Z = 50 region were found and characterized. Making isotopic assignments for previously unknown {gamma}-ray cascades proves to be one of the biggest problems. Our assignments were based (a) on rare overlaps with radioactivity data, (b) on the relative yields with different beams, and (c) on observed cross-coincidences between {gamma} rays from light and heavy reaction partners. However, the primary products of deep inelastic collisions often are sufficiently excited for subsequent neutron evaporation, so {gamma}{gamma} cross-coincidence results require careful interpretation.
Fermi Detection of a Luminous gamma-ray Pulsar in a Globular Cluster
Freire, P. C. C.; Abdo, A. A.; Ajello, M.; Allafort, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bechtol, K.; Bellazzini, R.; Blandford, R. D.;
2011-01-01
We report the Fermi Large Area Telescope detection of gamma -ray (>100 mega-electron volts) pulsations from pulsar J1823--3021A in the globular cluster NGC 6624 with high significance (approx 7 sigma). Its gamma-ray luminosity L (sub 3) = (8:4 +/- 1:6) X 10(exp 34) ergs per second, is the highest observed for any millisecond pulsar (MSP) to date, and it accounts for most of the cluster emission. The non-detection of the cluster in the off-pulse phase implies that its contains < 32 gamma-ray MSPs, not approx 100 as previously estimated. The gamma -ray luminosity indicates that the unusually large rate of change of its period is caused by its intrinsic spin-down. This implies that J1823--3021A has the largest magnetic field and is the youngest MSP ever detected, and that such anomalous objects might be forming at rates comparable to those of the more normal MSPs.
The Gamma-ray Universe through Fermi
Thompson, David J.
2012-01-01
Gamma rays, the most powerful form of light, reveal extreme conditions in the Universe. The Fermi Gamma-ray Space Telescope and its smaller cousin AGILE have been exploring the gamma-ray sky for several years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge ga.nuna-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.
Measurement of neutron and gamma-ray production double differential cross section at KEK
International Nuclear Information System (INIS)
Ishibashi, Kenji
1995-01-01
High energy nuclear radiations were measured for 0.8-3.0 GeV proton induced reactions at KEK. The measurement was carried out to overcome the problems arising from the use of secondary beam line of a quite low incident beam intensity. Digital pulse shape discrimination method was applicable to separation between high energy neutrons and gamma-rays. By the use of a number of scintillators, cross sections were obtained for production of neutrons and gamma-rays. (author)
A new gamma ray imaging diagnostic for runaway electron studies at DIII-D
Cooper, C. M.; Pace, D. C.; Eidietis, N. W.; Paz-Soldan, C.; Commaux, N.; Shiraki, D.; Hollmann, E. M.; Moyer, R. A.; Risov, V.
2015-11-01
A new Gamma Ray Imager (GRI) is developed to probe the electron distribution function with 2D spatial resolution during runaway electron (RE) experiments at DIII-D. The diagnostic is sensitive to 0.5 - 50 MeV gamma rays, allowing characterization of the RE distribution function evolution during RE dissipation from pellet injection. The GRI consists of a lead ``pinhole camera'' mounted on the midplane with 11x11 counter-current tangential chords 20 cm wide that span the vessel. Up to 30 bismuth germanate (BGO) scintillation detectors capture RE Bremsstrahlung radiation. Detectors operate in current saturation mode at 10 MHz, or the flux is attenuated for Pulse Height Analysis (PHA) capable of discriminating up to ~10k pulses per second. Digital signal processing routines combining shaping filters are performed during PHA to reject noise and record gamma ray energy. The GRI setup and PHA algorithms will be described and initial data from experiments will be presented. Work supported by the US DOE under DE-AC05-00OR22725, DE-FG02-07ER54917 & DE-FC02-04ER54698.
FERMI-LAT DETECTION OF PULSED GAMMA-RAYS ABOVE 50 GeV FROM THE VELA PULSAR
Energy Technology Data Exchange (ETDEWEB)
Leung, Gene C. K.; Takata, J.; Ng, C. W.; Cheng, K. S. [Department of Physics, The University of Hong Kong, Pokfulam Road (Hong Kong); Kong, A. K. H.; Tam, P. H. T. [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu, Taiwan (China); Hui, C. Y., E-mail: gene930@connect.hku.hk, E-mail: takata@hku.hk [Department of Astronomy and Space Science, Chungnam National University, Daejeon (Korea, Republic of)
2014-12-20
The first Fermi-Large Area Telescope (LAT) catalog of sources above 10 GeV reported evidence of pulsed emission above 25 GeV from 12 pulsars, including the Vela pulsar, which showed evidence of pulsation at >37 GeV energy bands. Using 62 months of Fermi-LAT data, we analyzed the gamma-ray emission from the Vela pulsar and searched for pulsed emission above 50 GeV. Having confirmed the significance of the pulsation in 30-50 GeV with the H test (p-value ∼10{sup –77}), we extracted its pulse profile using the Bayesian block algorithm and compared it with the distribution of the five observed photons above 50 GeV using the likelihood ratio test. Pulsation was significantly detected for photons above 50 GeV with a p-value of =3 × 10{sup –5} (4.2σ). The detection of pulsation is significant above 4σ at >79 GeV and above 3σ at >90 GeV energy bands, making this the highest energy pulsation significantly detected by the LAT. We explore the non-stationary outer gap scenario of the very high-energy emissions from the Vela pulsar.
The rapid decline of the prompt emission in Gamma-Ray Bursts
Dado, Shlomo; De Rújula, Alvaro
2008-01-01
Many gamma ray bursts (GRBs) have been observed with the Burst-Alert and X-Ray telescopes of the SWIFT satellite. The successive `pulses' of these GRBs end with a fast decline and a fast spectral softening, until they are overtaken by another pulse, or the last pulse's decline is overtaken by a less rapidly-varying `afterglow'. The fast decline-phase has been attributed, in the standard fireball model of GRBs, to `high-latitude' synchrotron emission from a collision of two conical shells. This interpretation does not agree with the observed spectral softening. The temporal behaviour and the spectral evolution during the fast-decline phase agree with the predictions of the cannonball model of GRBs.
International Nuclear Information System (INIS)
Yanagida, Takayuki; Watanabe, Kenichi; Fujimoto, Yutaka
2015-01-01
Solid state organic scintillators, such as anthracene, stilbene, and p-terphenyl were investigated on their basic scintillation properties and neutron–gamma discrimination capabilities. Scintillation wavelengths under X-ray irradiation of anthracene, stilbene, and p-terphenyl were 445–525, 400–500, and 350–450 nm, respectively. Scintillation light yields of anthracene, stilbene, and p-terphenyl under 137 Cs gamma-ray irradiation were 20100, 16000, and 19400 ph/MeV, respectively. Neutron and gamma-ray events discrimination capabilities were examined and anthracene exhibited the best figure of merit among three organic scintillators
Energy Technology Data Exchange (ETDEWEB)
Yanagida, Takayuki, E-mail: yanagida@lsse.kyutech.ac.jp [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu, Kitakyushu, Fukuoka 808-0196 (Japan); Watanabe, Kenichi [Nagoya University, Furocho, Chikusa, Nagoya 464-8603 (Japan); Fujimoto, Yutaka [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu, Kitakyushu, Fukuoka 808-0196 (Japan)
2015-06-01
Solid state organic scintillators, such as anthracene, stilbene, and p-terphenyl were investigated on their basic scintillation properties and neutron–gamma discrimination capabilities. Scintillation wavelengths under X-ray irradiation of anthracene, stilbene, and p-terphenyl were 445–525, 400–500, and 350–450 nm, respectively. Scintillation light yields of anthracene, stilbene, and p-terphenyl under {sup 137}Cs gamma-ray irradiation were 20100, 16000, and 19400 ph/MeV, respectively. Neutron and gamma-ray events discrimination capabilities were examined and anthracene exhibited the best figure of merit among three organic scintillators.
Lunar based gamma ray astronomy
International Nuclear Information System (INIS)
Haymes, R.C.
1985-01-01
Gamma ray astronomy represents the study of the universe on the basis of the electromagnetic radiation with the highest energy. Gamma ray astronomy provides a crucial tool for the understanding of astronomical phenomena, taking into account nucleosynthesis in supernovae, black holes, active galaxies, quasars, the sources of cosmic rays, neutron stars, and matter-antimatter annihilation. Difficulties concerning the conduction of studies by gamma ray astronomy are related to the necessity to perform such studies far from earth because the atmosphere is a source of gamma rays. Studies involving the use of gamma ray instruments in earth orbit have been conducted, and more gamma ray astronomy observations are planned for the future. Imperfections of studies conducted in low earth orbit could be overcome by estalishing an observatory on the moon which represents a satellite orbiting at 60 earth radii. Details concerning such an observatory are discussed. 5 references
Energy Technology Data Exchange (ETDEWEB)
Anderson, S.G., E-mail: anderson131@llnl.gov [Lawrence Livermore National Laboratory, 7000 East Ave., Livermore, CA 94551 (United States); Albert, F.; Bayramian, A.J.; Beer, G.; Bonanno, R.E.; Cross, R.R.; Deis, G.; Ebbers, C.A.; Gibson, D.J.; Hartemann, F.V.; Houck, T.L.; Marsh, R.A.; McNabb, D.P.; Messerly, M.J.; Scarpetti, R.D.; Shverdin, M.Y.; Siders, C.W.; Wu, S.S.; Barty, C.P.J. [Lawrence Livermore National Laboratory, 7000 East Ave., Livermore, CA 94551 (United States); Adolphsen, C.E. [SLAC National Accelerator Laboratory, 2575 Sand Hill Rd., Menlo Park, CA 94025 (United States); and others
2011-11-21
The rf photoinjector and linear accelerator in the Mono-Energetic Gamma-ray (MEGa-ray) facility at LLNL is presented. This machine uses 11.4 GHz rf technology to accelerate a high-brightness electron beam up to 250 MeV to produce MeV {gamma}-rays through Compton scattering with a Joule-class laser pulse. Compton scattering-based generation of high flux, narrow bandwidth {gamma}-rays places stringent requirements on the performance of the accelerator. The component parts of the accelerator are presented and their requirements described. Simulations of expected electron beam parameters and the resulting light source properties are presented.
1991-01-01
This photograph shows the Compton Gamma-Ray Observatory (GRO) being deployed by the Remote Manipulator System (RMS) arm aboard the Space Shuttle Atlantis during the STS-37 mission in April 1991. The GRO reentered Earth atmosphere and ended its successful mission in June 2000. For nearly 9 years, the GRO Burst and Transient Source Experiment (BATSE), designed and built by the Marshall Space Flight Center (MSFC), kept an unblinking watch on the universe to alert scientists to the invisible, mysterious gamma-ray bursts that had puzzled them for decades. By studying gamma-rays from objects like black holes, pulsars, quasars, neutron stars, and other exotic objects, scientists could discover clues to the birth, evolution, and death of stars, galaxies, and the universe. The gamma-ray instrument was one of four major science instruments aboard the Compton. It consisted of eight detectors, or modules, located at each corner of the rectangular satellite to simultaneously scan the entire universe for bursts of gamma-rays ranging in duration from fractions of a second to minutes. In January 1999, the instrument, via the Internet, cued a computer-controlled telescope at Las Alamos National Laboratory in Los Alamos, New Mexico, within 20 seconds of registering a burst. With this capability, the gamma-ray experiment came to serve as a gamma-ray burst alert for the Hubble Space Telescope, the Chandra X-Ray Observatory, and major gound-based observatories around the world. Thirty-seven universities, observatories, and NASA centers in 19 states, and 11 more institutions in Europe and Russia, participated in the BATSE science program.
International Nuclear Information System (INIS)
Carroll, J. J.; Karamian, S. A.; Rivlin, L. A.; Zadernovsky, A. A.
2001-01-01
X-ray-driven gamma emission describes processes that may release nuclear energy in a 'clean' way, as bursts of incoherent or coherent gamma rays without the production of radioactive by-products. Over the past decade, studies in this area, as a part of the larger field of quantum nucleonics, have gained tremendous momentum. Since 1987 it has been established that photons could trigger gamma emission from a long-lived metastable nuclear excited state of one nuclide and it appears likely that triggering in other isotopes will be demonstrated conclusively in the near future. With these experimental results have come new proposals for the creation of collective and avalanche-like incoherent gamma-ray bursts and even for the ultimate light source, a gamma-ray laser. Obviously, many applications would benefit from controlled bursts of gamma radiation, whether coherent or not. This paper reviews the experimental results and concepts for the production of gamma rays, driven by externally produced X-rays
Detection of Primordial Magnetic Fields in TeV gamma-ray data
Wingler, A.
The analysis of the time-variable flux of γ-ray photons from extragalactic sources is currently the only proposed way to directly determine the magnetic field strengths in intergalactic space - far away from galaxies and clusters (in the cosmological "voids") - in the range below about 10,10 Gauss (Plaga 1995). Remnant magnetic fields with field strengths much below this, which may well have formed in early cosmological times, could exist in these voids. Due to their interaction with infrared photons TeV gamma-rays induce pair production in intergalactic space. The electrons and positrons are deflected by ambient magnetic fields and produce γ-rays via inverse Compton scattering that are delayed with respect to the original photons in an energy-dependent, characteristic manner. A standard method to identify these delayed events in a data sample of a source with a variable VHE γ-ray flux (as available from several Cherenkov telescope experiments for the high-emission phase of the AGN Mrk 501 in 1997) is described. Monte-Carlo simulations of existing data sets (taking into backgrounds and instrumental limitations) are used to explore how sensitive data sets similar to the existing ones are to primordial magnetic fields. We find that about 22000 (15000) events from a source with characteristics similar to Mrk 501 are needed to detect a primordial B field of 3 (10) atto Gauss (10,18 G) with a 3 significance.
Extragalactic Gamma-Ray Astrophysics
CERN. Geneva
2016-01-01
During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...
Gravitational Waves versus X and Gamma Ray Emission in a Short Gamma-Ray Burst
Oliveira, F. G.; Rueda, Jorge A.; Ruffini, Remo
2012-01-01
The recent progress in the understanding the physical nature of neutron star equilibrium configurations and the first observational evidence of a genuinely short gamma-ray burst, GRB 090227B, allows to give an estimate of the gravitational waves versus the X and Gamma-ray emission in a short gamma-ray burst.
International Nuclear Information System (INIS)
Hermsen, W.
1980-01-01
Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)
Gamma-ray relative energy response of Ce: YAG crystal
International Nuclear Information System (INIS)
Zhang Jianhua; Zhang Chuanfei; Hu Mengchun; Peng Taiping; Wang Zhentong; Tang Dengpan; Zhao Guangjun
2010-01-01
Gamma-ray relative energy response of Ce: YAG crystal, which is important for pulsed γ-ray measurement, was studied in this work.The Ce: YAG crystal, which was developed at Shanghai Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, was aligned point by point with γ-rays scattered from an industrial 60 Co line source. The γ-ray relative energy response was calculated using the mass attenuation coefficient. The results show that the numerical calculation method of γ-ray relative energy response is reliable, and the experimental method with multi-energy point γ-ray by Compton scattering is also feasible, that can be used for checking up correctness of the numerical calculation results. (authors)
Equipment for x- and gamma ray radiography
International Nuclear Information System (INIS)
Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail
2004-01-01
The following topics related to the equipment for x - and gamma ray radiography are discussed in this chapter. The topics are x-ray source for Industrial Radiography: properties of x-ray, generation of x-ray, mechanism of x-ray production, x-ray equipment, power supply, distribution of x-ray intensity along the tube: gamma ray source for Industrial Radiography: properties of gamma rays, gamma ray sources, gamma ray projectors on cameras, source changing. Care of Radiographic Equipments: Merits and Demerits of x and Gamma Rays
Gamma-ray burst polarimeter (GAP)
International Nuclear Information System (INIS)
Mihara, Tatehiro; Murakami, Toshio; Yonetoku, Daisuke; Gunji, Shuichi; Kubo, Shin
2013-01-01
The gamma-ray burst polarimeter (GAP: GAmma-ray burst Polarimeter), which had been almost handcrafted by scientists, has succeeded in working normally in interplanetary space, and in detecting the polarization of the gamma-ray from a mysterious astronomical object 'gamma-ray burst'. It is the first result of the detectors in the world exclusively aiming at detecting gamma-ray polarization. We mainly describe the hardware of our GAP equipment and show the method of preparing equipment to work in the cosmic space with a tight budget. The mechanical structure, the electronic circuits, the software on the equipment, the data analysis on the earth, and the scientific results gained by the observation just over one year, are presented after explaining the principle of gamma-ray polarization detection. Our design to protect equipment against mechanical shock and cosmic radiation may provide useful information for future preparation of compact satellite. (J.P.N.)
Ultrashort X-ray pulse science
Energy Technology Data Exchange (ETDEWEB)
Chin, Alan Hap [Univ. of California, Berkeley, CA (US). Dept. of Physics; Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
1998-05-01
A variety of phenomena involves atomic motion on the femtosecond time-scale. These phenomena have been studied using ultrashort optical pulses, which indirectly probe atomic positions through changes in optical properties. Because x-rays can more directly probe atomic positions, ultrashort x-ray pulses are better suited for the study of ultrafast structural dynamics. One approach towards generating ultrashort x-ray pulses is by 90° Thomson scattering between terawatt laser pulses and relativistic electrons. Using this technique, the author generated ~ 300 fs, 30 keV (0.4 Å) x-ray pulses. These x-ray pulses are absolutely synchronized with ultrashort laser pulses, allowing femtosecond optical pump/x-ray probe experiments to be performed. Using the right-angle Thomson scattering x-ray source, the author performed time-resolved x-ray diffraction studies of laser-perturbated InSb. These experiments revealed a delayed onset of lattice expansion. This delay is due to the energy relaxation from a dense electron-hole plasma to the lattice. The dense electron-hole plasma first undergoes Auger recombination, which reduces the carrier concentration while maintaining energy content. Longitudinal-optic (LO) phonon emission then couples energy to the lattice. LO phonon decay into acoustic phonons, and acoustic phonon propagation then causes the growth of a thermally expanded layer. Source characterization is instrumental in utilizing ultrashort x-ray pulses in time-resolved x-ray spectroscopies. By measurement of the electron beam diameter at the generation point, the pulse duration of the Thomson scattered x-rays is determined. Analysis of the Thomson scattered x-ray beam properties also provides a novel means of electron bunch characterization. Although the pulse duration is inferred for the Thomson scattering x-ray source, direct measurement is required for other x-ray pulse sources. A method based on the laser-assisted photoelectric effect (LAPE) has been demonstrated as a
Ultrashort X-ray pulse science
International Nuclear Information System (INIS)
Chin, A.H.; Lawrence Berkeley National Lab., CA
1998-01-01
A variety of phenomena involves atomic motion on the femtosecond time-scale. These phenomena have been studied using ultrashort optical pulses, which indirectly probe atomic positions through changes in optical properties. Because x-rays can more directly probe atomic positions, ultrashort x-ray pulses are better suited for the study of ultrafast structural dynamics. One approach towards generating ultrashort x-ray pulses is by 90 o Thomson scattering between terawatt laser pulses and relativistic electrons. Using this technique, the author generated ∼ 300 fs, 30 keV (0.4 (angstrom)) x-ray pulses. These x-ray pulses are absolutely synchronized with ultrashort laser pulses, allowing femtosecond optical pump/x-ray probe experiments to be performed. Using the right-angle Thomson scattering x-ray source, the author performed time-resolved x-ray diffraction studies of laser-perturbated InSb. These experiments revealed a delayed onset of lattice expansion. This delay is due to the energy relaxation from a dense electron-hole plasma to the lattice. The dense electron-hole plasma first undergoes Auger recombination, which reduces the carrier concentration while maintaining energy content. Longitudinal-optic (LO) phonon emission then couples energy to the lattice. LO phonon decay into acoustic phonons, and acoustic phonon propagation then causes the growth of a thermally expanded layer. Source characterization is instrumental in utilizing ultrashort x-ray pulses in time-resolved x-ray spectroscopies. By measurement of the electron beam diameter at the generation point, the pulse duration of the Thomson scattered x-rays is determined. Analysis of the Thomson scattered x-ray beam properties also provides a novel means of electron bunch characterization. Although the pulse duration is inferred for the Thomson scattering x-ray source, direct measurement is required for other x-ray pulse sources. A method based on the laser-assisted photoelectric effect (LAPE) has been
Accuracy and borehole influences in pulsed neutron gamma density logging while drilling
Energy Technology Data Exchange (ETDEWEB)
Yu Huawei [College of Geo-Resources and Information, China University of Petroleum, Qingdao, Shandong 266555 (China); Center for Engineering Applications of Radioisotopes (CEAR), Department of Nuclear Engineering, North Carolina State University, Raleigh, NC 27695 (United States); Sun Jianmeng [College of Geo-Resources and Information, China University of Petroleum, Qingdao, Shandong 266555 (China); Wang Jiaxin [Center for Engineering Applications of Radioisotopes (CEAR), Department of Nuclear Engineering, North Carolina State University, Raleigh, NC 27695 (United States); Gardner, Robin P., E-mail: gardner@ncsu.edu [Center for Engineering Applications of Radioisotopes (CEAR), Department of Nuclear Engineering, North Carolina State University, Raleigh, NC 27695 (United States)
2011-09-15
A new pulsed neutron gamma density (NGD) logging has been developed to replace radioactive chemical sources in oil logging tools. The present paper describes studies of near and far density measurement accuracy of NGD logging at two spacings and the borehole influences using Monte-Carlo simulation. The results show that the accuracy of near density is not as good as far density. It is difficult to correct this for borehole effects by using conventional methods because both near and far density measurement is significantly sensitive to standoffs and mud properties. - Highlights: > Monte Carlo evaluation of pulsed neutron gamma-ray density tools. > Results indicate sensitivity of the tool to standoff and mudcake properties. > Accuracy of far spaced detector is better than near spaced.
Accuracy and borehole influences in pulsed neutron gamma density logging while drilling
International Nuclear Information System (INIS)
Yu Huawei; Sun Jianmeng; Wang Jiaxin; Gardner, Robin P.
2011-01-01
A new pulsed neutron gamma density (NGD) logging has been developed to replace radioactive chemical sources in oil logging tools. The present paper describes studies of near and far density measurement accuracy of NGD logging at two spacings and the borehole influences using Monte-Carlo simulation. The results show that the accuracy of near density is not as good as far density. It is difficult to correct this for borehole effects by using conventional methods because both near and far density measurement is significantly sensitive to standoffs and mud properties. - Highlights: → Monte Carlo evaluation of pulsed neutron gamma-ray density tools. → Results indicate sensitivity of the tool to standoff and mudcake properties. → Accuracy of far spaced detector is better than near spaced.
International Nuclear Information System (INIS)
Hillier, R.
1984-01-01
The book reviews the development of gamma ray astronomy over the past twenty five years. A large section of the book is devoted to the problems of background radiation and the design of detectors. Gamma rays from the sun, the galactic disc, the galaxy, and extra galactic sources; are also discussed. (U.K.)
Impact of intense x-ray pulses on a NaI(Tl)-based gamma camera
Koppert, Wilco J C; van der Velden, Sandra; Steenbergen, J H Leo; de Jong, Hugo W A M
2018-01-01
INTRODUCTION: In SPECT/CT systems X-ray and -ray imaging is performed sequentially. Simultaneous acquisition may have advantages, for instance in interventional settings. However, this may expose a gamma camera to relatively high X-ray doses and deteriorate its functioning. We studied the NaI(Tl)
International Nuclear Information System (INIS)
Kim, Jinhyung; Kim, J. H.; Choi, H. D.
2014-01-01
As a representative method of non-destructive assay, accurate neutron measurement is difficult due to large background radiation such as γ-ray, secondary radiation, spurious pulse, etc. In a BF 3 detector, the process of signal generation is different between neutron and other radiations. As the development of detection technique, all of signal data can be digitized by digital measurement method. In the previous study, Applied Nuclear Physics Group in Seoul National University has developed digital Pulse Shape Discrimination (PSD) method using digital oscilloscope. In this study, optimization of parameters for pulse discrimination is discussed and γ-ray region is determined by measuring 60 Co source. The background signal of BF 3 detector is discriminated by digital PSD system. Parameters for PSD are optimized through FOM calculation. And the γ-ray region is determined by measuring 60 Co source. In the future, the performance of developed system will be tested in low and high intensity neutron field
Simultaneous beta and gamma spectroscopy
Farsoni, Abdollah T.; Hamby, David M.
2010-03-23
A phoswich radiation detector for simultaneous spectroscopy of beta rays and gamma rays includes three scintillators with different decay time characteristics. Two of the three scintillators are used for beta detection and the third scintillator is used for gamma detection. A pulse induced by an interaction of radiation with the detector is digitally analyzed to classify the type of event as beta, gamma, or unknown. A pulse is classified as a beta event if the pulse originated from just the first scintillator alone or from just the first and the second scintillator. A pulse from just the third scintillator is recorded as gamma event. Other pulses are rejected as unknown events.
Designing a new type of neutron detector for neutron and gamma-ray discrimination via GEANT4
International Nuclear Information System (INIS)
Shan, Qing; Chu, Shengnan; Ling, Yongsheng; Cai, Pingkun; Jia, Wenbao
2016-01-01
Design of a new type of neutron detector, consisting of a fast neutron converter, plastic scintillator, and Cherenkov detector, to discriminate 14-MeV fast neutrons and gamma rays in a pulsed n–γ mixed field and monitor their neutron fluxes is reported in this study. Both neutrons and gamma rays can produce fluorescence in the scintillator when they are incident on the detector. However, only the secondary charged particles of the gamma rays can produce Cherenkov light in the Cherenkov detector. The neutron and gamma-ray fluxes can be calculated by measuring the fluorescence and Cherenkov light. The GEANT4 Monte Carlo simulation toolkit is used to simulate the whole process occurring in the detector, whose optimum parameters are known. Analysis of the simulation results leads to a calculation method of neutron flux. This method is verified by calculating the neutron fluxes using pulsed n–γ mixed fields with different n/γ ratios, and the results show that the relative errors of all calculations are <5%. - Highlights: • A neutron detector is developed to discriminate 14-MeV fast neutrons and gamma rays. • The GEANT4 is used to optimize the parameters of the detector. • A calculation method of neutron flux is established through the simulation. • Several n/γ mixture fields are simulated to validate of the calculation method.
Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations
MAGIC Collaboration; Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; de Almeida, U. Barres; Barrio, J. A.; González, J. Becerra; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.
2017-01-01
The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes have been predicted for both the central binary and the interaction regions between jets and surrounding nebula. Also, non-thermal emission at lower energies has been previously reported. We explore the capability of SS 433 to emit VHE gamma rays during periods in which the expected flux attenuation due to ...
The 4U 0115+63: Another energetic gamma ray binary pulsar
Chadwick, P. M.; Dipper, N. A.; Dowthwaite, J. C.; Kirkman, I. W.; Mccomb, T. J. L.; Orford, K. J.; Turver, K. E.
1985-01-01
Following the discovery of Her X-1 as a source of pulsed 1000 Gev X-rays, a search for emission from an X-ray binary containing a pulsar with similar values of period, period derivative and luminosity was successful. The sporadic X-ray binary 4U 0115-63 has been observed, with probability 2.5 x 10 to the minus 6 power ergs/s to emit 1000 GeV gamma-rays with a time averaged energy flux of 6 to 10 to the 35th power.
Space instrumentation for gamma-ray astronomy
Energy Technology Data Exchange (ETDEWEB)
Teegarden, B.J
1999-02-11
The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world.
Space instrumentation for gamma-ray astronomy
International Nuclear Information System (INIS)
Teegarden, B.J.
1999-01-01
The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world
The analysis of the gamma-ray pulseheight spectra resulting from the NaI detector
International Nuclear Information System (INIS)
Huang Zhengde; Zhang Guishan; Chen Qun; Cao Zhong
1990-01-01
The analysis of the Gamma-ray pulse-height spectra resulting from NaI detector is described by using weighted least square iteration. The computer program has the function of searching for Gamma-ray peak automatically. It can be used in the analysis of continuous, discrete or their superposition spectra. Besides, there are some function of the spectrum smooth,the correction of the shift in gain and zero energy channel intercept. Some results of the computer program are presented
Pulsar Wind Nebulae and Cosmic Rays: A Bedtime Story
Energy Technology Data Exchange (ETDEWEB)
Weinstein, A.
2014-11-15
The role pulsar wind nebulae play in producing our locally observed cosmic ray spectrum remains murky, yet intriguing. Pulsar wind nebulae are born and evolve in conjunction with SNRs, which are favored sites of Galactic cosmic ray acceleration. As a result they frequently complicate interpretation of the gamma-ray emission seen from SNRs. However, pulsar wind nebulae may also contribute directly to the local cosmic ray spectrum, particularly the leptonic component. This paper reviews the current thinking on pulsar wind nebulae and their connection to cosmic ray production from an observational perspective. It also considers how both future technologies and new ways of analyzing existing data can help us to better address the relevant theoretical questions. A number of key points will be illustrated with recent results from the VHE (E > 100 GeV) gamma-ray observatory VERITAS.
DISCOVERY OF GAMMA-RAY PULSATIONS FROM THE TRANSITIONAL REDBACK PSR J1227-4853
Energy Technology Data Exchange (ETDEWEB)
Johnson, T. J. [College of Science, George Mason University, Fairfax, VA 22030 (United States); Ray, P. S.; Cheung, C. C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States); Roy, J.; Bhattacharyya, B.; Stappers, B. W. [Jodrell Bank Centre for Astrophysics, School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Harding, A. K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Pletsch, H. J.; Fort, S. [Albert-Einstein-Institut, Max-Planck-Institut für Gravitationsphysik, D-30167 Hannover (Germany); Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Deneva, J. [National Research Council Research Associate, National Academy of Sciences, Washington, DC 20001 (United States); Kerr, M., E-mail: tyrel.j.johnson@gmail.com, E-mail: Paul.Ray@nrl.navy.mil, E-mail: jayanta.roy@manchester.ac.uk [CSIRO Astronomy and Space Science, Australia Telescope National Facility, Epping NSW 1710 (Australia)
2015-06-10
The 1.69 ms spin period of PSR J1227−4853 was recently discovered in radio observations of the low-mass X-ray binary XSS J12270−4859 following the announcement of a possible transition to a rotation-powered millisecond pulsar state, inferred from decreases in optical, X-ray, and gamma-ray flux from the source. We report the detection of significant (5σ) gamma-ray pulsations after the transition, at the known spin period, using ∼1 year of data from the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. The gamma-ray light curve of PSR J1227−4853 can be fit by one broad peak, which occurs at nearly the same phase as the main peak in the 1.4 GHz radio profile. The partial alignment of light-curve peaks in different wavebands suggests that at least some of the radio emission may originate at high altitude in the pulsar magnetosphere, in extended regions co-located with the gamma-ray emission site. We folded the LAT data at the orbital period, both pre- and post-transition, but find no evidence for significant modulation of the gamma-ray flux. Analysis of the gamma-ray flux over the mission suggests an approximate transition time of 2012 November 30. Continued study of the pulsed emission and monitoring of PSR J1227−4853, and other known redback systems, for subsequent flux changes will increase our knowledge of the pulsar emission mechanism and transitioning systems.
Apparatus for gamma ray radiography
International Nuclear Information System (INIS)
Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi
1979-01-01
This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)
International Nuclear Information System (INIS)
Jin, Y.; Verghese, K.; Gardner, R.P.
1986-01-01
This paper describes a major part of our efforts to simulate the entire spectral response of the neutron capture prompt gamma-ray analyzer for bulk media (or conveyor belt) samples by the Monte Carlo method. This would allow one to use such a model to augment or, in most cases, essentially replace experiments in the calibration and optimum design of these analyzers. In previous work, we simulated the unscattered gamma-ray intensities, but would like to simulate the entire spectral response as we did with the energy-dispersive x-ray fluorescence analyzers. To accomplish this, one must account for the scattered gamma rays as well as the unscattered and one must have available the detector response function to translate the incident gamma-ray spectrum calculated by the Monte Carlo simulation into the detected pulse-height spectrum. We recently completed our work on the germanium detector response function, and the present paper describes our efforts to simulate the entire spectral response by using it with Monte Carlo predicted unscattered and scattered gamma rays
International Nuclear Information System (INIS)
Broomhead, Laurent.
1980-01-01
The nuclear gamma astronomy is presented, in particular the Gamma Ray Observatory, an enormous eight tonnes machine fitted with gamma telescopes, scheduled for launching around 1985. It is thereby hoped to study the natural nuclear reactions which occur when stars explode [fr
Response function of NaI(Tl) detectors and multiple backscattering of gamma rays in aluminium
International Nuclear Information System (INIS)
Sabharwal, Arvind D.; Singh, Manpreet; Singh, Bhajan; Sandhu, B.S.
2008-01-01
The response function, converting the observed pulse-height distribution of a NaI(Tl) detector to a true photon spectrum, is obtained experimentally with the help of an inverse matrix approach. The energy of gamma-ray photons continuously decreases as the number of scatterings increases in a sample having finite dimensions when one deals with the depth of the sample. The present experiments are undertaken to study the effect of target thickness on intensity distribution of gamma photons multiply backscattered from an aluminium target. A NaI(Tl) gamma-ray detector detects the photons backscattered from the aluminium target. The subtraction of analytically estimated singly scattered distribution from the observed intensity distribution (originating from interactions of primary gamma-ray photons with the target) results in multiply backscattered events. We observe that for each incident gamma photon energy, the number of multiply backscattered photons increases with increase in target thickness and then saturates at a particular target thickness called the saturation thickness (depth). Saturation thickness for multiply backscattering of gamma photons is found to decrease with increase in energy of incident gamma-ray photons
International Nuclear Information System (INIS)
Dawson, J.V.; Howard, A.S.; Akimov, D.; Araujo, H.; Bewick, A.; Davidge, D.C.R.; Jones, W.G.; Joshi, M.; Lebedenko, V.N.; Liubarsky, I.; Quenby, J.J.; Rochester, G.; Shaul, D.; Sumner, T.J.; Walker, R.J.
2005-01-01
Scintillation produced in liquid xenon by alpha particles and gamma rays has been studied as a function of applied electric field. For back scattered gamma rays with energy of about 200keV, the number of scintillation photons was found to decrease by 64±2% with increasing field strength. Consequently, the pulse shape discrimination power between alpha particles and gamma rays is found to reduce with increasing field, but remaining non-zero at higher fields
Quantum-Gravity Based Photon Dispersion in Gamma-Ray Bursts: The Detection Problem
International Nuclear Information System (INIS)
Norris, Jay P.; Scargle, Jeffrey D.
2007-01-01
Gamma-ray bursts at cosmological distances offer a time-varying signal that can be used to search for energy-dependent photon dispersion effects. We show that short bursts with narrow pulse structures at high energies will offer the least ambiguous tests for energy-dependent dispersion effects. We discuss quantitative methods to search for such effects in time-tagged photon data. Utilizing observed gamma-ray burst profiles extrapolated to GeV energies, as may expected to be observed by GLAST, we also demonstrate the extent to which these methods can be used as an empirical exploration of quantum gravity formalisms
International Nuclear Information System (INIS)
Michael Momayezi
2001-01-01
use is to correct for the effect of varying charge collection times when measuring gamma-ray energies using large-volume Ge detectors. The substantial charge collection times in a large Ge detector cause ballistic deficit when used with a resistive feedback preamplifier. Conventional Gaussian shaping with long time constants can reduce the resulting spectral broadening to an insignificant level at the great expense of limiting the high count rate capability of a big Ge detector. Pulse shape analysis can be used to accurately correct for the preamplifier ballistic deficit independent of the filter time. As a result, the energy resolution of a big Ge detector at high count rates will be degraded only by the noise performance of its preamplifier. Pulse rise time analysis can be fruitfully applied to hemispherical CdZnTe detectors with a small charge-collecting electrode. In CdZnTe electrons travel fast and are collected with good efficiency over appreciable distances. Holes, on the other hand, travel slowly and are collected with poor efficiency. Hemispherical detectors use the small-pixel effect to reduce their intrinsic sensitivity to this effect. Yet, a pulse rise time analysis can provide a significant improvement in spectral resolution by eliminating events in which the gamma ray converts close to the collecting electrode. Finally, pulse rise time analysis can be used to implement an extremely efficient pileup rejecter, with an equivalent double pulse resolution much less than the trigger filter time or the sampling time of the wave form digitizer. (authors)
Development of portable gamma ray tomography for imaging corrosion under insulation
International Nuclear Information System (INIS)
Rasif Mohd Zain; Roslan Yahya
2009-01-01
Corrosion under insulation (CUI) on the external wall of steel pipes is a common problem in many types of industrial plants. This is mainly due to the presence of moisture or water in the insulation materials. This type of corrosion can cause failures in areas that are normally of a primary concern to an inspection program. The failures are often the result of localized corrosion and not general wasting over large area. These failures can tee catastrophic in nature at least have an adverse economic effect in terms of downtime and repairs. There are number of techniques used today for CUI investigations. The main ones are profile radiography, pulse eddy current (PEC), ultrasonic spot readings and insulation removal. A new system that has been developed is gamma-ray computer tomography. The system is based on parallel-beam gamma ray absorption technique using NaI(Tl) 1 ' x 1 ' scintillation detectors. This paper describes the development of gamma ray tomography system. (author)
Operator's guide for VAXGAP, a gamma-ray spectrum analysis package
International Nuclear Information System (INIS)
Killian, E.W.; Femec, D.A.
1992-08-01
This report describes the gamma-ray analysis program VAXGAP, which has continually evolved at the Idaho National Engineering Laboratory over a period of several years. It is an integrated suite of computer programs for performing analyses of pulse-height spectra from high-resolution gamma-ray spectrometers and assorted support functions. VAXGAP programs operate on Digital Equipment Corporation (DEC) VAX computers running the VMS operating system, and were written in VAX FORTRAN and DEC Digital Command Language (DCL). These programs make use of DEC GKS and ReGIS for graphical output on standard terminals and printers, and DEC windows for graphics on workstations and terminals that support the X Window System protocol. This report addresses the use of VAXGAP for data acquisition and control, energy scale calibration, and real-time analyses of background and sample pulse-height spectra. Also addressed are the creation and use efficiency tables and isotope libraries, manipulation of spectrum files and their contents, and graphical display of on-going acquisitions, saved spectra, and mathematical fits to spectral peaks
International Nuclear Information System (INIS)
Yamagami, Takamasa
1985-01-01
Ballon experiments for searching gamma-ray burst were carried out by employing rotating-cross modulation collimators. From a very long observation of total 315 hours during 1975 to 1979, three gamma-ray intensity anomalies were observed which were speculated as a gamma-ray burst. As for the first gamma-ray intensity anomaly observed in 1975, the burst source could be located precisely but the source, heavenly body, could not be specified. Gamma-ray burst source estimation was made by analyzing distribution of burst source in the celestial sphere, burst size distribution, and burst peak. Using the above-mentioned data together with previously published ones, apparent inconsistency was found between the observed results and the adopted theory that the source was in the Galaxy, and this inconsistency was found due to the different time profiles of the burst observed with instruments of different efficiency. It was concluded by these analysis results that employment of logN - logP (relation between burst frequency and burst count) was better than that of logN - logS (burst size) in the examination of gamma-ray burst because the former was less uncertain than the latter. Analyzing the author's observed gamma-ray burst data and the related published data, it was clarified that the burst distribution was almost P -312 for the burst peak value larger than 10 -6 erg/cm 2 .sec. The author could indicate that the calculated celestial distribution of burst source was consistent with the observed results by the derivation using the logN - logP relationship and that the burst larger than 10 -6 erg/cm 2 .sec happens about one thousand times a year, about ten times of the previous value. (Takagi, S.)
International Nuclear Information System (INIS)
Mayhugh, M.R.; Utts, B.K.; Shoffner, B.M.
1978-01-01
A phoswich constructed using thin calcium fluoride optically coupled to a thicker sodium iodide crystal and operated with pulse shape analysis equipment can be used as an efficient low background counting assembly. Low background in the beta ray counting channel is achieved by judicious choice of pure materials in the assembly and by operating the analysis equipment so as to reject background events which occur simultaneously in the sodium iodide crystal. Careful survey of construction materials and methods has resulted in reducing beta ray counting background to 0.6 c/min for a 2-inch diameter assembly. The radioactivity of typical building materials will be discussed. A pulse shape analyzer has been constructed which provides separately adjusted time windows and separate output information for the beta ray and gamma ray channels. The dual channel capability combined with the low beta ray background reduces the sample counting time significantly for typical laboratory samples. (author)
Stanbro, M.; Briggs, M. S.; Cramer, E.; Dwyer, J. R.; Roberts, O.
2017-12-01
Terrestrial Gamma-ray Flashes (TGFs) are sub-ms, intense flashes of gamma-rays. They are due to the acceleration of electrons with relativistic energies in thunderstorms that emit gamma-rays via bremsstrahlung. When these photons reach the upper atmosphere, they can produce secondary electrons and positrons that escape the atmosphere and propagate along the Earth's magnetic field line. Space instruments can detect these charged particles, known as Terrestrial Electron Beams (TEBs), after traveling thousands of kilometers from the thunderstorm. We present an event that was observed by the Fermi Gamma-ray Burst Monitor (GBM) as both a TGF and a TEB. To our knowledge this is the first such event that has ever been observed. We interpret the first pulse as a TGF with a duration of 0.2 ms. After 0.5 ms a second pulse is seen with a duration of 2 ms that we interpret as a TEB. Confirming this interpretation, a third pulse is seen 90 ms later, which is understood as a TEB magnetic mirror pulse. The World Wide Lightning Location Network (WWLLN) and the Earth Networks Total Lightning Network (ENTLN) detected a sferic, under the spacecraft footprint and within the southern magnetic footprint that is simultaneous with the first pulse. Along with the sferic, this unique observation allows us for the first time to test TGF and TEB models for the same event. We present Monte Carlo simulations of the first two pulses, including pitch angles for electrons and positrons, to see if the models can consistently describe the TGF/TEB spectra and time profiles originating from the same source.
Gamma-Ray Astronomy Technology Needs
Gehrels, N.; Cannizzo, J. K.
2012-01-01
In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.
GRAP, Gamma-Ray Level-Scheme Assignment
International Nuclear Information System (INIS)
Franklyn, C.B.
2002-01-01
1 - Description of program or function: An interactive program for allocating gamma-rays to an energy level scheme. Procedure allows for searching for new candidate levels of the form: 1) L1 + G(A) + G(B) = L2; 2) G(A) + G(B) = G(C); 3) G(A) + G(B) = C (C is a user defined number); 4) L1 + G(A) + G(B) + G(C) = L2. Procedure indicates intensity balance of feed and decay of each energy level. Provides for optimization of a level energy (and associated error). Overall procedure allows for pre-defining of certain gamma-rays as belonging to particular regions of the level scheme, for example, high energy transition levels, or due to beta- decay. 2 - Method of solution: Search for cases in which the energy difference between two energy levels is equal to a gamma-ray energy within user-defined limits. 3 - Restrictions on the complexity of the problem: Maximum number of gamma-rays: 999; Maximum gamma ray energy: 32000 units; Minimum gamma ray energy: 10 units; Maximum gamma-ray intensity: 32000 units; Minimum gamma-ray intensity: 0.001 units; Maximum number of levels: 255; Maximum level energy: 32000 units; Minimum level energy: 10 units; Maximum error on energy, intensity: 32 units; Minimum error on energy, intensity: 0.001 units; Maximum number of combinations: 6400 (ca); Maximum number of gamma-ray types : 127
Observation of solar gamma-ray by Hinotori
International Nuclear Information System (INIS)
Yoshimori, Masato; Okudaira, Kiyoaki; Hirashima, Yo; Kondo, Ichiro.
1982-01-01
The solar gamma-ray emitted by solar flare was observed. The gamma-ray is the electromagnetic radiation with the energy more than 300 keV. The line gamma-ray intensity and the time profile were observed. The gamma-ray detector CsI (Tl) was loaded on Hinotori, and the observed gamma-ray was analyzed by a multi-channel analyzer. The observed line gamma-ray was the radiation from Fe-56 and Ne-20. The line gamma-ray from C-12 and O-16 was also seen. These gamma-ray is the direct evidence of the nuclear reaction on the sun. The observed spectrum suggested the existence of the lines from Mg-24 and Si-28. The intensity of the 2.22 MeV gamma-line was small. This fact showed that the origin of this line was different from other nuclear gamma-ray. Two kinds of hard X-ray bursts were detected. The one was impulsive burst, and the other was gradual burst. There was no time difference between the hard X-ray and the gamma-ray of the impulsive burst. The impulsive burst may be explained by the beam model. The delay of time profile in the high energy gamma-ray of the gradual burst was observed. This means that the time when accelerated electrons cause bremsstrahlung depends on the electron energy. The long trapping of electrons at the top of magnetic loop is suggested. (Kato, T.)
Relativistic motion in gamma-ray bursts
International Nuclear Information System (INIS)
Krolik, J.H.; Pier, E.A.
1991-01-01
Three fundamental problems affect models of gamma-ray bursts, i.e., the energy source, the ability of high-energy photons to escape the radiation region, and the comparative weakness of X-ray emission. It is indicated that relativistic bulk motion of the gamma-ray-emitting plasma generically provides a solution to all three of these problems. Results show that, if the plasma that produces gamma-ray bursts has a bulk relativistic velocity with Lorentz factor gamma of about 10, several of the most troubling problems having to do with gamma-ray bursts are solved. 42 refs
Are PSR 0656+14, PSR 0950+08, and PSR 1822-09 gamma ray pulsars?
Brown, Lawrence E.; Hartmann, Dieter H.
1993-01-01
The possible discovery of three new gamma-ray pulsars PSR 0656+14, PSR 0950+08, and PSR 1822-09 (Ma, Lu, Yu, and Young, 1993) in data obtained with the COS-B experiment is reinvestigated using a refined technique for pulsar light curve analysis. The results of this study do not confirm the previously claimed gamma-ray pulsar nature of any of these pulsars. Even when using the standard epoch folding technique in conjunction with energy-dependent acceptance cones, we do not detect pulsed gamma-ray emission from these sources. We suspect that insufficient position accuracy is the cause for the discrepancy between our results and those of Ma et al. (1993). We do not rule out that any one of the three candidates, or all of them, is in fact a gamma-ray pulsar, but their spin properties must differ from those derived by Ma et al. (1993). More work is needed to determine the correct high-energy properties of these three sources.
Highlights of GeV Gamma-Ray Astronomy
Thompson, David J.
2010-01-01
Because high-energy gamma rays are primarily produced by high-energy particle interactions, the gamma-ray survey of the sky by the Fermi Gamma-ray Space Telescope offers a view of sites of cosmic ray production and interactions. Gamma-ray bursts, pulsars, pulsar wind nebulae, binary sources, and Active Galactic Nuclei are all phenomena that reveal particle acceleration through their gamma-ray emission. Diffuse Galactic gamma radiation, Solar System gamma-ray sources, and energetic radiation from supernova remnants are likely tracers of high-energy particle interactions with matter and photon fields. This paper will present a broad overview of the constantly changing sky seen with the Large Area Telescope (LAT) on the Fermi spacecraft.
Localization of Gamma-Ray Bursts Using the Fermi Gamma-Ray Burst Monitor
Connaughton, V.; Briggs, M.S.; Goldstein, A.; Meegan, C.A.; Paciesas, W.S.; Preece, R.D.; Wilson-Hodge, C.A.; Gibby, M.H.; Greiner, J.; Gruber, D.; Jenke, P.; Kippen, R.M.; Pelassa, V.; Xiong, S.; Yu, H-F.; Bhat, P.N.; Burgess, J.M.; Byrne, D.; Fitzpatrick, G.; Foley, S.; Giles, M.M.; Guiriec, S.; van der Horst, A.J.; von Kienlin, A.; McBreen, S.; McGlynn, S.; Tierney, D.; Zhang, B..B.
2015-01-01
The Fermi Gamma-ray Burst Monitor (GBM) has detected over 1400 gamma-ray bursts (GRBs) since it began science operations in 2008 July. We use a subset of over 300 GRBs localized by instruments such as Swift, the Fermi Large Area Telescope, INTEGRAL, and MAXI, or through triangulations from the
Gamma-Ray Lenses for Astrophysics-and the Gamma-Ray Imager Mission GRI
DEFF Research Database (Denmark)
Wunderer, C. B.; Ballmoos, P. V.; Barriere, N.
2009-01-01
Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are acc...
Experimental evaluation of multiple Compton backscattering of gamma rays in copper
International Nuclear Information System (INIS)
Sabharwal, Arvind D.; Singh, Manpreet; Singh, Bhajan; Sandhu, B.S.
2009-01-01
The gamma ray photons continue to soften in energy as the number of scatterings increases in thick target, and results in the generation of singly and multiply scattered events. The number of these multiply scattered events increases with an increase in target thickness and saturates beyond a particular target thickness known as saturation depth. The present experiment is undertaken to study the saturation depth for 279 and 320 keV incident gamma ray photons multiply backscattered from copper targets of varying thickness. The backscattered photons are detected by a Nal(Tl) gamma detector whose pulse-height distribution is converted into a photon spectrum with the help of an inverse matrix approach. To extract the contribution of multiply backscattered photons only, the spectrum of singly scattered photon is reconstructed analytically. We observe that the numbers of multiply scattered events increases with an increase in target thickness and then saturate. The saturation depth is found to be decreasing with increase in incident gamma energy. (author)
International Nuclear Information System (INIS)
Matsumoto, T.; Harano, H.; Shimoyama, T.; Kudo, K.; Uritani, A.
2005-01-01
A small-sized thermal neutron detector based on a 6 Li-glass scintillator and a plastic optical fiber was developed for measurement of a dose distribution of thermal neutrons in a thermal neutron standard field. A contribution of gamma rays can not be neglected in the neutron measurement with this detector, although the 6 Li-glass scintillator can be distinguishable for the neutrons and the gamma rays by difference of each pulse height. Moreover, to reduce an uncertainty of neutron counts caused by the gamma ray background around a discrimination level, we suggested a gamma-ray-suppression type of small-sized thermal neutron detector with a 6 Li-glass scintillator, a hollow CsI(Tl) scintillator and plastic optical fibers. The detector can reject signals due to the gamma rays with an anti-coincidence method. In the present paper, we evaluated an ability of a gamma-ray suppression of the detector using the EGS4 electron-photon transport Monte-Carlo code with the PRESTA routine. As the results, the sufficient gamma-ray suppression effect was shown. (author)
Gamma ray astronomy with COS-B
International Nuclear Information System (INIS)
Swanenburg, B.N.
1981-01-01
Observational results in the field of gamma-ray astronomy that have been obtained to date with the COS-B satellite are discussed and questions raised by these observations are summarized. Following a brief review of the instrumental characteristics of COS-B and the extent of COS-B gamma-ray coverage of the sky, particular attention is given to the questions raised by the discovery of many unidentified gamma-ray sources with no apparent optical, X-ray or radio counterparts and the detection of high-energy gamma radiation from the quasar 3C 273, which suggests the role of gamma-ray emission in the creation of other radiation
International Nuclear Information System (INIS)
Lapides, J.R.
1981-01-01
The gamma-ray spectroscopy of planet surfaces is one of several possible methods that are useful in determining the elemental composition of planet surfaces from orbiting spacecraft. This has been demonstrated on the Apollos 15 and 16 missions as well as the Soviet Mars-5 mission. Planetary gamma-ray emission is primarily the result of natural radioactive decay and cosmic-ray and solar-flare-induced nuclear reactions. Secondary neutron reactions play a large role in the more intense gamma-ray emission. The technique provides information on the elemental composition of the top few tens of centimeters of the planet surface. Varying concentrations of hydrogen and compositional variations that alter the macroscopic thermal-neutron absorption cross section have a significant effect on the neutron flux in the planet surface and therefore also on the gamma-ray emission from the surface. These effects have been systematically studied for a wide range of possible planetary compositions that include Mercury, the moon, Mars, the comets, and the asteroids. The problem of the Martian atmosphere was also investigated. The results of these calculations, in which both surface neutron fluxes and gamma-ray emission fluxes were determined, were used to develop general procedures for obtaining planet compositions from the gamma-ray spectrum. Several changes have been suggested for reanalyzing the Apollos 15 and 16 gamma-ray results. In addition, procedures have been suggested that can be applied to neutron-gamma techniques in mineral and oil exploration
International Nuclear Information System (INIS)
Fernandes, A.M.; Pereira, R.C.; Sousa, J.; Neto, A.; Carvalho, P.; Batista, A.J.N.; Carvalho, B.B.; Varandas, C.A.F.; Tardocchi, M.; Gorini, G.
2010-01-01
A new data acquisition (DAQ) system was developed to fulfil the requirements of the gamma-ray spectrometer (GRS) JET-EP2 (joint European Torus enhancement project 2), providing high-resolution spectroscopy at very high-count rate (up to few MHz). The system is based on the Advanced Telecommunications Computing Architecture TM (ATCA TM ) and includes a transient record (TR) module with 8 channels of 14 bits resolution at 400 MSamples/s (MSPS) sampling rate, 4 GB of local memory, and 2 field programmable gate array (FPGA) able to perform real time algorithms for data reduction and digital pulse processing. Although at 400 MSPS only fast programmable devices such as FPGAs can be used either for data processing and data transfer, FPGA resources also present speed limitation at some specific tasks, leading to an unavoidable data lost when demanding algorithms are applied. To overcome this problem and foreseeing an increase of the algorithm complexity, a new digital parallel filter was developed, aiming to perform real time pulse processing in the FPGAs of the TR module at the presented sampling rate. The filter is based on the conventional digital time-invariant trapezoidal shaper operating with parallelized data while performing pulse height analysis (PHA) and pile up rejection (PUR). The incoming sampled data is successively parallelized and fed into the processing algorithm block at one fourth of the sampling rate. The following data processing and data transfer is also performed at one fourth of the sampling rate. The algorithm based on data parallelization technique was implemented and tested at JET facilities, where a spectrum was obtained. Attending to the observed results, the PHA algorithm will be improved by implementing the pulse pile up discrimination.
Gamma Ray Bursts-Afterglows and Counterparts
Fishman, Gerald J
1998-01-01
Several breakthrough discoveries were made last year of x-ray, optical and radio afterglows and counterparts to gamma-ray bursts, and a redshift has been associated with at least one of these. These discoveries were made possible by the fast, accurate gamma-ray burst locations of the BeppoSAX satellite. It is now generally believed that the burst sources are at cosmological distances and that they represent the most powerful explosions in the Universe. These observations also open new possibilities for the study of early star formation, the physics of extreme conditions and perhaps even cosmology. This session will concentrate on recent x-ray, optical and radio afterglow observations of gamma-ray bursts, associated redshift measurements, and counterpart observations. Several review and theory talks will also be presented, along with a summary of the astrophysical implications of the observations. There will be additional poster contributions on observations of gamma-ray burst source locations at wavelengths other than gamma rays. Posters are also solicited that describe new observational capabilities for rapid follow-up observations of gamma-ray bursts.
Diehl, Roland
2017-06-01
Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.
International Nuclear Information System (INIS)
Flaska, Marek; Faisal, Muhammad; Wentzloff, David D.; Pozzi, Sara A.
2013-01-01
One of the most important questions to be answered with regard to digital pulse-shape discrimination (PSD) systems based on organic scintillators is: What sampling properties are required for a fast-waveform digitizer used for digitizing neutron/gamma-ray pulses, while an accurate PSD is desired? Answering this question is the main objective of this paper. Specifically, the paper describes the influence of the resolution and sampling frequency of a waveform digitizer on the PSD performance of organic scintillators. The results presented in this paper are meant to help the reader choosing a waveform digitizer with appropriate bit resolution and sampling frequency. The results presented here show that a 12-bit, 250-MHz digitizer is a good choice for applications that require good PSD performance. However, when more accurate PSD performance is the main requirement, this paper presents PSD figures of merit to qualify the impact of further increasing either sampling frequency or resolution of the digitizer
Lunar occultations for gamma-ray source measurements
Koch, David G.; Hughes, E. B.; Nolan, Patrick L.
1990-01-01
The unambiguous association of discrete gamma-ray sources with objects radiating at other wavelengths, the separation of discrete sources from the extended emission within the Galaxy, the mapping of gamma-ray emission from nearby galaxies and the measurement of structure within a discrete source cannot presently be accomplished at gamma-ray energies. In the past, the detection processes used in high-energy gamma-ray astronomy have not allowed for good angular resolution. This problem can be overcome by placing gamma-ray detectors on the moon and using the horizon as an occulting edge to achieve arcsec resolution. For purposes of discussion, this concept is examined for gamma rays above 100 MeV for which pair production dominates the detection process and locally-generated nuclear gamma rays do not contribute to the background.
Future prospects for. gamma. -ray astronomy
Energy Technology Data Exchange (ETDEWEB)
Fichtel, C [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center
1981-06-30
As ..gamma..-ray astronomy moves from the discovery to the exploratory phase, the promise of ..gamma..-ray astrophysics noted by theorists in the late 1940s and 1950s is beginning to be realized. In the future, satellites should carry instruments that will have over an order of magnitude greater sensitivity than those flown thus far, and, for at least some portions of the ..gamma..-ray energy range, these detectors will also have substantially improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance our knowledge of several astrophysical phenomena including the very energetic and nuclear processes associated with compact objects, astrophysical nucleosynthesis, solar particle acceleration, the chemical composition of the planets and other bodies of the Solar System, the structure of our Galaxy, the origin and dynamic pressure effects of the cosmic rays, high energy particles and energetic processes in other galaxies especially active ones, and the degree of matter-antimatter symmetry of the Universe. The ..gamma..-ray results of the forthcoming programs such as Gamma-I, the Gamma Ray Observatory, the ..gamma..-ray burst network, Solar Polar, and very high energy ..gamma..-ray telescopes on the ground will almost certainly provide justification for more sophisticated telescopes. These advanced instruments might be placed on the Space Platform currently under study by N.A.S.A.
The relativistic feedback discharge model of terrestrial gamma ray flashes
Dwyer, Joseph R.
2012-02-01
As thunderclouds charge, the large-scale fields may approach the relativistic feedback threshold, above which the production of relativistic runaway electron avalanches becomes self-sustaining through the generation of backward propagating runaway positrons and backscattered X-rays. Positive intracloud (IC) lightning may force the large-scale electric fields inside thunderclouds above the relativistic feedback threshold, causing the number of runaway electrons, and the resulting X-ray and gamma ray emission, to grow exponentially, producing very large fluxes of energetic radiation. As the flux of runaway electrons increases, ionization eventually causes the electric field to discharge, bringing the field below the relativistic feedback threshold again and reducing the flux of runaway electrons. These processes are investigated with a new model that includes the production, propagation, diffusion, and avalanche multiplication of runaway electrons; the production and propagation of X-rays and gamma rays; and the production, propagation, and annihilation of runaway positrons. In this model, referred to as the relativistic feedback discharge model, the large-scale electric fields are calculated self-consistently from the charge motion of the drifting low-energy electrons and ions, produced from the ionization of air by the runaway electrons, including two- and three-body attachment and recombination. Simulation results show that when relativistic feedback is considered, bright gamma ray flashes are a natural consequence of upward +IC lightning propagating in large-scale thundercloud fields. Furthermore, these flashes have the same time structures, including both single and multiple pulses, intensities, angular distributions, current moments, and energy spectra as terrestrial gamma ray flashes, and produce large current moments that should be observable in radio waves.
Reset charge sensitive amplifier for NaI(Tl) gamma-ray spectrometer
International Nuclear Information System (INIS)
Zeng, Guoqiang; Tan, Chengjun; Li, Qiang; Ge, Liangquan; Liu, Xiyao; Luo, Qun
2015-01-01
The time constant of the output signal of the front-end readout circuit of a traditional gamma-ray spectrometer with a NaI(Tl)+PMT structure is affected by temperature, measurement environment and the signal transmission cable, so it is difficult to get a good resolution spectrum, especially at higher counting rates. In this paper, a reset charge sensitive amplifier (RCSA) is designed for the gamma-ray spectrometer with a NaI(Tl)+PMT structure. The designed RCSA outputs a step signal, thus enabling the acquisition of double-exponential signals with a stable time constant by using the next stage of a CR differentiating circuit. The designed RCSA is mainly composed of a basic amplifying circuit, a reset circuit and a dark current compensation circuit. It provides the output step signal through the integration of the PMT output charge signal. When the amplitude of the step signal exceeds a preset voltage threshold, it triggers the reset circuit to generate a reset pulse (about 5 µs pulse width) to reset the output signal. Experimental results demonstrated that the designed RCSA achieves a charge sensitivity of 4.26×10 10 V/C, with a zero capacitance noise of 51.09 fC and a noise slope of 1.98 fC/pF. Supported by the digital shaping algorithm of the digital multi-channel analyzer (DMCA), it can maintain good energy resolution with high counting rates up to 150 kcps and with a temperature range from −19 °C to 50 °C. - Highlights: • A new reset type charge sensitive amplifier for gamma-ray spectrometer based on a photomultiplier tube is proposed. • Reset circuit formed by constant current source output a fixed width pulse to reset charge sensitive amplifier. • Photomultiplier tube dark current compensation circuit could increase the pulse through rate by decreasing reset frequency. • This amplifier outputs a step function signal that could match next stage circuit easily
Digital gamma-ray spectroscopy based on FPGA technology
Bolic, M
2002-01-01
A digital pulse processing system convenient for high rate gamma-ray spectroscopy with NaI(Tl) detectors has been designed. The new programmable logic device has been used for implementation of dedicated high-speed pulse processor, as the central part of the system. The processor is capable to operate at the speed of fast ADC, preserving maximum throughput of the system. Special care has been taken to reduce the distortion of energy spectrum caused by pile-up at high-count rates. The developed system is highly flexible, and the parameters of its operation can be changed in software. The performance of the system was tested for high counting rate of 400000 s sup - sup 1.
Radio Observations of Gamma-ray Novae
Linford, Justin D.; Chomiuk, L.; Ribeiro, V.; project, E.-Nova
2014-01-01
Recent detection of gamma-ray emission from classical novae by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope surprised many in the astronomical community. We present results from radio observations, obtained using the Karl G. Jansky Very Large Array (VLA), of three gamma-ray novae: Mon2012, Sco2012, and Del2013. Radio observations allow for the calculation of ejecta masses, place limits on the distances, and provide information about the gamma-ray emission mechanism for these sources.
Wunderer, Cornelia B.; GRI Collaboration
2008-03-01
Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are accelerated to extreme relativistic energies by mechanisms which are still poorly understood, and nuclear reactions are synthesizing the basic constituents of our world. Cosmic accelerators and cosmic explosions are major science themes that are addressed in the gamma-ray regime. ESA's INTEGRAL observatory currently provides the astronomical community with a unique tool to investigate the sky up to MeV energies and hundreds of sources, new classes of objects, extraordinary views of antimatter annihilation in our Galaxy, and fingerprints of recent nucleosynthesis processes have been discovered. NASA's GLAST mission will similarly take the next step in surveying the high-energy ( GeV) sky, and NuSTAR will pioneer focusing observations at hard X-ray energies (to 80 keV). There will be clearly a growing need to perform deeper, more focused investigations of gamma-ray sources in the 100-keV to MeV regime. Recent technological advances in the domain of gamma-ray focusing using Laue diffraction and multilayer-coated mirror techniques have paved the way towards a gamma-ray mission, providing major improvements compared to past missions regarding sensitivity and angular resolution. Such a future Gamma-Ray Imager will allow the study of particle acceleration processes and explosion physics in unprecedented detail, providing essential clues on the innermost nature of the most violent and most energetic processes in the Universe.
A Population of Gamma-Ray Millisecond Pulsars Seen with the Fermi Large Area Telescope
International Nuclear Information System (INIS)
Dumora, D.; Grondin, M.H.; Guillemot, L.; Lemoine-Goumard, M.; Lovellette, M.N.; Parent, D.; Smith, D.A.; Abdo, A.A.; Chekhtman, A.; Dermer, C.D.; Grove, J.E.; Johnson, W.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wood, K.S.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Charles, E.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Edmonds, Y.; Focke, W.B.; Funk, S.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Panetta, J.H.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.B.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Atwood, W.B.; Dormody, M.; Johnson, R.P.; Porter, T.A.; Sadrozinski, H.F.W.; Schalk, T.L.; Thorsett, S.E.; Ziegler, M.; Axelsson, M.; Carlson, P.; Conrad, J.; Meurer, C.; Ryde, F.; Ylinen, T.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Spandre, G.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Starck, J.L.
2009-01-01
Pulsars are born with sub-second spin periods and slow by electromagnetic braking for several tens of millions of years, when detectable radiation ceases. A second life can occur for neutron stars in binary systems. They can acquire mass and angular momentum from their companions, to be spun up to millisecond periods and begin radiating again. We searched Fermi Large Area Telescope data for pulsations from all known millisecond pulsars (MSPs) outside of globular clusters, using rotation parameters from radio telescopes. Strong gamma-ray pulsations were detected for eight MSPs. The gamma-ray pulse profiles and spectral properties resemble those of young gamma-ray pulsars. The basic emission mechanism seems to be the same for MSPs and young pulsars, with the emission originating in regions far from the neutron star surface. (authors)
Mirzoyan, Razmik
2018-04-01
The MAGIC collaboration reports the first detection of very-high-energy (VHE; E > 100 GeV) gamma-ray emission from PGC 2402248, also known as 2WHSP J073326.7+515354 (Chang et al. 2016, A & A, 598, A17) with coordinates R.A.: 07:33:26.7 h, Dec: +51:53:54.99 deg. The source is classified as an extreme high-energy peaked BL Lacertae object of unknown redshift, included in the 2WHSP catalog with a synchrotron peak located at 10^17.9 Hz. PGC 2402248 was observed with the MAGIC telescopes from 2018/01/23 to 2018/04/18 (MJD 58141-58226) for about 23 h. The preliminary analysis of these data resulted in the detection of PGC 2402248 with a statistical significance of more than 6 standard deviations.
Observation of gamma-ray bursts with GINGA
International Nuclear Information System (INIS)
Murakami, Toshio; Fujii, Masami; Nishimura, Jun
1989-01-01
Gamma-ray Burst Detector System (GBD) on board the scientific satellite 'GINGA' which was launched on Feb. 5, 1987, was realized as an international cooperation between ISAS and LANL. It has recorded more than 40 Gamma-Ray Burst candidates during 20 months observation. Although many observational evidences were accumulated in past 20 years after the discovery of gamma-ray burst by LANL scientists, there are not enough evidence to determine the origin and the production mechanism of the gamma-ray burst. GBD consists of a proportional counter and a NaI scintillation counter so that it became possible to observe energy spectrum of the gamma-ray burst with high energy resolution over wide range of energy (1.5-380 keV) together with high time resolution. As the result of observation, the following facts are obtained: (1) A large fraction of observed gamma-ray bursts has a long X-ray tail after the harder part of gamma-ray emission has terminated. (2) Clear spectral absorption features with harmonic in energy was observed in some of the energy spectrum of gamma-ray bursts. These evidences support the hypothesis that the strongly magnetized neutron star is the origin of gamma-ray burst. (author)
Gamma ray astronomy from satellites and balloons
International Nuclear Information System (INIS)
Schoenfelder, V.
1986-01-01
A survey is given of gamma ray astronomy topics presented at the Cosmic Ray Conference. The major conclusions at the Cosmic Ray Conference in the field of gamma ray astronomy are given. (1) MeV-emission of gamma-ray bursts is a common feature. Variations in duration and energy spectra from burst to burst may explain the discrepancy between the measured log N - log S dependence and the observed isotropy of bursts. (2) The gamma-ray line at 1.809 MeV from Al(26) is the first detected line from a radioactive nucleosynthesis product. In order to understand its origin it will be necessary to measure its longitude distribution in the Milky Way. (3) The indications of a gamma-ray excess found from the direction of Loop I is consistent with the picture that the bulk of cosmic rays below 100 GeV is produced in galactic supernova remnants. (4) The interpretation of the large scale distribution of gamma rays in the Milky Way is controversial. At present an extragalactic origin of the cosmic ray nuclei in the GeV-range cannot be excluded from the gamma ray data. (5) The detection of MeV-emission from Cen A is a promising step towards the interesting field of extragalactic gamma ray astronomy
Bodnarik, J.; Evans, L.; Floyd, S.; Lim, L.; McClanahan, T.; Namkung, M.; Parsons, A.; Schweitzer, J.; Starr, R.; Trombka, J.
2010-01-01
An outside neutron and gamma ray instrumentation test facility has been constructed at NASA's Goddard Space Flight Center (GSFC) to evaluate conceptual designs of gamma ray and neutron systems that we intend to propose for future planetary lander and rover missions. We will describe this test facility and its current capabilities for operation of planetary in situ instrumentation, utilizing a l4 MeV pulsed neutron generator as the gamma ray excitation source with gamma ray and neutron detectors, in an open field with the ability to remotely monitor and operate experiments from a safe distance at an on-site building. The advantage of a permanent test facility with the ability to operate a neutron generator outside and the flexibility to modify testing configurations is essential for efficient testing of this type of technology. Until now, there have been no outdoor test facilities for realistically testing neutron and gamma ray instruments planned for solar system exploration
NEW FERMI-LAT EVENT RECONSTRUCTION REVEALS MORE HIGH-ENERGY GAMMA RAYS FROM GAMMA-RAY BURSTS
Energy Technology Data Exchange (ETDEWEB)
Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Baldini, L. [Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bregeon, J.; Pesce-Rollins, M.; Sgro, C.; Tinivella, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bruel, P. [Laboratoire Leprince-Ringuet, Ecole polytechnique, CNRS/IN2P3, Palaiseau (France); Chekhtman, A. [Center for Earth Observing and Space Research, College of Science, George Mason University, Fairfax, VA 22030 (United States); Cohen-Tanugi, J. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, F-34095 Montpellier (France); Drlica-Wagner, A.; Omodei, N.; Rochester, L. S.; Usher, T. L. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Granot, J. [Department of Natural Sciences, The Open University of Israel, 1 University Road, P.O. Box 808, Ra' anana 43537 (Israel); Longo, F. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Razzaque, S. [Department of Physics, University of Johannesburg, Auckland Park 2006 (South Africa); Zimmer, S., E-mail: melissa.pesce.rollins@pi.infn.it, E-mail: nicola.omodei@stanford.edu, E-mail: granot@openu.ac.il [Department of Physics, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden)
2013-09-01
Based on the experience gained during the four and a half years of the mission, the Fermi-LAT Collaboration has undertaken a comprehensive revision of the event-level analysis going under the name of Pass 8. Although it is not yet finalized, we can test the improvements in the new event reconstruction with the special case of the prompt phase of bright gamma-ray bursts (GRBs), where the signal-to-noise ratio is large enough that loose selection cuts are sufficient to identify gamma rays associated with the source. Using the new event reconstruction, we have re-analyzed 10 GRBs previously detected by the Large Area Telescope (LAT) for which an X-ray/optical follow-up was possible and found four new gamma rays with energies greater than 10 GeV in addition to the seven previously known. Among these four is a 27.4 GeV gamma ray from GRB 080916C, which has a redshift of 4.35, thus making it the gamma ray with the highest intrinsic energy ({approx}147 GeV) detected from a GRB. We present here the salient aspects of the new event reconstruction and discuss the scientific implications of these new high-energy gamma rays, such as constraining extragalactic background light models, Lorentz invariance violation tests, the prompt emission mechanism, and the bulk Lorentz factor of the emitting region.
X-ray and gamma radiography devices
International Nuclear Information System (INIS)
Abdul Nassir Ibrahim; Azali Muhammad; Ab. Razak Hamzah; Abd. Aziz Mohamed; Mohamad Pauzi Ismail
2008-01-01
When we are using this technique, we also must familiar with the device and instrument that used such as gamma projector, crawler, x-ray tubes and others. So this chapter discussed detailed on device used for radiography work. For the x-ray and gamma, their characteristics are same but the source to produce is a big different. X-ray produced from the machine meanwhile, gamma produce from the source such as Co-60 and IR-192. Both are electromagnetic waves. So, the reader can have some knowledge on what is x-ray tube, discrete x-ray and characteristic x-ray, how the machine works and how to control a machine, what is source for gamma emitter, how to handle the projector and lastly difference between x-ray and gamma. Of course this cannot be with the theory only, so detailed must be learned practically.
CONSTRAINTS ON THE EMISSION GEOMETRIES AND SPIN EVOLUTION OF GAMMA-RAY MILLISECOND PULSARS
Energy Technology Data Exchange (ETDEWEB)
Johnson, T. J. [National Research Council Research Associate, National Academy of Sciences, Washington, DC 20001 (United States); Venter, C. [Centre for Space Research, North-West University, Potchefstroom Campus, Private Bag X6001, 2520 Potchefstroom (South Africa); Harding, A. K.; Çelik, Ö.; Ferrara, E. C. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Guillemot, L. [Laboratoire de Physique et Chimie de l' Environnement, LPCE UMR 6115 CNRS, F-45071 Orléans Cedex 02 (France); Smith, D. A.; Hou, X. [Centre d' Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Kramer, M. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, 53121 Bonn (Germany); Den Hartog, P. R. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Lande, J. [Twitter Inc., 1355 Market Street 900, San Francisco, CA 94103 (United States); Ray, P. S., E-mail: tyrel.j.johnson@gmail.com, E-mail: Christo.Venter@nwu.ac.za, E-mail: ahardingx@yahoo.com [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States)
2014-07-01
Millisecond pulsars (MSPs) are a growing class of gamma-ray emitters. Pulsed gamma-ray signals have been detected from more than 40 MSPs with the Fermi Large Area Telescope (LAT). The wider radio beams and more compact magnetospheres of MSPs enable studies of emission geometries over a broader range of phase space than non-recycled radio-loud gamma-ray pulsars. We have modeled the gamma-ray light curves of 40 LAT-detected MSPs using geometric emission models assuming a vacuum retarded-dipole magnetic field. We modeled the radio profiles using a single-altitude hollow-cone beam, with a core component when indicated by polarimetry; however, for MSPs with gamma-ray and radio light curve peaks occurring at nearly the same rotational phase, we assume that the radio emission is co-located with the gamma rays and caustic in nature. The best-fit parameters and confidence intervals are determined using a maximum likelihood technique. We divide the light curves into three model classes, with gamma-ray peaks trailing (Class I), aligned (Class II), or leading (Class III) the radio peaks. Outer gap and slot gap (two-pole caustic) models best fit roughly equal numbers of Class I and II, while Class III are exclusively fit with pair-starved polar cap models. Distinguishing between the model classes based on typical derived parameters is difficult. We explore the evolution of the magnetic inclination angle with period and spin-down power, finding possible correlations. While the presence of significant off-peak emission can often be used as a discriminator between outer gap and slot gap models, a hybrid model may be needed.
CONSTRAINTS ON THE EMISSION GEOMETRIES AND SPIN EVOLUTION OF GAMMA-RAY MILLISECOND PULSARS
International Nuclear Information System (INIS)
Johnson, T. J.; Venter, C.; Harding, A. K.; Çelik, Ö.; Ferrara, E. C.; Guillemot, L.; Smith, D. A.; Hou, X.; Kramer, M.; Den Hartog, P. R.; Lande, J.; Ray, P. S.
2014-01-01
Millisecond pulsars (MSPs) are a growing class of gamma-ray emitters. Pulsed gamma-ray signals have been detected from more than 40 MSPs with the Fermi Large Area Telescope (LAT). The wider radio beams and more compact magnetospheres of MSPs enable studies of emission geometries over a broader range of phase space than non-recycled radio-loud gamma-ray pulsars. We have modeled the gamma-ray light curves of 40 LAT-detected MSPs using geometric emission models assuming a vacuum retarded-dipole magnetic field. We modeled the radio profiles using a single-altitude hollow-cone beam, with a core component when indicated by polarimetry; however, for MSPs with gamma-ray and radio light curve peaks occurring at nearly the same rotational phase, we assume that the radio emission is co-located with the gamma rays and caustic in nature. The best-fit parameters and confidence intervals are determined using a maximum likelihood technique. We divide the light curves into three model classes, with gamma-ray peaks trailing (Class I), aligned (Class II), or leading (Class III) the radio peaks. Outer gap and slot gap (two-pole caustic) models best fit roughly equal numbers of Class I and II, while Class III are exclusively fit with pair-starved polar cap models. Distinguishing between the model classes based on typical derived parameters is difficult. We explore the evolution of the magnetic inclination angle with period and spin-down power, finding possible correlations. While the presence of significant off-peak emission can often be used as a discriminator between outer gap and slot gap models, a hybrid model may be needed
Processing of gamma-ray spectrometric logs
International Nuclear Information System (INIS)
Umiastowski, K.; Dumesnil, P.
1984-10-01
CEA (Commissariat a l'Energie Atomique) has developped a gamma-ray spectrometric tool, containing an analog-to-digital converter. This new tool permits to perform very precise uranium logs (natural gamma-ray spectrometry), neutron activation logs and litho-density logs (gamma-gamma spectrometric logs). Specific processing methods were developped to treate the particular problems of down-hole gamma-ray spectrometry. Extraction of the characteristic gamma-ray peak, even if they are superposed on the background radiation of very high intensity, is possible. This processing methode enables also to obtain geological informations contained in the continuous background of the spectrum. Computer programs are written in high level language for SIRIUS (VICTOR) and APOLLO computers. Exemples of uranium and neutron activation logs treatment are presented [fr
A link between prompt optical and prompt gamma-ray emission in gamma-ray bursts.
Vestrand, W T; Wozniak, P R; Wren, J A; Fenimore, E E; Sakamoto, T; White, R R; Casperson, D; Davis, H; Evans, S; Galassi, M; McGowan, K E; Schier, J A; Asa, J W; Barthelmy, S D; Cummings, J R; Gehrels, N; Hullinger, D; Krimm, H A; Markwardt, C B; McLean, K; Palmer, D; Parsons, A; Tueller, J
2005-05-12
The prompt optical emission that arrives with the gamma-rays from a cosmic gamma-ray burst (GRB) is a signature of the engine powering the burst, the properties of the ultra-relativistic ejecta of the explosion, and the ejecta's interactions with the surroundings. Until now, only GRB 990123 had been detected at optical wavelengths during the burst phase. Its prompt optical emission was variable and uncorrelated with the prompt gamma-ray emission, suggesting that the optical emission was generated by a reverse shock arising from the ejecta's collision with surrounding material. Here we report prompt optical emission from GRB 041219a. It is variable and correlated with the prompt gamma-rays, indicating a common origin for the optical light and the gamma-rays. Within the context of the standard fireball model of GRBs, we attribute this new optical component to internal shocks driven into the burst ejecta by variations of the inner engine. The correlated optical emission is a direct probe of the jet isolated from the medium. The timing of the uncorrelated optical emission is strongly dependent on the nature of the medium.
Observations of VHE γ-Ray Sources with the MAGIC Telescope
Bartko, H.
2008-10-01
The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.
Neutron and gamma-ray transport experiments in liquid air
International Nuclear Information System (INIS)
Farley, W.E.
1976-01-01
Accurate estimates of neutron and gamma radiations from a nuclear explosion and their subsequent transport through the atmosphere are vital to nuclear-weapon employment studies: i.e., for determining safety radii for aircraft crews, casualty and collateral-damage risk radii for tactical weapons, and the kill range from a high-yield defensive burst for a maneuvering reentry vehicle. Radiation transport codes, such as the Laboratory's TARTNP, are used to calculate neutron and gamma fluences. Experiments have been performed to check and update these codes. Recently, a 1.3-m-radius liquid-air (21 percent oxygen) sphere, with a pulsed source of 14-MeV neutrons at its center, was used to measure the fluence and spectra of emerging neutrons and secondary gamma rays. Comparison of measured radiation dose with TARTNP showed agreement within 10 percent
Stellar Sources of Gamma-ray Bursts
Luchkov, B. I.
2011-01-01
Correlation analysis of Swift gamma-ray burst coordinates and nearby star locations (catalog Gliese) reveals 4 coincidences with good angular accuracy. The random probability is 4\\times 10^{-5}, so evidencing that coincident stars are indeed gamma-ray burst sources. Some additional search of stellar gamma-ray bursts is discussed.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Xiaodong, E-mail: xzhang39@utk.edu [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Ayaz-Maierhafer, Birsen; Laubach, Mitchell A. [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Hayward, Jason P. [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Oak Ridge National Lab, Oak Ridge, TN 37831 (United States)
2015-06-01
A high energy gamma and x-ray LIDAR system consisting of a fast pulse (~50 ps, FWHM) LINAC and a Cherenkov detection system was used to investigate response differences among materials, their thicknesses, and bremsstrahlung x-ray intensities. The energies and pulse width of electrons used to produce bremsstrahlung x-rays were set at 20 or 40 MeV and 50 ps FWHM duration, respectively. The Cherenkov detector was built with a fused silica glass optically coupled to a 51 mm fast timing photomultiplier tube, which has an intrinsic energy threshold of 340.7 keV for Compton backscattered gammas. Such a fast detection system yields a coincidence resolving time of 93 ps FWHM, which is equivalent to a depth resolving capability of about 3 cm FWHM. The thicknesses of iron and lead targets were varied from 1 in. to 7 in. with a step of 1 in., and the thicknesses of DU were varied from 1/3 in. to 1 in. with a step of 1/3 in. The experimental results show that iron targets tend to produce a factor of five less observed x-rays and gammas, with less energetic photoelectron frequency distributions, compared with DU and lead targets for the same beam intensity and target thicknesses. Additionally, the self-shielding effect causes the lead to yield more gammas than the DU considering the experimental observation point. For the setup used in this study, a charge per pulse in the range of 1–2.5 nC yields the best resolving capability between the DU and lead targets.
Hard x-ray to low energy gamma ray spectrum of the Crab Nebula
International Nuclear Information System (INIS)
Jung, G.V.
1986-01-01
The spectrum of the Crab Nebula has been determined in the energy range 10 keV to 5 MeV from the data of the UCSD/MIT Hard-X-ray and Low Energy Gamma Ray Experiment on the first High Energy Astronomy Observatory, HEAO-1. The x-ray to γ-ray portion of the continuous emission from the Crab is indicative of the electron spectrum, its transport through the nebula, and the physical conditions near the shocked interface between the nebular region and the wind which is the physical link between the nebula and the pulsar, NP0532. The power-law dependence of the spectrum found in the lower-energy decade of this observation (10 to 100 keV) is not continued without modification to higher energies. Evidence for this has been accumulating from previous observations in the γ-ray ranges of 1-10 MeV and above 35 MeV. The observations on which this dissertation is based further characterize the spectral change in the 100 keV to 1 MeV region. These observations provide a crucial connection between the x-ray and γ-ray spectrum of the non-pulsed emission of the Crab Nebula. The continuity of this spectrum suggests that the emission mechanism responsible for the non-pulsed γ-rays observed above 35 MeV is of the same origin as the emission at lower energies, i.e. that of synchrotron radiation in the magnetic field of the nebula
Very high energy gamma ray astrophysics: Progress report, May 1, 1987-February 1, 1988
International Nuclear Information System (INIS)
Lamb, R.G.; Lewis, D.A.
1988-02-01
The Whipple observatory Gamma Ray Collaboration has continued to make steady progress in its development of a highly sensitive stereoscopic imaging gamma-ray telescope (known as the HERCULES project). The milestones in this year's development include: the demonstration of the success of the imaging concept with a single camera by the detection of a very weak flux of gamma rays from the Crab Nebula at a high level of statistical significance (7 sigma), the confirmation of our detection of an anomalous pulsed flux from Hercules X-1 in the summer of 1986 by two other groups; this result has serious implications for the mechanism for gamma-ray emission in this binary source. The construction and installation of the new high resolution camera on the 10 m reflector; the realistic simulation of the sensitivity of this camera as well as that of the full HERCULES system was also undertaken. These, and other highlights of this year's program at the Iowa State University and the Smithsonian Astrophysical Observatory, are discussed in this paper. 6 figs
Physical constraints on models of gamma-ray bursters
International Nuclear Information System (INIS)
Epstein, R.I.
1985-01-01
This report deals with the constraints that can be placed on models of gamma-ray burst sources based on only the well-established observational facts and physical principles. The premise is developed that the very hard x-ray and gamma-ray continua spectra are well-established aspects of gamma-ray bursts. Recent theoretical work on gamma-ray bursts are summarized with emphasis on the geometrical properties of the models. Constraints on the source models which are implied by the x-ray and gamma-ray spectra are described. The allowed ranges for the luminosity and characteristic dimension for gamma-ray burst sources are shown. Some of the deductions and inferences about the nature of the gamma-ray burst sources are summarized. 67 refs., 3 figs
Microwave-gamma ray water in crude monitor
International Nuclear Information System (INIS)
Paap, H.J.
1984-01-01
A microwave-gamma ray water-in-crude monitoring system measures the percent quantity of fresh water or salt water in crude oil flowing in a pipe line. The system includes a measuring cell arranged with the pipe line so that the crude oil flows through the measuring cell. A microwave transmitter subsystem and a gamma ray source are arranged with the measuring cell so that microwave energy and gamma rays are transmitted through the measuring cell. A microwave receiving subsystem and a gamma ray detector provide signals corresponding to received microwave energy and to the received gamma rays, respectively. Apparatus connected to the microwave receiver and to the gamma ray detector provides an indication of the percentage of water in the crude oil
International Nuclear Information System (INIS)
Cooper, C. M.; Pace, D. C.; Paz-Soldan, C.; Eidietis, N. W.; Commaux, N.; Shiraki, D.; Hollmann, E. M.
2016-01-01
A new gamma ray imager (GRI) is developed to probe the electron distribution function with 2D spatial resolution during runaway electron (RE) experiments at the DIII-D tokamak. The diagnostic is sensitive to 0.5–100 MeV gamma rays, allowing characterization of the RE distribution function evolution during RE growth and dissipation. The GRI consists of a lead “pinhole camera” mounted on the DIII-D midplane with 123 honeycombed tangential chords 20 cm wide that span the vessel interior. Up to 30 bismuth germanate (BGO) scintillation detectors capture RE bremsstrahlung radiation for Pulse Height Analysis (PHA) capable of discriminating up to 20 000 pulses per second. Digital signal processing routines combining shaping filters are performed during PHA to reject noise and record gamma ray energy. The GRI setup and PHA algorithms will be described and initial data from experiments will be presented. A synthetic diagnostic is developed to generate the gamma ray spectrum of a GRI channel given the plasma information and a prescribed distribution function. Magnetic reconstructions of the plasma are used to calculate the angle between every GRI sightline and orient and discriminate gamma rays emitted by a field-aligned RE distribution function.
Energy Technology Data Exchange (ETDEWEB)
Cooper, C. M., E-mail: coopercm@fusion.gat.com [Oak Ridge Associated Universities, Oak Ridge, Tennessee 37830 (United States); Pace, D. C.; Paz-Soldan, C.; Eidietis, N. W. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Commaux, N.; Shiraki, D. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37830 (United States); Hollmann, E. M. [University of California, San Diego, La Jolla, California 92093-0533 (United States)
2016-11-15
A new gamma ray imager (GRI) is developed to probe the electron distribution function with 2D spatial resolution during runaway electron (RE) experiments at the DIII-D tokamak. The diagnostic is sensitive to 0.5–100 MeV gamma rays, allowing characterization of the RE distribution function evolution during RE growth and dissipation. The GRI consists of a lead “pinhole camera” mounted on the DIII-D midplane with 123 honeycombed tangential chords 20 cm wide that span the vessel interior. Up to 30 bismuth germanate (BGO) scintillation detectors capture RE bremsstrahlung radiation for Pulse Height Analysis (PHA) capable of discriminating up to 20 000 pulses per second. Digital signal processing routines combining shaping filters are performed during PHA to reject noise and record gamma ray energy. The GRI setup and PHA algorithms will be described and initial data from experiments will be presented. A synthetic diagnostic is developed to generate the gamma ray spectrum of a GRI channel given the plasma information and a prescribed distribution function. Magnetic reconstructions of the plasma are used to calculate the angle between every GRI sightline and orient and discriminate gamma rays emitted by a field-aligned RE distribution function.
Energy Technology Data Exchange (ETDEWEB)
Shao, Lang; Wang, Fu-Ri; Cheng, Ye-Hao; Zhang, Xi; Yu, Bang-Yao; Xi, Bao-Jia; Wang, Xue; Feng, Huan-Xue; Zhang, Meng, E-mail: lshao@hebtu.edu.cn [Department of Space Sciences and Astronomy, Hebei Normal University, Shijiazhuang 050024 (China); Zhang, Bin-Bin [Instituto de Astrofísica de Andalucá (IAA-CSIC), P.O. Box 03004, E-18080 Granada (Spain); Wu, Xue-Feng [Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China); Xu, Dong [Key Laboratory of Space Astronomy and Technology, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2017-08-01
We carry out a systematical study of the spectral lag properties of 50 single-pulsed gamma-ray bursts (GRBs) detected by the Fermi Gamma-Ray Burst Monitor. By dividing the light curves into multiple consecutive energy channels, we provide a new measurement of the spectral lag that is independent of energy channel selections. We perform a detailed statistical study of our new measurements. We find two similar power-law energy dependencies of both the pulse arrival time and pulse width. Our new results on the power-law indices would favor the relativistic geometric effects for the origin of spectral lag. However, a complete theoretical framework that can fully account for the diverse energy dependencies of both arrival time and pulse width revealed in this work is still lacking. We also study the spectral evolution behaviors of the GRB pulses. We find that a GRB pulse with negligible spectral lag would usually have a shorter pulse duration and would appear to have a “hardness-intensity tracking” behavior, and a GRB pulse with a significant spectral lag would usually have a longer pulse duration and would appear to have a “hard-to-soft” behavior.
Remote planetary geochemical exploration with the NEAR X-ray/gamma-ray spectrometer
International Nuclear Information System (INIS)
Trombka, J.I.; Boynton, W.V.; Brueckner, J.; Squyres, S.; Clark, P.E.; Starr, R.; Evans, L.G.; Floyd, S.R.; McClanahan, T.P.; Goldsten, J.; Mcnutt, R.; Schweitzer, J.S.
1999-01-01
The X-ray/gamma-ray spectrometer (XGRS) instrument onboard the Near Earth Asteroid Rendezvous (NEAR) spacecraft will map asteroid 433 Eros in the 0.2 keV to 10 MeV energy region. Measurements of the discrete line X-ray and gamma-ray emissions in this energy domain can be used to obtain both qualitative and quantitative elemental composition maps of the asteroid surface. The NEAR X-ray/gamma-ray spectrometer (XGRS) was turned on for the first time during the week of 7 April 1996. Rendezvous with Eros 433 is expected during December 1998. Observations of solar X-ray spectra during both quiescent and active periods have been made. A gamma-ray transient detection system has been implemented and about three gamma-ray transient events a week have been observed which are associated with either gamma-ray bursts or solar flares
X-Ray Scattering Applications Using Pulsed X-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
Larson, B.C.
1999-05-23
Pulsed x-ray sources have been used in transient structural phenomena investigations for over fifty years; however, until the advent of synchrotrons sources and the development of table-top picosecond lasers, general access to ligh temporal resolution x-ray diffraction was relatively limited. Advances in diffraction techniques, sample excitation schemes, and detector systems, in addition to IncEased access to pulsed sources, have ld tO what is now a diverse and growing array of pulsed-source measurement applications. A survey of time-resolved investigations using pulsed x-ray sources is presented and research opportunities using both present and planned pulsed x-ray sources are discussed.
Multifrequency Observations of Gamma-Ray Burst
Greiner, J.
1995-01-01
Neither a flaring nor a quiescent counterpart to a gamma-ray burst has yet been convincingly identified at any wavelength region. The present status of the search for counterparts of classical gamma-ray bursts is given. Particular emphasis is put on the search for flaring counterparts, i.e. emission during or shortly after the gamma-ray emission.
Gamma-rays from deep inelastic collisions
International Nuclear Information System (INIS)
Stephens, F.S.
1981-01-01
My objective in this talk is to consider the question: 'What can be learned about deep inelastic collisions (DIC) from studying the associated gamma-rays'. First, I discuss the origin and nature of the gamma-rays from DIC, then the kinds of information gamma-ray spectra contain, and finally come to the combination of these two subjects. (orig./HSI)
Soft x-ray emission from gamma-ray bursts observed with ginga
International Nuclear Information System (INIS)
Yoshida, Atsumasa; Murakami, Toshio; Itoh, Masayuki
1989-01-01
The soft X-ray emission of gamma-ray bursts below 10 keV provides information about size, location, and emission mechanism. The Gamma-ray Burst Detector (GBD) on board Ginga, which consists of a proportional counter and a scintillation detector, covers an energy range down to 1.5 keV with 63 cm 2 effective area. In several of the observed gamma-ray bursts, the intensity of the soft X-ray emission showed a longer decay time of 50 to 100s after the higher energy gamma-ray emission had ended. Although we cannot rule out other models, such as bremsstrahlung and thermal cyclotron types, due to poor statistics, the soft X-ray spectra are consistent with a blackbody of 1 to 2 keV in the late phase of the gamma-ray bursts. This enables us to estimate the size of the blackbody responsible for the X-ray emission. (author)
The high intensity {gamma}-ray source (HI{gamma}S) and recent results
Energy Technology Data Exchange (ETDEWEB)
Tonchev, A.P. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States)]. E-mail: tonchev@tunl.duke.edu; Boswell, M. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Howell, C.R. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Karwowski, H.J. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Kelley, J.H. [North Carolina State University and TUNL, Raleigh, NC 27695 (United States); Tornow, W. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Wu, Y.K. [Duke University and Duke Free Electron Laser Laboratory, Durham, NC 27708-0319 (United States)
2005-12-15
The high intensity {gamma}-ray source (HI{gamma}S) utilizes intra-cavity backscattering of free electron laser photons from the Duke electron storage ring to produce a unique monoenergetic beam of high-flux {gamma}-rays with high polarization and selectable energy resolution. At present, {gamma}-ray beams with energies from 2 to 58 MeV are available with intensities as high as 10{sup 5}-5 x 10{sup 6} {gamma}/s, energy spreads of 3% or better, and nearly 100% linear polarization. The quality and intensity of the {gamma}-ray beams at HI{gamma}S are responsible for the unprecedented performance of this facility in a broad range of research programs in nuclear structure, nuclear astrophysics and nuclear applications. Recent results from excitation of isomeric states in ({gamma}, n) reactions and parity assignments of dipole states determined via the ({gamma}, {gamma}') reaction are presented.
Gamma-ray Output Spectra from 239 Pu Fission
International Nuclear Information System (INIS)
Ullmann, John
2015-01-01
Gamma-ray multiplicities, individual gamma-ray energy spectra, and total gamma energy spectra following neutron-induced fission of 239 Pu were measured using the DANCE detector at Los Alamos. Corrections for detector response were made using a forward-modeling technique based on propagating sets of gamma rays generated from a paramaterized model through a GEANT model of the DANCE array and adjusting the parameters for best fit to the measured spectra. The results for the gamma-ray spectrum and multiplicity are in general agreement with previous results, but the measured total gamma-ray energy is about 10% higher. A dependence of the gamma-ray spectrum on the gamma-ray multplicity was also observed. Global model calculations of the multiplicity and gamma energy distributions are in good agreement with the data, but predict a slightly softer total-energy distribution
X-ray and. gamma. -ray sources: a comparison of their characteristics
Energy Technology Data Exchange (ETDEWEB)
Freund, A K [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)
1979-11-01
A comparison of the various source characteristics, in particular the available fluxes of radiation in the X-ray/..gamma..-ray region from (1) high power rotary anode X-ray generators, (2) radioactive ..gamma..-ray sources and (3) high energy electron storage rings is presented. Some of the specific characteristics and possible applications of synchrotron radiation as a source are discussed in detail, together with problems associated with the monochromatization of the continuous radiation in the X-ray/..gamma..-ray region. The new high energy machines PEP at Stanford, the 8 GeV storage ring CESR at Cornell and the PETRA storage ring in Hamburg, which will soon come into operation provide a spectrum of high intensity radiation reaching well above h..gamma..sub(photon)=100 keV. The possibilities of using ondulators (wigglers), and laser-electron scattering for constructing high repetition rate tunable ..gamma..-ray sources are also discussed. Finally the potentials of using the powerful spontaneous emission of ..gamma..-quanta by relativistic channeled particles are mentioned.
Pellizza, L. J.
Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH
Design and Performance of the GAMMA-400 Gamma-Ray Telescope for Dark Matter Searches
Galper, A. M.; Adriani, O.; Aptekar, R. L.; Arkhangelskaja, I. V.; Arkhangelskiy, A. I.; Boezio, M.; Bonvicini, V.; Boyarchuk, K. A.; Fradkin, M. I.; Gusakov, Yu V.;
2012-01-01
The GAMMA-400 gamma-ray telescope is designed to measure the fluxes of gamma-rays and cosmic-ray electrons (+) positrons, which can be produced by annihilation or decay of the dark matter particles, as well as to survey the celestial sphere in order to study point and extended sources of gamma-rays, measure energy spectra of Galactic and extragalactic diffuse gamma-ray emission, gamma-ray bursts, and gamma-ray emission from the Sun. GAMMA-400 covers the energy range from 100 MeV to 3000 GeV. Its angular resolution is approximately 0.01deg (E(sub gamma) greater than 100 GeV), the energy resolution approximately 1% (E(sub gamma) greater than 10 GeV), and the proton rejection factor approximately 10(exp 6). GAMMA-400 will be installed on the Russian space platform Navigator. The beginning of observations is planned for 2018.
International Nuclear Information System (INIS)
Jun, I.; Kim, W.; Smith, M.; Mitrofanov, I.; Litvak, M.
2011-01-01
The surface elemental composition of Venus can be determined using an artificially pulsed 14 MeV neutron generator (PNG) combined with a gamma ray spectrometer (GRS). The 14 MeV neutrons will interact with the surface materials and generate gamma rays, characteristic of specific elements, whose energy spectrum will be measured by GRS. These characteristic gamma rays are produced mainly through 3 different neutron interaction mechanisms: capture, inelastic, and activation reactions. Each reaction type has a different neutron energy dependency and different time scale for gamma ray production and transport. Certain elements are more easily identified through one reaction type over the others. Thus, careful analysis of the gamma ray spectra during and after the neutron pulse provides a comprehensive understanding of the surface elemental composition. In this paper, we use a well-tested neutron/gamma transport code, called Monte Carlo N-Particles (MCNP), to investigate the measurement capability of a PNG-GRS detection system through the neutron activation reactions. An activation analysis was performed for a representative soil composition of Venus with a notional operational scenario of PNG and GRS. The analysis shows that the proposed instrument concept can identify most of the modeled surface elements at Venus with sufficient accuracy through the activation mode. Specifically, U, Th, K, Si can be measured to within 1%, Fe within 2%, Al within 10%, Ca within 5%, Mg with 15%, Mn with 20%, and Cl within 6%. Although modeled in the analysis, it is shown that the activation mode alone cannot distinguish the S and Ti peaks.
Thermal neutron capture gamma-rays
International Nuclear Information System (INIS)
Tuli, J.K.
1983-01-01
The energy and intensity of gamma rays as seen in thermal neutron capture are presented. Only those (n,α), E = thermal, reactions for which the residual nucleus mass number is greater than or equal to 45 are included. These correspond to evaluations published in Nuclear Data Sheets. The publication source data are contained in the Evaluated Nuclear Structure Data File (ENSDF). The data presented here do not involve any additional evaluation. Appendix I lists all the residual nuclides for which the data are included here. Appendix II gives a cumulated index to A-chain evaluations including the year of publication. The capture gamma ray data are given in two tables - the Table 1 is the list of all gamma rays seen in (n,#betta#) reaction given in the order of increasing energy; the Table II lists the gamma rays according to the nuclide
The Animated Gamma-ray Sky Revealed by the Fermi Gamma-ray Space Telescope
International Nuclear Information System (INIS)
Grenier, Isabelle
2009-01-01
The Fermi Gamma-ray Space Telescope has been observing the sky in gamma-rays since August 2008. In addition to breakthrough capabilities in energy coverage (20 MeV-300 GeV) and angular resolution, the wide field of view of the Large Area Telescope enables observations of 20% of the sky at any instant, and of the whole sky every three hours. It has revealed a very animated sky with bright gamma-ray bursts flashing and vanishing in minutes, powerful active galactic nuclei flaring over hours and days, many pulsars twinkling in the Milky Way, and X-ray binaries shimmering along their orbit. Most of these variable sources had not been seen by the Fermi predecessor, EGRET, and the wealth of new data already brings important clues to the origin of the high-energy emission and particles powered by the compact objects. The telescope also brings crisp images of the bright gamma-ray emission produced by cosmic-ray interactions in the interstellar medium, thus allowing to measure the cosmic nuclei and electron spectra across the Galaxy, to weigh interstellar clouds, in particular in the dark-gas phase. The telescope sensitivity at high energy will soon provide useful constraints on dark-matter annihilations in a variety of environments. I will review the current results and future prospects of the Fermi mission.
Sample analysis using gamma ray induced fluorescent X-ray emission
Energy Technology Data Exchange (ETDEWEB)
Sood, B S; Allawadhi, K L; Gandhi, R; Batra, O P; Singh, N [Punjabi Univ., Patiala (India). Nuclear Science Labs.
1983-01-01
A non-destructive method for the analysis of materials using gamma ray-induced fluorescent x-ray emission has been developed. In this method, special preparation of very thin samples in which the absorption of the incident gamma rays and the emitted fluorescent x-rays is negligible, is not needed, and the absorption correction is determined experimentally. A suitable choice of the incident gamma ray energies is made to minimise enhancement effects through selective photoionization of the elements in the sample. The method is applied to the analysis of a typical sample of the soldering material using 279 keV and 59.5 keV gamma rays from /sup 203/Hg and /sup 241/Am radioactive sources respectively. The results of the analysis are found to agree well with those obtained from the chemical analysis.
International Nuclear Information System (INIS)
Dubois, Florent
2009-01-01
H.E.S.S. (High Energy Stereoscopic System) is one of the leading systems of four Imaging Atmospheric Cherenkov Telescopes that investigates very high energy (VHE) cosmic gamma-rays in the 100 GeV to 100 TeV energy range. H.E.S.S. is located in Namibia, near the Gamsberg mountain and operational since December 2003. The H.E.S.S. experiment is mainly aimed to the observation of the southern sky including the galactic plan and the numerous astrophysics sources therein. Three analysis methods have been developed using various properties of the electromagnetic showers generated by the interaction of primary cosmic gamma-rays within the Earth atmosphere. The first goal of this thesis was to combine the information from these methods for the selection and the energy and direction reconstruction of gamma-ray events. The new analysis called X eff improves significantly the quality of the selection and the precision of the reconstruction. This analysis has been afterwards applied to the study of pulsar wind nebulae like Vela X, G0.9+0.1 and MSH 15-52. New results were found concerning the source extension (Vela X) or spectral analysis (G0.9+0.1 and MSH 15-52) at TeV energies, thanks to additional data and to the improved efficiency of the new method. In 2010, a new phase will begin with the achievement of a fifth telescope dedicated to gamma-ray observation from tens GeV. The calibration processes of the photomultipliers equipping the camera of the new telescope, as well as the results of the tests, are also described in this thesis. (author)
Gamma-rays generated from plasmas in the interaction of solid targets with femtosecond laser pulses
International Nuclear Information System (INIS)
He Jingtang; Zhang Ping; Chen Duanbao; Li Zuhao; Tang Xiaowei; Zhang Ying; Wang Long; Feng Baohua; Zhang Xiulan; Wei Zhiyi; Li Zanliang; Zhang Jie
1998-01-01
The γ-rays with energies up to 300 keV have been observed from plasmas produced by femtosecond laser pulses at a focused intensity of 5 x 10 15 W·cm -2 ·μm 2 irradiating Ta, Mo and Cu targets. By introducing an 8% prepulse of 70 ps before the main pulse, the fraction of high energy γ-ray photons (hν>100 keV) was significantly enhanced relative to low energy photons (hν<100 keV)
Terrestrial gamma-ray flash production by lightning
Carlson, Brant E.
Terrestrial gamma-ray flashes (TGFs) are brief flashes of gamma-rays originating in the Earth's atmosphere and observed by satellites. First observed in 1994 by the Burst And Transient Source Experiment on board the Compton Gamma-Ray Observatory, TGFs consist of one or more ˜1 ms pulses of gamma-rays with a total fluence of ˜1/cm2, typically observed when the satellite is near active thunderstorms. TGFs have subsequently been observed by other satellites to have a very hard spectrum (harder than dN/d E ∝ 1/ E ) that extends from below 25 keV to above 20 MeV. When good lightning data exists, TGFs are closely associated with measurable lightning discharge. Such discharges are typically observed to occur within 300 km of the sub-satellite point and within several milliseconds of the TGF observation. The production of these intense energetic bursts of photons is the puzzle addressed herein. The presence of high-energy photons implies a source of bremsstrahlung, while bremsstrahlung implies a source of energetic electrons. As TGFs are associated with lightning, fields produced by lightning are naturally suggested to accelerate these electrons. Initial ideas about TGF production involved electric fields high above thunderstorms as suggested by upper atmospheric lightning research and the extreme energies required for lower-altitude sources. These fields, produced either quasi-statically by charges in the cloud and ionosphere or dynamically by radiation from lightning strokes, can indeed drive TGF production, but the requirements on the source lightning are too extreme and therefore not common enough to account for all existing observations. In this work, studies of satellite data, the physics of energetic electron and photon production, and consideration of lightning physics motivate a new mechanism for TGF production by lightning current pulses. This mechanism is then developed and used to make testable predictions. TGF data from satellite observations are compared
ICIT contribution to JET gamma-ray diagnostics enhancement
International Nuclear Information System (INIS)
Soare, S.; Curuia, M.; Zoita, V.
2010-01-01
Full text: Gamma-ray emission of tokamak plasmas is the result of the interaction of fast ions (fusion reaction products, including alpha particles, NBI ions, ICRH-accelerated ions) with main plasma impurities (e.g., carbon, beryllium). Gamma-ray diagnostics involve both gamma-ray imaging (cameras) and gamma-ray spectrometry (spectrometers). For the JET tokamak, gamma-ray diagnostics have been used to provide information on the characteristics of the fast ion population in plasmas. Two gamma-ray diagnostics enhancements project have been launched by JET and the MEdC/EURATOM Association has agreed to lead both of them with ICIT as projects leader. (authors)
Gamma-ray burst observations: the present situation
International Nuclear Information System (INIS)
Vedrenne, G.
1984-01-01
Recent results in gamma ray burst investigations concerning the spectral variability on a short time scale, precise locations, and the discovery of optical flashes in gamma ray burst positions on archival plates are presented. The implications of optical and X-ray observations of gamma ray burst error boxes are also discussed. 72 references
Found: A Galaxy's Missing Gamma Rays
Kohler, Susanna
2016-04-01
Recent reanalysis of data from the Fermi Gamma-ray Space Telescope has resulted in the first detection of high-energy gamma rays emitted from a nearby galaxy. This discovery reveals more about how supernovae interact with their environments.Colliding Supernova RemnantAfter a stellar explosion, the supernovas ejecta expand, eventually encountering the ambient interstellar medium. According to models, this generates a strong shock, and a fraction of the kinetic energy of the ejecta is transferred into cosmic rays high-energy radiation composed primarily of protons and atomic nuclei. Much is still unknown about this process, however. One open question is: what fraction of the supernovas explosion power goes into accelerating these cosmic rays?In theory, one way to answer this is by looking for gamma rays. In a starburst galaxy, the collision of the supernova-accelerated cosmic rays with the dense interstellar medium is predicted to produce high-energy gamma rays. That radiation should then escape the galaxy and be visible to us.Pass 8 to the RescueObservational tests of this model, however, have beenstumped by Arp 220. This nearby ultraluminous infrared galaxy is the product of a galaxy merger ~700 million years ago that fueled a frenzy of starbirth. Due to its dusty interior and extreme levels of star formation, Arp 220 has long been predicted to emit the gamma rays produced by supernova-accelerated cosmic rays. But though weve looked, gamma-ray emission has never been detected from this galaxy until now.In a recent study, a team of scientists led by Fang-Kun Peng (Nanjing University) reprocessed 7.5 years of Fermi observations using the new Pass 8 analysis software. The resulting increase in resolution revealed the first detection of GeV emission from Arp 220!Acceleration EfficiencyGamma-ray luminosity vs. total infrared luminosity for LAT-detected star-forming galaxies and Seyferts. Arp 220s luminosities are consistent with the scaling relation. [Peng et al. 2016
Multiwavelength Study of Gamma-Ray Bright Blazars
Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.
2011-01-01
We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.
A library least-squares approach for scatter correction in gamma-ray tomography
International Nuclear Information System (INIS)
Meric, Ilker; Anton Johansen, Geir; Valgueiro Malta Moreira, Icaro
2015-01-01
Scattered radiation is known to lead to distortion in reconstructed images in Computed Tomography (CT). The effects of scattered radiation are especially more pronounced in non-scanning, multiple source systems which are preferred for flow imaging where the instantaneous density distribution of the flow components is of interest. In this work, a new method based on a library least-squares (LLS) approach is proposed as a means of estimating the scatter contribution and correcting for this. The validity of the proposed method is tested using the 85-channel industrial gamma-ray tomograph previously developed at the University of Bergen (UoB). The results presented here confirm that the LLS approach can effectively estimate the amounts of transmission and scatter components in any given detector in the UoB gamma-ray tomography system. - Highlights: • A LLS approach is proposed for scatter correction in gamma-ray tomography. • The validity of the LLS approach is tested through experiments. • Gain shift and pulse pile-up affect the accuracy of the LLS approach. • The LLS approach successfully estimates scatter profiles
Gamma-Ray Emission from Galaxy Clusters : DARK MATTER AND COSMIC-RAYS
Pinzke, Anders
The quest for the first detection of a galaxy cluster in the high energy gamma-ray regime is ongoing, and even though clusters are observed in several other wave-bands, there is still no firm detection in gamma-rays. To complement the observational efforts we estimate the gamma-ray contributions from both annihilating dark matter and cosmic-ray (CR) proton as well as CR electron induced emission. Using high-resolution simulations of galaxy clusters, we find a universal concave shaped CR proton spectrum independent of the simulated galaxy cluster. Specifically, the gamma-ray spectra from decaying neutral pions, which are produced by CR protons, dominate the cluster emission. Furthermore, based on our derived flux and luminosity functions, we identify the galaxy clusters with the brightest galaxy clusters in gamma-rays. While this emission is challenging to detect using the Fermi satellite, major observations with Cherenkov telescopes in the near future may put important constraints on the CR physics in clusters. To extend these predictions, we use a dark matter model that fits the recent electron and positron data from Fermi, PAMELA, and H.E.S.S. with remarkable precision, and make predictions about the expected gamma-ray flux from nearby clusters. In order to remain consistent with the EGRET upper limit on the gamma-ray emission from Virgo, we constrain the minimum mass of substructures for cold dark matter halos. In addition, we find comparable levels of gamma-ray emission from CR interactions and dark matter annihilations without Sommerfeld enhancement.
Gamma ray emission from pulsars
International Nuclear Information System (INIS)
Salvati, M.; Massaro, E.
1978-01-01
A model for the production of gamma rays in a pulsar environment is presented, together with numerical computations fitted to the observations of PSR 0833-45. It is assumed that the primary particles are accelerated close to the star surface and then injected along the open field lines, which cause them to emit curvature radiation. The equation describing the particles' braking is integrated exactly up to the first order in the pulsar rotational frequency, and the transfer problem for the curvature photons is solved with the aberration, the Doppler shif, and the pair production absorption being taken into account. The latter effect is due not only to the transverse component of the magnetic field, but also to the electric field induced by the rotation. The synchrotron radiation emitted by the secondary particles is also included, subject to the 'on-the-spot' approximation. It is found that the observed gamma rays originate in the innermost regions of the magnetosphere, where the open lines' bundle is narrow and the geometrical beaming is effective. As shown by the computed pulse profiles, the duty cycle turns out to be equal to a few percent, comparable to the one of PSR 0833-45. The averaged spectra indicate that a substantial fraction of the primary photons do outlive the interaction with the magnetisphere; furthermore, the agreement in shape with the observational curves suggests that the acceleration output is fiarly close to a monoenergetic beam of particles. (orig.) [de
Neutron detection gamma ray sensitivity criteria
International Nuclear Information System (INIS)
Kouzes, Richard T.; Ely, James H.; Lintereur, Azaree T.; Mace, Emily K.; Stephens, Daniel L.; Woodring, Mitchell L.
2011-01-01
The shortage of 3 He has triggered the search for effective alternative neutron detection technologies for national security and safeguards applications. Any new detection technology must satisfy two basic criteria: (1) it must meet a neutron detection efficiency requirement, and (2) it must be insensitive to gamma-ray interference at a prescribed level, while still meeting the neutron detection requirement. It is the purpose of this paper to define measureable gamma ray sensitivity criteria for neutron detectors. Quantitative requirements are specified for: intrinsic gamma ray detection efficiency and gamma ray absolute rejection. The gamma absolute rejection ratio for neutrons (GARRn) is defined, and it is proposed that the requirement for neutron detection be 0.9 3 He based neutron detector is provided showing that this technology can meet the stated requirements. Results from tests of some alternative technologies are also reported.
Steady-state emission of blazars at very high energies
Energy Technology Data Exchange (ETDEWEB)
Hoehne-Moench, Daniel
2010-07-01
One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018
Evaluation of gamma-ray intensities
International Nuclear Information System (INIS)
Yoshizawa, Yasukazu; Inoue, Hikaru; Hoshi, Masaharu; Shizuma, Kiyoshi; Iwata, Yosei.
1980-04-01
Relative intensities and intensities per decay of gamma rays were evaluated for 16 nuclides, 22 Na, 24 Na, 46 Sc, 54 Mn, 60 Co, 85 Sr, 88 Y, 95 Nb, sup(108m)Ag, 134 Cs, 133 Ba, 139 Ce, sup(180m)Hf, 198 Au, 203 Hg and 207 Bi. For most of these nuclides disintegration rates can be determined by means of β-γ or X-γ coincidence method. Since decay schemes of these nuclides are established, intensities per decay of strong gamma rays were accurately evaluated by using weak beta-ray branching ratios, relative gamma-ray intensities and internal conversion coefficients. Half-lives of the nuclides were also evaluated. Use of the nuclides, therefore, are recommended for precision intensity calibration of the detectors. (author)
A search for fast radio bursts associated with gamma-ray bursts
International Nuclear Information System (INIS)
Palaniswamy, Divya; Wayth, Randall B.; Trott, Cathryn M.; Tingay, Steven J.; Reynolds, Cormac; McCallum, Jamie N.
2014-01-01
The detection of seven fast radio bursts (FRBs) has recently been reported. FRBs are short duration (∼1 ms), highly dispersed radio pulses from astronomical sources. The physical interpretation for the FRBs remains unclear but is thought to involve highly compact objects at cosmological distance. It has been suggested that a fraction of FRBs could be physically associated with gamma-ray bursts (GRBs). Recent radio observations of GRBs have reported the detection of two highly dispersed short duration radio pulses using a 12 m radio telescope at 1.4 GHz. Motivated by this result, we have performed a systematic and sensitive search for FRBs associated with GRBs. We have observed five GRBs at 2.3 GHz using a 26 m radio telescope located at the Mount Pleasant Radio Observatory, Hobart. The radio telescope was automated to rapidly respond to Gamma-ray Coordination Network notifications from the Swift satellite and slew to the GRB position within ∼140 s. The data were searched for pulses up to 5000 pc cm –3 in dispersion measure and pulse widths ranging from 640 μs to 25.60 ms. We did not detect any events ≥6σ. An in depth statistical analysis of our data shows that events detected above 5σ are consistent with thermal noise fluctuations only. A joint analysis of our data with previous experiments shows that previously claimed detections of FRBs from GRBs are unlikely to be astrophysical. Our results are in line with the lack of consistency noted between the recently presented FRB event rates and GRB event rates.
Local gamma ray events as tests of the antimatter theory of gamma ray bursts
International Nuclear Information System (INIS)
Sofia, S.; Wilson, R.E.
1976-01-01
Nearby examples of the antimatter 'chunks' postulated by Sofia and Van Horn to explain the cosmic gamma ray bursts may produce detectable gamma ray events when struck by solar system meteoroids. These events would have a much shorter time scale and higher energy spectrum than the bursts already observed. In order to have a reasonably high event rate, the local meteoroid population must extend to a distance from the Sun of the order of 0.1 pc, but the required distance could become much lower if the instrumental threshold is improved. The expected gamma ray flux for interaction of the antimatter bodies with the solar wind is also examined, and found to be far below present instrumental capabilities. (Auth.)
Gehrels, Neil; Meszaros, Peter
2012-01-01
Gamma-ray bursts (GRBs) are bright flashes of gamma-rays coming from the cosmos. They occur roughly once per day ,last typically lOs of seconds and are the most luminous events in the universe. More than three decades after their discovery, and after pioneering advances from space and ground experiments, they still remain mysterious. The launch of the Swift and Fermi satellites in 2004 and 2008 brought in a trove of qualitatively new data. In this review we survey the interplay between these recent observations and the theoretical models of the prompt GRB emission and the subsequent afterglows.
Discoveries by the Fermi Gamma Ray Space Telescope
Gehrels, Neil
2011-01-01
Fermi is a large space gamma-ray mission developed by NASA and the DOE with major contributions from France, Germany, Italy, Japan and Sweden. It was launched in June 2008 and has been performing flawlessly since then. The main instrument is the Large Area Telescope (LAT) operating in the 20 MeV to 300 GeV range and a smaller monitor instrument is the Gamma-ray Burst Monitor (GBM) operating in the 8 keV to 40 MeV range. New findings are occurring every week. Some of the key discoveries are: 1) Discovery of many new gamma-ray pulsars, including gamma-ray only and millisecond pulsars. 2) Detection of high energy gamma-ray emission from globular clusters, most likely due to summed emission from msec pulsars. 3) Discovery of delayed and extended high energy gamma-ray emission from short and long gamma-ray busts. 4) Detection of approximately 250 gamma-ray bursts per year with the GBM instrument. 5) Most accurate measurement of the cosmic ray electron spectrum between 30 GeV and 1 TeV, showing some excess above the conventional diffusion model. The talk will present the new discoveries and their implications.
Feasibility study of gamma-ray medical radiography
International Nuclear Information System (INIS)
Alyassin, Abdalmajeid M.; Maqsoud, Hamza A.; Mashat, Ahmad M.; Al-Mohr, Al-Sayed; Abdulwajid, Subhan
2013-01-01
This research explores the feasibility of using gamma-ray radiography in medical imaging. We will show that gamma-ray medical radiography has the potential to provide alternative diagnostic medical information to X-ray radiography. Approximately one Ci Am-241 radioactive source which emits mono-energetic 59.5 keV gamma rays was used. Several factors that influence the feasibility of this study were tested. They were the radiation source uniformity, image uniformity, and image quality parameters such as contrast, noise, and spatial resolution. In addition, several gamma-ray and X-ray images were acquired using humanoid phantoms. These images were recorded on computed radiography image receptors and displayed on a standard monitor. Visual assessments of these images were then conducted. The Am-241 radioactive source provided relatively uniform radiation exposure and images. Image noise and image contrast were mainly dependent on the exposure time and source size, whereas spatial resolution was dependent on source size and magnification factor. The gamma-ray humanoid phantom images were of lower quality than the X-ray images mainly due to the low radioactivity used and not enough exposure time. Nevertheless, the gamma-ray images displayed most of the main structures contained in the humanoid phantoms. Higher exposure rates and thus lower exposure times were estimated for different pure Am-241 source sizes that are hypothesized to provide high quality images similar to X-ray images. For instance, a 10 mm source size of pure Am-241 with 7 s exposure time should produce images similar in contrast and noise to X-ray images. This research paves the way for the production and usage of a highly radioactive Am-241 source with the potential to lead to the feasibility of acceptable quality medical gamma-ray radiography. - Highlights: ► Characterized the performance of gamma-ray radiography. ► Displayed medical images of humanoid phantoms using gamma radiography. ► Am-241
Advanced gamma ray balloon experiment ground checkout and data analysis
Blackstone, M.
1976-01-01
A software programming package to be used in the ground checkout and handling of data from the advanced gamma ray balloon experiment is described. The Operator's Manual permits someone unfamiliar with the inner workings of the software system (called LEO) to operate on the experimental data as it comes from the Pulse Code Modulation interface, converting it to a form for later analysis, and monitoring the program of an experiment. A Programmer's Manual is included.
Gamma-ray transients and related astrophysical phenomena
International Nuclear Information System (INIS)
Lingenfelter, R.E.; Hudson, H.S.; Worrall, D.M.
1982-01-01
The workshop covered the study of the explosive phenomena responsible for the various gamma ray transients. X-ray burster observations and theories were also reviewed with emphasis on their relationship to gamma ray bursts. Recent observational data, particularly from the SMM, HEAO, and VENERA satellites made the workshop especially timely. Major headings include: gamma-ray transients, x-ray bursts, solar transients, and instrumental concepts. Individual items from the workshop were prepared separately for the data base
Cosmic gamma-ray background radiation. Current understandings and problems
International Nuclear Information System (INIS)
Inoue, Yoshiyuki
2015-01-01
The cosmic gamma-ray background radiation is one of the most fundamental observables in the gamma-ray band. Although the origin of the cosmic gamma-ray background radiation has been a mystery for a long time, the Fermi gamma-ray space telescope has recently measured it at 0.1-820 GeV and revealed that the cosmic GeV gamma-ray background is composed of blazars, radio galaxies, and star-forming galaxies. However, Fermi still leaves the following questions. Those are dark matter contribution, origins of the cosmic MeV gamma-ray background, and the connection to the IceCube TeV-PeV neutrino events. In this proceeding, I will review the current understandings of the cosmic gamma-ray background and discuss future prospects of cosmic gamma-ray background radiation studies. (author)
Gamma-Ray Interactions for Reachback Analysts
Energy Technology Data Exchange (ETDEWEB)
Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Myers, Steven Charles [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-08-02
This presentation is a part of the DHS LSS spectroscopy training course and presents an overview of the following concepts: identification and measurement of gamma rays; use of gamma counts and energies in research. Understanding the basic physics of how gamma rays interact with matter can clarify how certain features in a spectrum were produced.
Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong
2014-01-01
It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.
International Nuclear Information System (INIS)
Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao
2014-01-01
It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)
Gamma-ray spectrometry applied to down-hole logging
International Nuclear Information System (INIS)
Dumesnil, P.; Umiastowsky, K.
1983-11-01
Gamma-ray spectrometry permits to improve the accuracy of natural gamma, gamma-gamma and neutron-gamma geophysical measurements. The probe developed at Centre d'Etudes Nucleaires de Saclay allows down-hole gamma-ray spectrometry. Among others, this probe can be applied to the uranium content determination by selective natural gamma method, down-hole determination of the ash content in the coal by gamma-gamma selective method and elemental analysis by neutron-gamma method. For the calibration and an exact interpretation of the measurements it is important to know the gamma-ray and neutron characteristics of the different kinds of rocks considered as probabilistic variables
Gamma-Ray Imaging Spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy
International Nuclear Information System (INIS)
Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; Maccallum, C.J.; Stang, P.D.; Sandia Labs., Albuquerque, NM)
1985-01-01
High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload, a balloon program was initiated to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments
High-energy gamma-ray emission in compact binaries
International Nuclear Information System (INIS)
Cerutti, Benoit
2010-01-01
Four gamma-ray sources have been associated with binary systems in our Galaxy: the micro-quasar Cygnus X-3 and the gamma-ray binaries LS I +61 degrees 303, LS 5039 and PSR B1259-63. These systems are composed of a massive companion star and a compact object of unknown nature, except in PSR B1259-63 where there is a young pulsar. I propose a comprehensive theoretical model for the high-energy gamma-ray emission and variability in gamma-ray emitting binaries. In this model, the high-energy radiation is produced by inverse Compton scattering of stellar photons on ultra-relativistic electron-positron pairs injected by a young pulsar in gamma-ray binaries and in a relativistic jet in micro-quasars. Considering anisotropic inverse Compton scattering, pair production and pair cascade emission, the TeV gamma-ray emission is well explained in LS 5039. Nevertheless, this model cannot account for the gamma-ray emission in LS I +61 degrees 303 and PSR B1259-63. Other processes should dominate in these complex systems. In Cygnus X-3, the gamma-ray radiation is convincingly reproduced by Doppler-boosted Compton emission of pairs in a relativistic jet. Gamma-ray binaries and micro-quasars provide a novel environment for the study of pulsar winds and relativistic jets at very small spatial scales. (author)
Gamma-rays from decaying dark matter
Energy Technology Data Exchange (ETDEWEB)
Bertone, G. [Paris-6 Univ., 75 (France). Inst. d' Astrophysique; Buchmueller, W.; Covi, L.; Ibarra, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2007-10-15
We study the prospects for detecting gamma-rays from decaying Dark Matter (DM), focusing in particular on gravitino DM in R-parity breaking vacua. Given the substantially different angular distribution of the predicted gamma-ray signal with respect to the case of annihilating DM, and the relatively poor (of order 0.1 ) angular resolution of gamma-ray detectors, the best strategy for detection is in this case to look for an exotic contribution to the gamma-ray flux at high galactic latitudes, where the decaying DM contribution would resemble an astrophysical extragalactic component, similar to the one inferred by EGRET observations. Upcoming experiments such as GLAST and AMS-02 may identify this exotic contribution and discriminate it from astrophysical sources, or place significant constraints on the mass and lifetime of DM particles. (orig.)
Study of X-rays and nuclear gamma -rays in muonic thallium
Backe, H; Jahnke, U; Kankeleit, E; Pearce, R M; Petitjean, C; Schellenberg, L; Schneuwly, H; Schröder, W U; Walter, H K; Zehnder, A
1972-01-01
Energies and intensities of muonic X-rays, nuclear gamma -rays and mu -capture gamma -rays were measured in natural muonic thallium with Ge (Li) detectors. The absolute intensities of higher mu X-rays were reproduced by a cascade calculation starting with a statistical population at n=20 including K-, L- and M-conversion. The electron screening effect was deduced from energies of higher mu X-rays. Eight prompt nuclear gamma -rays were found. This excitation explains the anomalous intensity ratios of the 2p-1s and 3d-2p fine structure components. From the nuclear gamma -rays of the first excited states were deduced: the magnetic h.f. splittings, muonic isomer shifts E2/M1 mixing ratios and the half-life in the presence of the muon in /sup 205/Tl. Evidence for a magnetic nuclear polarization was found. An isotope shift of Delta E=10.35+or-0.25 keV was measured for the 1s/sub 1/2/ state which is compared with data from optical spectroscopy. From an analysis of the time distribution of delayed gamma -rays from mu...
SYSTEMATIC STUDY OF GAMMA-RAY-BRIGHT BLAZARS WITH OPTICAL POLARIZATION AND GAMMA-RAY VARIABILITY
Energy Technology Data Exchange (ETDEWEB)
Itoh, Ryosuke; Fukazawa, Yasushi; Kanda, Yuka; Shiki, Kensei; Kawabata, Miho; Nakaoka, Tatsuya; Takaki, Katsutoshi; Takata, Koji; Ui, Takahiro [Department of Physical Science, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Nalewajko, Krzysztof; Madejski, Greg M. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Stanford University, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Uemura, Makoto; Tanaka, Yasuyuki T.; Kawabata, Koji S.; Akitaya, Hiroshi; Ohsugi, Takashi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Schinzel, Frank K. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Moritani, Yuki [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo Institutes for Advanced Study, The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Sasada, Mahito [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Yamanaka, Masayuki, E-mail: itoh@hep01.hepl.hiroshima-u.ac.jp, E-mail: itoh@hp.phys.titech.ac.jp [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); and others
2016-12-10
Blazars are highly variable active galactic nuclei that emit radiation at all wavelengths from radio to gamma rays. Polarized radiation from blazars is one key piece of evidence for synchrotron radiation at low energies, and it also varies dramatically. The polarization of blazars is of interest for understanding the origin, confinement, and propagation of jets. However, even though numerous measurements have been performed, the mechanisms behind jet creation, composition, and variability are still debated. We performed simultaneous gamma-ray and optical photopolarimetry observations of 45 blazars between 2008 July and 2014 December to investigate the mechanisms of variability and search for a basic relation between the several subclasses of blazars. We identify a correlation between the maximum degree of optical linear polarization and the gamma-ray luminosity or the ratio of gamma-ray to optical fluxes. Since the maximum polarization degree depends on the condition of the magnetic field (chaotic or ordered), this result implies a systematic difference in the intrinsic alignment of magnetic fields in parsec-scale relativistic jets between different types of blazars (flat-spectrum radio quasars vs. BL Lacs) and consequently between different types of radio galaxies (FR I versus FR II).
Gamma-ray spectroscopy on irradiated fuel rods
International Nuclear Information System (INIS)
Terremoto, Luis Antonio Albiac
2009-01-01
The recording of gamma-ray spectra along an irradiated fuel rod allows the fission products to be qualitatively and quantitatively examined. Among all nondestructive examinations performed on irradiated fuel rods by gamma-ray spectroscopy, the most comprehensive one is the average burnup measurement, which is quantitative. Moreover, burnup measurements by means of gamma-ray spectroscopy are less time-consuming and waste-generating than burnup measurements by radiochemical, destructive methods. This work presents the theoretical foundations and experimental techniques necessary to measure, using nondestructive gamma-ray spectroscopy, the average burnup of irradiated fuel rods in a laboratory equipped with hot cells. (author)
The GAMMA Ray Sky as Seen by Fermi: Opening a New Window on the High Energy Space Environment
2009-01-01
important early discoveries of Fermi have been from objects in our galaxy. The LAT has discovered 12 new pulsars that seem to be visible only in gamma...have now been discov- ered by LAT. Finally, the discovery of pulsed gamma rays from several radio pulsars with millisecond spin periods, previously... pulsars , stars whose repeating emissions can be used as ultra-precise chronometers. Measurement of gamma radiation provides unique insight
GAMMA RAYS FROM STAR FORMATION IN CLUSTERS OF GALAXIES
International Nuclear Information System (INIS)
Storm, Emma M.; Jeltema, Tesla E.; Profumo, Stefano
2012-01-01
Star formation in galaxies is observed to be associated with gamma-ray emission, presumably from non-thermal processes connected to the acceleration of cosmic-ray nuclei and electrons. The detection of gamma rays from starburst galaxies by the Fermi Large Area Telescope (LAT) has allowed the determination of a functional relationship between star formation rate and gamma-ray luminosity. Since star formation is known to scale with total infrared (8-1000 μm) and radio (1.4 GHz) luminosity, the observed infrared and radio emission from a star-forming galaxy can be used to quantitatively infer the galaxy's gamma-ray luminosity. Similarly, star-forming galaxies within galaxy clusters allow us to derive lower limits on the gamma-ray emission from clusters, which have not yet been conclusively detected in gamma rays. In this study, we apply the functional relationships between gamma-ray luminosity and radio and IR luminosities of galaxies derived by the Fermi Collaboration to a sample of the best candidate galaxy clusters for detection in gamma rays in order to place lower limits on the gamma-ray emission associated with star formation in galaxy clusters. We find that several clusters have predicted gamma-ray emission from star formation that are within an order of magnitude of the upper limits derived in Ackermann et al. based on non-detection by Fermi-LAT. Given the current gamma-ray limits, star formation likely plays a significant role in the gamma-ray emission in some clusters, especially those with cool cores. We predict that both Fermi-LAT over the course of its lifetime and the future Cerenkov Telescope Array will be able to detect gamma-ray emission from star-forming galaxies in clusters.
A Liquid-Cryogen-Free Cryostat for Ultrahigh Resolution Gamma-Ray Spectrometers
International Nuclear Information System (INIS)
Dreyer, J.G.; Hertrich, T.; Drury, O.B.; Hohne, J.; Friedrich, S.
2008-01-01
We are developing ultra-high energy resolution gamma-ray detectors based on superconducting transition edge sensors (TESs) for nuclear non-proliferation and fundamental science applications. They use bulk tin absorbers attached to molybdenum-copper multilayer TESs, and have achieved an energy resolution between 50 and 90 eV FWHM for gamma-ray energies below 122 keV. For increased user-friendliness, we have built a cryostat that attains the required detector operating temperature of 0.1 K at the push of a button without the use of cryogenic liquids. It uses a two-stage mechanical pulse tube refrigerator for precooling to ∼3 K, and a two-stage adiabatic demagnetization refrigerator for cooling to the base temperature. The cryostat is fully automated, attains a base temperature below 30 mK without the use of cryogenic liquids, and has a hold time of ∼2 days at 0.1 K between 1-hour demagnetization cycles. Here we discuss the performance of the cryostat for operation in a Gamma-spectrometer with 112-pixel arrays of superconducting TES detectors
Detection of SNM by delayed gamma rays from induced fission
International Nuclear Information System (INIS)
Rennhofer, H.; Crochemore, J.-M.; Roesgen, E.; Pedersen, B.
2011-01-01
The Pulsed Neutron Interrogation Test Assembly (PUNITA) is an experimental device for research in NDA methods and field applicable instrumentation for nuclear safeguards and security applications. PUNITA incorporates a standard 14-MeV (D-T) pulsed neutron generator inside a large graphite mantle. The generator target is surrounded by a thick tungsten filter with the purpose to increase the neutron output and to tailor the neutron energy spectrum. In this configuration a sample may be exposed to a relatively high average thermal neutron flux of about (2.2±0.1)x10 3 s -1 cm -2 at only 10% of the maximum target neutron emission. The sample cavity is large enough to allow variation of the experimental setup including the fissile sample, neutron and gamma detectors, and shielding materials. The response from SNM samples of different fissile material content was investigated with various field-applicable scintillation gamma detectors such as the 3x2 in. LaBr 3 detector. Shielding in the form of tungsten and cadmium was applied to the detector to improve the signal to background ratio. Gamma and neutron shields surrounding the samples were also tested for the purpose of simulating clandestine conduct. The energy spectra of delayed gamma rays were recorded in the range 100 keV-9 MeV. In addition time spectra of delayed gamma rays in the range 3.3-8 MeV were recorded in the time period of 10 ms-120 s after the 14-MeV neutron burst. The goal of the experiment was to optimize the sample/detector configuration including the energy range and time period for SNM detection. The results show, for example, that a 170 g sample of depleted uranium can be detected with the given setup in less than 3 min of investigation. Samples of higher enrichment or higher mass are detected in much shorter time.
Upgrade of the JET gamma-ray cameras
International Nuclear Information System (INIS)
Soare, S.; Curuia, M.; Anghel, M.; Constantin, M.; David, E.; Craciunescu, T.; Falie, D.; Pantea, A.; Tiseanu, I.; Kiptily, V.; Prior, P.; Edlington, T.; Griph, S.; Krivchenkov, Y.; Loughlin, M.; Popovichev, S.; Riccardo, V; Syme, B.; Thompson, V.; Lengar, I.; Murari, A.; Bonheure, G.; Le Guern, F.
2007-01-01
Full text: The JET gamma-ray camera diagnostics have already provided valuable information on the gamma-ray imaging of fast ion in JET plasmas. The applicability of gamma-ray imaging to high performance deuterium and deuterium-tritium JET discharges is strongly dependent on the fulfilment of rather strict requirements for the characterisation of the neutron and gamma-ray radiation fields. These requirements have to be satisfied within very stringent boundary conditions for the design, such as the requirement of minimum impact on the co-existing neutron camera diagnostics. The JET Gamma-Ray Cameras (GRC) upgrade project deals with these issues with particular emphasis on the design of appropriate neutron/gamma-ray filters ('neutron attenuators'). Several design versions have been developed and evaluated for the JET GRC neutron attenuators at the conceptual design level. The main design parameter was the neutron attenuation factor. The two design solutions, that have been finally chosen and developed at the level of scheme design, consist of: a) one quasi-crescent shaped neutron attenuator (for the horizontal camera) and b) two quasi-trapezoid shaped neutron attenuators (for the vertical one). The second design solution has different attenuation lengths: a short version, to be used together with the horizontal attenuator for deuterium discharges, and a long version to be used for high performance deuterium and DT discharges. Various neutron-attenuating materials have been considered (lithium hydride with natural isotopic composition and 6 Li enriched, light and heavy water, polyethylene). Pure light water was finally chosen as the attenuating material for the JET gamma-ray cameras. The neutron attenuators will be steered in and out of the detector line-of-sight by means of an electro-pneumatic steering and control system. The MCNP code was used for neutron and gamma ray transport in order to evaluate the effect of the neutron attenuators on the neutron field of the
Gamma-Ray Pulsar Studies With GLAST
Energy Technology Data Exchange (ETDEWEB)
Thompson, D.J.; /NASA, Goddard
2011-11-23
Some pulsars have their maximum observable energy output in the gamma-ray band, offering the possibility of using these high-energy photons as probes of the particle acceleration and interaction processes in pulsar magnetospheres. After an extended hiatus between satellite missions, the recently-launched AGILE mission and the upcoming Gamma-ray Large Area Space Telescope (GLAST) Large Area Telescope (LAT) will allow gamma-ray tests of the theoretical models developed based on past discoveries. With its greatly improved sensitivity, better angular resolution, and larger energy reach than older instruments, GLAST LAT should detect dozens to hundreds of new gamma-ray pulsars and measure luminosities, light curves, and phase-resolved spectra with unprecedented resolution. It will also have the potential to find radio-quiet pulsars like Geminga, using blind search techniques. Cooperation with radio and X-ray pulsar astronomers is an important aspect of the LAT team's planning for pulsar studies.
Egret observations of the extragalactic gamma-ray emission
DEFF Research Database (Denmark)
Sreekumar, P.; Bertsch, D.L.; Dingus, B.L.
1998-01-01
The all-sky survey in high-energy gamma rays (E > 30 MeV) carried out by EGRET aboard the Compton Gamma Ray Observatory provides a unique opportunity to examine in detail the diffuse gamma-ray emission. The observed diffuse emission has a Galactic component arising from cosmic-ray interactions wi...
Sensitivity of Gamma-Ray Detectors to Polarization
Yadigaroglu, I. -A.
1996-01-01
Previous studies have shown that the largest gamma-ray detector to date, EGRET, does not have useful polarization sensitivity. We have explored here some improved approaches to analyzing gamma-ray pair production events, leading to important gains in sensitivity to polarization. The performance of the next generation gamma-ray instrument GLAST is investigated using a detailed Monte Carlo simulation of the complete detector.
Bulk density calculations from prompt gamma ray yield
International Nuclear Information System (INIS)
Naqvi, A.A.; Nagadi, M.M.; Al-Amoudi, O.S.B.; Maslehuddin, M.
2006-01-01
Full text: The gamma ray yield from a Prompt Gamma ray Neutron Activation Analysis (PGNAA) setup is a linear function of element concentration and neutron flux in a the sample with constant bulk density. If the sample bulk density varies as well, then the element concentration and the neutron flux has a nonlinear correlation with the gamma ray yield [1]. The measurement of gamma ray yield non-linearity from samples and a standard can be used to estimate the bulk density of the samples. In this study the prompt gamma ray yield from Blast Furnace Slag, Fly Ash, Silica Fumes and Superpozz cements samples have been measured as a function of their calcium and silicon concentration using KFUPM accelerator-based PGNAA setup [2]. Due to different bulk densities of the blended cement samples, the measured gamma ray yields have nonlinear correlation with calcium and silicon concentration of the samples. The non-linearity in the yield was observed to increase with gamma rays energy and element concentration. The bulk densities of the cement samples were calculated from ratio of gamma ray yield from blended cement and that from a Portland cement standard. The calculated bulk densities have good agreement with the published data. The result of this study will be presented
Airborne gamma-ray spectrometry
DEFF Research Database (Denmark)
Hovgaard, Jens
A new method - Noise Adjusted Singular Value Decomposition, NASVD - for processing gamma-ray spectra has been developed as part of a Ph.D. project. By using this technique one is able to decompose a large set of data - for example from airborne gamma-ray surveys - into a few spectral components....... By knowing the spectral components and their amplitudes in each of the measured spectra one is able to extract more information from the data than possible with the methods used otherwise....
Multiple Gamma-Ray Detection Capability of a CeBr3 Detector for Gamma Spectroscopy
Directory of Open Access Journals (Sweden)
A. A. Naqvi
2017-01-01
Full Text Available The newly developed cerium tribromide (CeBr3 detector has reduced intrinsic gamma-ray activity with gamma energy restricted to 1400–2200 keV energy range. This narrower region of background gamma rays allows the CeBr3 detector to detect more than one gamma ray to analyze the gamma-ray spectrum. Use of multiple gamma-ray intensities in elemental analysis instead of a single one improves the accuracy of the estimated results. Multigamma-ray detection capability of a cylindrical 75 mm × 75 mm (diameter × height CeBr3 detector has been tested by analyzing the chlorine concentration in water samples using eight chlorine prompt gamma rays over 517 to 8578 keV energies utilizing a D-D portable neutron generator-based PGNAA setup and measuring the corresponding minimum detection limit (MDC of chlorine. The measured MDC of chlorine for gamma rays with 517–8578 keV energies varies from 0.07 ± 0.02 wt% to 0.80 ± 0.24. The best value of MDC was measured to be 0.07 ± 0.02 wt% for 788 keV gamma rays. The experimental results are in good agreement with Monte Carlo calculations. The study has shown excellent detection capabilities of the CeBr3 detector for eight prompt gamma rays over 517–8578 keV energy range without significant background interference.
International Nuclear Information System (INIS)
White, Travis L.; Miller, William H.
1999-01-01
Researchers at the University of Missouri - Columbia have developed a three-crystal phoswich detector coupled to a digital pulse shape discrimination system for use in alpha/beta/gamma spectroscopy. Phoswich detectors use a sandwich of scintillators viewed by a single photomultiplier tube to simultaneously detect multiple types of radiation. Separation of radiation types is based upon pulse shape difference among the phosphors, which has historically been performed with analog circuitry. The system uses a GaGe CompuScope 1012, 12 bit, 10 MHz computer-based oscilloscope that digitally captures the pulses from a phoswich detector and subsequently performs pulse shape discrimination with cross-correlation analysis. The detector, based partially on previous phoswich designs by Usuda et al., uses a 10 mg/cm 2 thick layer of ZnS(Ag) for alpha detection, followed by a 0.254 cm CaF 2 (Eu) crystal for beta detection, all backed by a 2.54 cm NaI(Tl) crystal for gamma detection. Individual energy spectra and count rate information for all three radiation types are displayed and updated periodically. The system shows excellent charged particle discrimination with an accuracy of greater than 99%. Future development will include a large area beta probe with gamma-ray discrimination, systems for low-energy photon detection (e.g. Bremsstrahlung or keV-range photon emissions), and other health physics instrumentation
Observational techniques of gamma rays astronomy in low energy
International Nuclear Information System (INIS)
Costa, J.M. da.
1982-02-01
Due to the absorption of great part of the gamma-ray spectrum of cosmic origin, by the earth's atmosphere at heights above 20Km, gamma-ray astronomy achieved its full development only after the advent of the space age. Ballons and satellites are the space vehicles which have been used to transport gamma-ray telescopes to observational heights in the atmosphere, or out of it. The results of these experiments can determine the sources, the energy spectra and the intensities of the cosmic gamma-rays, and provide other important information of astrophysical interest. The detection of gamma-rays of cosmic origin is very difficult. The observational techniques used in gamma-ray astronomy are dependent on the energy range of the gamma-rays which one desires to detect. The most common telescopes of low energy gamma-ray astronomy (50KeV - 20MeV) use NaI(Tl) scintillators, or germanium diodes, as principal detectors, surrounded by an active shield (anticoincidence) of organic or inorganic scintillators. (Author) [pt
Possible galactic origin of. gamma. -ray bursts
Energy Technology Data Exchange (ETDEWEB)
Manchanda, R K; Ramsden, D [Southampton Univ. (UK). Dept. of Physics
1977-03-31
It is stated that extragalactic models for the origin of non-solar ..gamma..-ray bursts include supernova bursts in remote galaxies, and the collapse of the cores of active stars, whilst galactic models are based on flare stars, thermonuclear explosions in neutron stars and the sudden accretion of cometary gas on to neutron stars. The acceptability of any of these models may be tested by the observed size spectrum of the ..gamma..-ray bursts. The extragalactic models predict a power law spectrum with number index -1.5, whilst for the galactic models the number index will be -1. Experimental data on ..gamma..-ray bursts is, however, still meagre, and so far only 44 confirmed events have been recorded by satellite-borne instruments. The number spectrum of the observed ..gamma..-ray bursts indicates that the observed distribution for events with an energy < 10/sup -4/ erg/cm/sup 2/ is flat; this makes the choice of any model completely arbitrary. An analysis of the observed ..gamma..-ray events is here presented that suggests very interesting possibilities for their origin. There appears to be a preferred mean energy for ..gamma..-ray bursts; some 90% of the recorded events show a mean energy between 5 x 10/sup -5/ and 5 x 10/sup -4/ erg/cm/sup 2/, contrary to the predicted characteristics of the number spectrum of various models. A remarkable similarity is found between the distribution of ..gamma..-ray bursts and that of supernova remnants, suggesting a genetic relationship between the two and the galactic origin of the ..gamma..-ray bursts, and the burst source could be identified with completely run down neutron stars, formed during supernova explosions.
Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo
2013-08-01
Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models.
International Nuclear Information System (INIS)
Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo
2013-01-01
Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models
Prompt gamma-ray activation analysis (PGAA)
International Nuclear Information System (INIS)
Kern, J.
1996-01-01
The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs
Prompt gamma-ray activation analysis (PGAA)
Energy Technology Data Exchange (ETDEWEB)
Kern, J [Fribourg Univ. (Switzerland). Inst. de Physique
1996-11-01
The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs.
Gamma-Ray Bursts: 4th Huntsville Symposium. Proceedings
International Nuclear Information System (INIS)
Meegan, C.A.; Preece, R.D.; Koshut, T.M.
1998-01-01
These proceedings represent papers presented at the Fourth Huntsville Gamma-Ray Bursts Symposium held in September, 1997 in Huntsville, Alabama, USA. This conference occurred at a crucial time in the history of the gamma-ray burst research. In early 1997, 30 years after the detection of the first gamma-ray burst by the Vela satellites, counterparts to bursts were finally detected at optical and radio wavelengths. The symposium attracted about 200 scientists from 16 countries. Some of the topics discussed include gamma-ray burst spectra, x-ray observations, optical observations, radio observations, host galaxies, shocks and afterglows and models of gamma-ray bursts. There were 183 papers presented, out of these, 16 have been abstracted for the Energy Science and Technology database
The supernova-gamma-ray burst-jet connection.
Hjorth, Jens
2013-06-13
The observed association between supernovae and gamma-ray bursts represents a cornerstone in our understanding of the nature of gamma-ray bursts. The collapsar model provides a theoretical framework for this connection. A key element is the launch of a bipolar jet (seen as a gamma-ray burst). The resulting hot cocoon disrupts the star, whereas the (56)Ni produced gives rise to radioactive heating of the ejecta, seen as a supernova. In this discussion paper, I summarize the observational status of the supernova-gamma-ray burst connection in the context of the 'engine' picture of jet-driven supernovae and highlight SN 2012bz/GRB 120422A--with its luminous supernova but intermediate high-energy luminosity--as a possible transition object between low-luminosity and jet gamma-ray bursts. The jet channel for supernova explosions may provide new insights into supernova explosions in general.
Catalog of gamma-rays unplaced in radioactive decay schemes
International Nuclear Information System (INIS)
Narita, Tsutomu; Kitao, Kensuke.
1991-03-01
A catalog is made for gamma-rays emitted in decay of radioactive nuclides but not placed in their decay schemes. It consists of two tables. In Table 1, the number of these unplaced gamma-ray components by a nuclide is given together with the fraction of total intensity of these gamma-rays to that of all observed gamma-rays. In Table 2, the unplaced gamma-rays are arranged in order of increasing energy. Each line of this table contains the gamma-ray energy, intensity, nuclide identification, and energies and intensities of the most prominent gamma-rays from the decay of the radionuclides. This catalog is a compilation from Evaluated Nuclear Structure Data File (ENSDF) maintained by National Nuclear Data Center at Brookhaven National Laboratory, of at February 1990. (author)
A relativistic type Ibc supernova without a detected gamma-ray burst.
Soderberg, A M; Chakraborti, S; Pignata, G; Chevalier, R A; Chandra, P; Ray, A; Wieringa, M H; Copete, A; Chaplin, V; Connaughton, V; Barthelmy, S D; Bietenholz, M F; Chugai, N; Stritzinger, M D; Hamuy, M; Fransson, C; Fox, O; Levesque, E M; Grindlay, J E; Challis, P; Foley, R J; Kirshner, R P; Milne, P A; Torres, M A P
2010-01-28
Long duration gamma-ray bursts (GRBs) mark the explosive death of some massive stars and are a rare sub-class of type Ibc supernovae. They are distinguished by the production of an energetic and collimated relativistic outflow powered by a central engine (an accreting black hole or neutron star). Observationally, this outflow is manifested in the pulse of gamma-rays and a long-lived radio afterglow. Until now, central-engine-driven supernovae have been discovered exclusively through their gamma-ray emission, yet it is expected that a larger population goes undetected because of limited satellite sensitivity or beaming of the collimated emission away from our line of sight. In this framework, the recovery of undetected GRBs may be possible through radio searches for type Ibc supernovae with relativistic outflows. Here we report the discovery of luminous radio emission from the seemingly ordinary type Ibc SN 2009bb, which requires a substantial relativistic outflow powered by a central engine. A comparison with our radio survey of type Ibc supernovae reveals that the fraction harbouring central engines is low, about one per cent, measured independently from, but consistent with, the inferred rate of nearby GRBs. Independently, a second mildly relativistic supernova has been reported.
Near stellar sources of gamma-ray bursts
Luchkov, B. I.; Markin, P. D.
2012-01-01
Correlation analysis of gamma-ray burst coordinates and nearby stars, registered on 2008-2011, revealed 5 coincidences with angular accuracy better than 0.1 degree. The random probability is $7\\times 10^{-7}$, so evidencing that coincident stars are indeed gamma-ray burst sources. The proposed method should be continued in order to provide their share in common balance of cosmic gamma-ray bursts.
Gamma rays from the interstellar medium
International Nuclear Information System (INIS)
Bloemen, J.B.G.M.
1985-01-01
This thesis describes new gamma-ray views on cosmic rays and the interstellar medium. The author describes the COS-B data base and the pre-launch and in-flight calibration data used for all analyses. Diffuse galactic gamma radiation (> 50 MeV) may be either a result of cosmic-ray-matter interactions, or of the cosmic-ray electrons with the interstellar radiation field (mainly at optical and infrared wavelengths), through the inverse-Compton process. A detailed comparison between the gamma-ray observations of the large complex of interstellar clouds in Orion and Monoceros and the CO and HI surveys of this region is given. It gives insight into the cloud penetration of cosmic rays and in the relation between CO detections and molecular hydrogen column densities. Next, the radial distribution of gamma rays in the Galaxy is studied, as well as the galactic centre (more precisely, the central 400 pc), which contains a large concentration of CO molecules. The H 2 /CO abundance and the cosmic-ray density in the galactic centre are discussed and compared to the findings for the galactic disk. In various analyses in this thesis a likelihood-ratio method is applied for parameter estimation and hypothesis testing. A general description of this method is added as an appendix. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Mihalcea, D.; Murokh, A.; Piot, P.; Ruan, J.
2017-07-01
A high-brilliance (~1022 photon s-1 mm-2 mrad-2 /0.1%) gamma-ray source experiment is currently being planned at Fermilab (Eγ≃1.1 MeV). The source implements a high-repetition-rate inverse Compton scattering by colliding electron bunches formed in a ~300-MeV superconducting linac with a high-intensity laser pulse. This paper describes the design rationale along with some of technical challenges associated to producing high-repetition-rate collision. The expected performances of the gamma-ray source are also presented.
Time dependent deadtime and pile-up corrections for gamma-ray spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Roscoe, B A; Furr, A K [Virginia Polytechnic Inst. and State Univ., Blacksburg (USA)
1977-01-15
The losses of pulses in gamma spectroscopy due to the analog-to-digital (ADC) conversion process and due to pulse pile-up is a major problem in quantitative gamma ray spectroscopy. It is especially serious if the count rate varies significantly during the counting interval and if the nuclear events of interest are associated with an isotope with a half-life shorter than or comparable to the counting interval as is often the case for isotopes with half-lives of the order of 10 min or less. The count rates at which dead time losses become a problem depend upon the available equipment but, in the present work, the problem became acute at count rates in excess of 25000 cps. A technique developed at VPI and SU is discussed in the present work which very satisfactorily corrects for both ADC and pile-up losses and is dependent upon the half-life of the decaying radioisotope.
Review of GRANAT observations of gamma-ray bursts
DEFF Research Database (Denmark)
Terekhov, O.; Denissenko, D.; Sunyaev, R.
1995-01-01
The GRANAT observatory was launched into a high apogee orbit on 1 December, 1989. Three instruments onboard GRANAT - PHEBUS, WATCH and SIGMA are able to detect gamma-ray bursts in a very broad energy range from 6 keV up to 100 MeV. Over 250 gamma-ray bursts were detected. We discuss the results...... of the observations of the time histories and spectral evolution of the detected events provided by the different instruments in different energy ranges. Short Gamma-Ray Bursts ( 2 s) events. Evidence of the existence...... of four differently behaving componenents in gamma-ray burst spectra is discussed. Statistical properties of the gamma-ray burst sources based on the 5 years of observations with (∼ 10−6 erg/cm2) sensitivity as well as the results of high sensitivity (∼ 10−8 erg/cm2) search for Gamma-Ray Bursts within...
Ultra-high energy cosmic rays and prompt TeV gamma rays from ...
Indian Academy of Sciences (India)
physics pp. 789-792. Ultra-high energy cosmic rays and prompt. TeV gamma rays from gamma ray bursts ... The origin of the observed ultra-high energy cosmic ray (UHECR) events with ... are proton and electron rest mass, respectively.
Optimum filter-based discrimination of neutrons and gamma rays
International Nuclear Information System (INIS)
Amiri, Moslem; Prenosil, Vaclav; Cvachovec, Frantisek
2015-01-01
An optimum filter-based method for discrimination of neutrons and gamma-rays in a mixed radiation field is presented. The existing filter-based implementations of discriminators require sample pulse responses in advance of the experiment run to build the filter coefficients, which makes them less practical. Our novel technique creates the coefficients during the experiment and improves their quality gradually. Applied to several sets of mixed neutron and photon signals obtained through different digitizers using stilbene scintillator, this approach is analyzed and its discrimination quality is measured. (authors)
Testing T-odd, p-even interactions with gamma-rays from neutron p-wave resonances
International Nuclear Information System (INIS)
Barabanov, A.L.
1992-01-01
A new method for the study of time reversal violation is described. It consists of measurements of the forward-backward asymmetry in individual gamma-ray transitions resulting from unpolarized neutron capture in p-wave resonance. An experiment with a 113 Cd target performed at the Dubna pulsed neutron source has been analyzed and a limit on the time reversal odd, parity even interaction extracted. The possibilities of experiments using the powerful pulsed neutron source at Los Alamos are considered. 23 refs.; 2 figs
Physics and astrophysics with gamma-ray telescopes
Energy Technology Data Exchange (ETDEWEB)
Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)
2012-08-15
In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.
International Nuclear Information System (INIS)
Santoro, R.T.; Alsmiller, R.G. Jr.; Barnes, J.M.; Chapman, G.T.
1980-08-01
Integral experiments that measure the transport of approx. 14 MeV D-T neutrons through laminated slabs of proposed fusion reactor shield materials have been carried out. Measured and calculated neutron and gamma ray energy spectra are compared as a function of the thickness and composition of stainless steel type 304, borated polyethylene, and Hevimet (a tungsten alloy), and as a function of detector position behind these materials. The measured data were obtained using a NE-213 liquid scintillator using pulse-shape discrimination methods to resolve neutron and gamma ray pulse height data and spectral unfolding methods to convert these data to energy spectra. The calculated data were obtained using two-dimensional discrete ordinates radiation transport methods in a complex calculational network that takes into account the energy-angle dependence of the D-T neutrons and the nonphysical anomalies of the S/sub n/ method
X-Ray Spectral Characteristics of Ginga Gamma-Ray Bursts
International Nuclear Information System (INIS)
Strohmayer, T.E.; Fenimore, E.E.; Murakami, T.; Yoshida, A.
1998-01-01
We have investigated the spectral characteristics of a sample of bright gamma-ray bursts detected with the gamma-ray burst sensors aboard the satellite Ginga. This instrument employed a proportional and scintillation counter to provide sensitivity to photons in the 2 endash 400 keV region and as such provided a unique opportunity to characterize the largely unexplored X-ray properties of gamma-ray bursts. The photon spectra of the Ginga bursts are well described by a low-energy slope, a bend energy, and a high-energy slope. In the energy range where they can be compared, this result is consistent with burst spectral analyses obtained from the BATSE experiment aboard the Compton Gamma-Ray Observatory. However, below 20 keV we find evidence for a positive spectral number index in approximately 40% of our burst sample, with some evidence for a strong rolloff at lower energies in a few events. There is a correlation (Pearson's r = -0.62) between the low-energy slope and the bend energy. We find that the distribution of spectral bend energies extends below 10 keV. There has been some concern in cosmological models of gamma-ray bursts (GRBs) that the bend energy covers only a small dynamic range. Our result extends the observed dynamic range, and, since we observe bend energies down to the limit of our instrument, perhaps observations have not yet limited the range. The Ginga trigger range was virtually the same as that of BATSE, yet we find a different range of fit parameters. One possible explanation might be that GRBs have two break energies, one often in the 50 endash 500 keV range and the other near 5 keV. Both BATSE and Ginga fit with only a single break energy, so BATSE tends to find breaks near the center of its energy range, and we tend to find breaks in our energy range. The observed ratio of energy emitted in the X-rays relative to the gamma rays can be much larger than a few percent and, in fact, is sometimes larger than unity. The average for our 22 bursts
Investigation of the pulse shape analysis for the position sensitive γ-ray spectrometer AGATA
Energy Technology Data Exchange (ETDEWEB)
Lewandowski, Lars; Birkenbach, Benedikt; Reiter, Peter [Institut fuer Kernphysik Koeln (Germany); Collaboration: AGATA-Collaboration
2015-07-01
The next generation of γ-ray spectrometers like AGATA will provide high quality γ-ray spectra by the new Gamma-Ray Tracking technique (GRT). Position sensitive HPGe detectors will allow for precise Doppler correction and small broadening of lines for spectroscopy at relativistic energies. GRT is based on the interaction position of the γ-rays within the volume of the highly segmented germanium detectors provided by Pulse Shape Analysis (PSA) methods. The proof of principle of GRT was already demonstrated with great success however systematic deviations from expected results occur. The parameterization of the following detector properties and their impact on PSA were thoroughly investigated and optimized: electron and hole mobility, crystal axis orientation, space charge distributions, crystal impurities, response functions of preamplifiers and digitizers, linear and differential crosstalk, time alignment of pulses and the distance metric. Results of an improved PSA performance are presented.
International Nuclear Information System (INIS)
Mardiyanto
2008-01-01
Neutron-Gamma Pulse Shape Discrimination with a NE-213 Liquid Scintillator by Using Digital Signal Processing Combined with Similarity Method. Measurement of mixed neutron-gamma radiation is difficult because a nuclear detector is usually sensitive to both radiations. A new attempt of neutron-gamma pulse shape discrimination for a NE-213 liquid scintillator is presented by using digital signal processing combined with an off-line similarity method. The output pulse shapes are digitized with a high speed digital oscilloscope. The n-γ discrimination is done by calculating the index of each pulse shape, which is determined by the similarity method, and then fusing it with its corresponding pulse height. Preliminary results demonstrate good separation of neutron and gamma-ray signals from a NE-213 scintillator with a simple digital system. The results were better than those with a conventional rise time method. Figure of Merit is used to determine the quality of discrimination. The figure of merit of the discrimination using digital signal processing combined with off-line similarity method are 1.9; 1.7; 1.1; 1.1; and 0.8; on the other hand by using conventional method the rise time are 0.9; 0.9; 0.9; 0.7; and 0.4 for the equivalent electron energy of 800; 278; 139; 69; and 30 keV. (author)
Handbook on Mobile Gamma-ray Spectrometry
DEFF Research Database (Denmark)
Aage, Helle Karina; Korsbech, Uffe C C
2003-01-01
Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing......Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing...
Swift: A gamma ray burst MIDEX
International Nuclear Information System (INIS)
Barthelmy, Scott
2001-01-01
Swift is a first of its kind multiwavelength transient observatory for gamma-ray burst astronomy. It has the optimum capabilities for the next breakthroughs in determining the origin of gamma-ray bursts and their afterglows as well as using bursts to probe the early Universe. Swift will also perform the first sensitive hard X-ray survey of the sky. The mission is being developed by an international collaboration and consists of three instruments, the Burst Alert Telescope (BAT), the X-ray Telescope (XRT), and the Ultraviolet and Optical Telescope (UVOT). The BAT, a wide-field gamma-ray detector, will detect ∼1 gamma-ray burst per day with a sensitivity 5 times that of BATSE. The sensitive narrow-field XRT and UVOT will be autonomously slewed to the burst location in 20 to 70 seconds to determine 0.3-5.0 arcsec positions and perform optical, UV, and X-ray spectrophotometry. On-board measurements of redshift will also be done for hundreds of bursts. Swift will incorporate superb, low-cost instruments using existing flight-spare hardware and designs. Strong education/public outreach and follow-up programs will help to engage the public and astronomical community. Swift has been selected by NASA for development and launch in late 2003
Gamma ray astronomy and the origin of galactic cosmic rays
International Nuclear Information System (INIS)
Gabici, Stefano
2011-01-01
Diffusive shock acceleration operating at expanding supernova remnant shells is by far the most popular model for the origin of galactic cosmic rays. Despite the general consensus received by the model, an unambiguous and conclusive proof of the supernova remnant hypothesis is still missing. In this context, the recent developments in gamma ray astronomy provide us with precious insights into the problem of the origin of galactic cosmic rays, since production of gamma rays is expected both during the acceleration of cosmic rays at supernova remnant shocks and during their subsequent propagation in the interstellar medium. In particular, the recent detection of a number of supernova remnants at TeV energies nicely fits with the model, but it still does not constitute a conclusive proof of it, mainly due to the difficulty of disentangling the hadronic and leptonic contributions to the observed gamma ray emission. The main goal of my research is to search for an unambiguous and conclusive observational test for proving (or disproving) the idea that supernova remnants are the sources of galactic cosmic rays with energies up to (at least) the cosmic ray knee. Our present comprehension of the mechanisms of particle acceleration at shocks and of the propagation of cosmic rays in turbulent magnetic fields encourages beliefs that such a conclusive test might come from future observations of supernova remnants and of the Galaxy in the almost unexplored domain of multi-TeV gamma rays. (author)
Librarian driven analysis of gamma ray spectra
International Nuclear Information System (INIS)
Kondrashov, V.; Petersone, I.
2002-01-01
For a set of a priori given radionuclides extracted from a general nuclide data library, the authors use median estimates of the gamma-peak areas and estimates of their errors to produce a list of possible radionuclides matching gamma ray line(s). The identification of a given radionuclide is obtained by searching for a match with the energy information of a database. This procedure is performed in an interactive graphic mode by markers that superimpose, on the spectral data, the energy information and yields provided by a general gamma ray data library. This library of experimental data includes approximately 17,000 gamma ray energy lines related to 756 known gamma emitter radionuclides listed by the ICRP. (author)
New stage in high-energy gamma-ray studies with GAMMA-400 after Fermi-LAT
Directory of Open Access Journals (Sweden)
Topchiev N.P.
2017-01-01
Full Text Available Fermi-LAT has made a significant contribution to the study of high-energy gamma-ray diffuse emission and the observations of 3000 discrete sources. However, one third of all gamma-ray sources (both galactic and extragalactic are unidentified, the data on the diffuse gamma-ray emission should be clarified, and signatures of dark matter particles in the high-energy gamma-ray range are not observed up to now. GAMMA-400, the currently developing gamma-ray telescope, will have angular (∼0.01∘ at 100 GeV and energy (∼1% at 100 GeV resolutions in the energy range of 10–1000 GeV which are better than Fermi-LAT (as well as ground gamma-ray telescopes by a factor of 5–10. It will observe some regions of the Universe (such as the Galactic Center, Fermi Bubbles, Crab, Cygnus, etc. in a highly elliptic orbit (without shading the telescope by the Earth continuously for a long time. It will allow us to identify many discrete sources, to clarify the structure of extended sources, to specify the data on the diffuse emission, and to resolve gamma rays from dark matter particles.
Bright x-ray flares in gamma-ray burst afterglows.
Burrows, D N; Romano, P; Falcone, A; Kobayashi, S; Zhang, B; Moretti, A; O'brien, P T; Goad, M R; Campana, S; Page, K L; Angelini, L; Barthelmy, S; Beardmore, A P; Capalbi, M; Chincarini, G; Cummings, J; Cusumano, G; Fox, D; Giommi, P; Hill, J E; Kennea, J A; Krimm, H; Mangano, V; Marshall, F; Mészáros, P; Morris, D C; Nousek, J A; Osborne, J P; Pagani, C; Perri, M; Tagliaferri, G; Wells, A A; Woosley, S; Gehrels, N
2005-09-16
Gamma-ray burst (GRB) afterglows have provided important clues to the nature of these massive explosive events, providing direct information on the nearby environment and indirect information on the central engine that powers the burst. We report the discovery of two bright x-ray flares in GRB afterglows, including a giant flare comparable in total energy to the burst itself, each peaking minutes after the burst. These strong, rapid x-ray flares imply that the central engines of the bursts have long periods of activity, with strong internal shocks continuing for hundreds of seconds after the gamma-ray emission has ended.
A One-Dimensional Relativistic Shock Model for the Light Curve of Gamma-ray Bursts
Institute of Scientific and Technical Information of China (English)
Cheng-Yue Su; Yi-Ping Qin; Jun-Hui Fan; Zhang-Yu Han
2006-01-01
We investigate the forming of gamma-ray burst pulses with a simple onedimensional relativistic shock model. The mechanism is that a "central engine" drives forward the nearby plasma inside the fireball to generate a series of pressure waves. We give a relativistic geometric recurrence formula that connects the time when the pressure waves are produced and the time when the corresponding shocks occurred. This relation enables us to relate the pulse magnitude with the observation time. Our analysis shows that the evolution of the pressure waves leads to a fast rise and an exponential decay pulses. In determining the width of the pulses, the acceleration time is more important than that of the deceleration.
International Nuclear Information System (INIS)
Levesque, Emily M.; Kewley, Lisa J.; Soderberg, Alicia M.; Berger, Edo
2010-01-01
We compare the redshifts, host galaxy metallicities, and isotropic (E γ,iso ) and beaming-corrected (E γ ) gamma-ray energy release of 16 long-duration gamma-ray bursts (LGRBs) at z γ,iso , or E γ . These results are at odds with previous theoretical and observational predictions of an inverse correlation between gamma-ray energy release and host metallicity, as well as the standard predictions of metallicity-driven wind effects in stellar evolutionary models. We consider the implications that these results have for LGRB progenitor scenarios, and discuss our current understanding of the role that metallicity plays in the production of LGRBs.
International Nuclear Information System (INIS)
Wang, S.-H.; Robbins, C.D.
1979-01-01
An Anger gamma ray camera is improved by the substitution of a gamma ray sensitive, proximity type image intensifier tube for the scintillator screen in the Anger camera. The image intensifier tube has a negatively charged flat scintillator screen, a flat photocathode layer, and a grounded, flat output phosphor display screen, all of which have the same dimension to maintain unit image magnification; all components are contained within a grounded metallic tube, with a metallic, inwardly curved input window between the scintillator screen and a collimator. The display screen can be viewed by an array of photomultipliers or solid state detectors. There are two photocathodes and two phosphor screens to give a two stage intensification, the two stages being optically coupled by a light guide. (author)
Polarization of the prompt gamma-ray emission from the gamma-ray burst of 6 December 2002.
Coburn, Wayne; Boggs, Steven E
2003-05-22
Observations of the afterglows of gamma-ray bursts (GRBs) have revealed that they lie at cosmological distances, and so correspond to the release of an enormous amount of energy. The nature of the central engine that powers these events and the prompt gamma-ray emission mechanism itself remain enigmatic because, once a relativistic fireball is created, the physics of the afterglow is insensitive to the nature of the progenitor. Here we report the discovery of linear polarization in the prompt gamma-ray emission from GRB021206, which indicates that it is synchrotron emission from relativistic electrons in a strong magnetic field. The polarization is at the theoretical maximum, which requires a uniform, large-scale magnetic field over the gamma-ray emission region. A large-scale magnetic field constrains possible progenitors to those either having or producing organized fields. We suggest that the large magnetic energy densities in the progenitor environment (comparable to the kinetic energy densities of the fireball), combined with the large-scale structure of the field, indicate that magnetic fields drive the GRB explosion.
Delayed Fission Gamma-ray Characteristics of Th-232 U-233 U-235 U-238 and Pu-239
Energy Technology Data Exchange (ETDEWEB)
Lane, Taylor [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Parma, Edward J. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)
2015-08-01
Delayed fission gamma-rays play an important role in determining the time dependent ioniz- ing dose for experiments in the central irradiation cavity of the Annular Core Research Reactor (ACRR). Delayed gamma-rays are produced from both fission product decay and from acti- vation of materials in the core, such as cladding and support structures. Knowing both the delayed gamma-ray emission rate and the time-dependent gamma-ray energy spectrum is nec- essary in order to properly determine the dose contributions from delayed fission gamma-rays. This information is especially important when attempting to deconvolute the time-dependent neutron, prompt gamma-ray, and delayed gamma-ray contribution to the response of a diamond photo-conducting diode (PCD) or fission chamber in time frames of milliseconds to seconds following a reactor pulse. This work focused on investigating delayed gamma-ray character- istics produced from fission products from thermal, fast, and high energy fission of Th-232, U-233, U-235, U-238, and Pu-239. This work uses a modified version of CINDER2008, a transmutation code developed at Los Alamos National Laboratory, to model time and energy dependent photon characteristics due to fission. This modified code adds the capability to track photon-induced transmutations, photo-fission, and the subsequent radiation caused by fission products due to photo-fission. The data is compared against previous work done with SNL- modified CINDER2008 [ 1 ] and experimental data [ 2 , 3 ] and other published literature, includ- ing ENDF/B-VII.1 [ 4 ]. The ability to produce a high-fidelity (7,428 group) energy-dependent photon fluence at various times post-fission can improve the delayed photon characterization for radiation effects tests at research reactors, as well as other applications.
Secondary gamma-ray data for shielding calculation
International Nuclear Information System (INIS)
Miyasaka, Sunichi
1979-01-01
In deep penetration transport calculations, the integral design parameters is determined mainly by secondary particles which are produced by interactions of the primary radiation with materials. The shield thickness and the biological dose rate at a given point of a bulk shield are determined from the contribution from secondary gamma rays. The heat generation and the radiation damage in the structural and shield materials depend strongly on the secondary gamma rays. In this paper, the status of the secondary gamma ray data and its further problems are described from the viewpoint of shield design. The secondary gamma-ray data in ENDF/B-IV and POPOP4 are also discussed based on the test calculations made for several shield assemblies. (author)
X-Ray and Gamma-Ray Radiation Detector
DEFF Research Database (Denmark)
2015-01-01
Disclosed is a semiconductor radiation detector for detecting X-ray and / or gamma-ray radiation. The detector comprises a converter element for converting incident X-ray and gamma-ray photons into electron-hole pairs, at least one cathode, a plurality of detector electrodes arranged with a pitch...... (P) along a first axis, a plurality of drift electrodes, a readout circuitry being configured to read out signals from the plurality of detector electrodes and a processing unit connected to the readout circuitry and being configured to detect an event in the converter element. The readout circuitry...... is further configured to read out signals from the plurality of drift electrodes, and the processing unit is further configured to estimate a location of the event along the first axis by processing signals obtained from both the detector electrodes and the drift electrodes, the location of the event along...
A study on gamma rays from electrochemical cells
International Nuclear Information System (INIS)
Shin, Seung Ai
1993-01-01
The energies and intensities of gamma rays emitted from 3 cells with Pd-cathodes of φ 1mm x 10mm, φ 2mm x 20mm, φ 1mm x 10mm were determined using HPGe-detector system and compared with Pd-neutron capture model. Very strong gamma rays of 512keC, 622keC, 1051keC and 8 more important ones were found to be identical with characteristic gamma rays of 106 Pd and 109 Pd. It is likely that the neutron capture reaction, A PD(n, γ) A+1 Pd, occurred in the cell and the neutrons came from the fusion reaction of two deutrons. It is necessary, however, to retest the model since another strong 84keV-gamma rays do not belong to any A+1 Pd-gamma spectra and two important 106 Pd-gamma rays 717keV, 1046KeV were not detected. Total amount of emitted gamma rays was large when the size of the Pd-cathod was large. Its depedence on the time of measurement and the preheating period did not have any regularities. Thus the replication is not an easy thing. (Author)
Plastic Scintillator Based Detector for Observations of Terrestrial Gamma-ray Flashes.
Barghi, M. R., Sr.; Delaney, N.; Forouzani, A.; Wells, E.; Parab, A.; Smith, D.; Martinez, F.; Bowers, G. S.; Sample, J.
2017-12-01
We present an overview of the concept and design of the Light and Fast TGF Recorder (LAFTR), a balloon borne gamma-ray detector designed to observe Terrestrial Gamma-Ray Flashes (TGFs). Terrestrial Gamma-Ray Flashes (TGFs) are extremely bright, sub-millisecond bursts of gamma-rays observed to originate inside thunderclouds coincident with lightning. LAFTR is joint institutional project built by undergraduates at the University of California Santa Cruz and Montana State University. It consists of a detector system fed into analog front-end electronics and digital processing. The presentation focuses specifically on the UCSC components, which consists of the detector system and analog front-end electronics. Because of the extremely high count rates observed during TGFs, speed is essential for both the detector and electronics of the instrument. The detector employs a fast plastic scintillator (BC-408) read out by a SensL Silicon Photomultiplier (SiPM). BC-408 is chosen for its speed ( 4 ns decay time) and low cost and availability. Furthermore, GEANT3 simulations confirm the scintillator is sensitive to 500 counts at 7 km horizontal distance from the TGF source (for a 13 km source altitude and 26 km balloon altitude) and to 5 counts out to 20 km. The signal from the SiPM has a long exponential decay tail and is sent to a custom shaping circuit board that amplifies and shapes the signal into a semi-Gaussian pulse with a 40 ns FWHM. The signal is then input to a 6-channel discriminator board that clamps the signal and outputs a Low Voltage Differential Signal (LVDS) for processing by the digital electronics.
An X-ray perspective on a gamma-ray mission
DEFF Research Database (Denmark)
Lund, Niels
2003-01-01
The most recent astrophysics mission of ESA is INTEGRAL, a mission dedicated to gamma-ray astronomy (Winkler et al. 2003). INTEGRAL carries two gamma-ray instruments: the imager, IBIS, and the spectrometer, SPI, and in addition an optical monitor, OMC, and an X-ray monitor, JEM-X. INTEGRAL is an ...... is an observatory mission with 70% of the observation time available to the general astronomical community through a peer-reviewed selection process. This paper describes the INTEGRAL mission primarily as seen from the JEM-X perspective....
Constraints on the galactic distribution of cosmic rays from the COS-B gamma-ray data
International Nuclear Information System (INIS)
1985-08-01
The velocity information of the HI and CO observations is used as a distance indicator to ascertain the spatial distribution of the interstellar gas. Using this distance information, the galacto-centric distribution of the gamma-ray emissivity (the production rate per H atom) is determined for three gamma-ray energy ranges from a correlation study of the gamma-ray intensity maps and the gas-tracer maps for selected galacto-centric distance intervals, taking into account the expected IC contribution and pointlike gamma-ray sources. On the assumption that unresolved gamma-ray point sources do not contribute significantly to the observed gamma-ray emission, the gamma-ray emissivity is proportional to the Cosmic ray density and, more specifically, the energy dependence can be used to study separately the distribution of Cosmic ray electrons and nuclei: whereas the emission for the 300 MeV - 5 GeV range is dominated by π 0 -decay, the 70 MeV - 150 MeV range has a large electron bremsstrahlung contribution
Femtosecond profiling of shaped x-ray pulses
Hoffmann, M. C.; Grguraš, I.; Behrens, C.; Bostedt, C.; Bozek, J.; Bromberger, H.; Coffee, R.; Costello, J. T.; DiMauro, L. F.; Ding, Y.; Doumy, G.; Helml, W.; Ilchen, M.; Kienberger, R.; Lee, S.; Maier, A. R.; Mazza, T.; Meyer, M.; Messerschmidt, M.; Schorb, S.; Schweinberger, W.; Zhang, K.; Cavalieri, A. L.
2018-03-01
Arbitrary manipulation of the temporal and spectral properties of x-ray pulses at free-electron lasers would revolutionize many experimental applications. At the Linac Coherent Light Source at Stanford National Accelerator Laboratory, the momentum phase-space of the free-electron laser driving electron bunch can be tuned to emit a pair of x-ray pulses with independently variable photon energy and femtosecond delay. However, while accelerator parameters can easily be adjusted to tune the electron bunch phase-space, the final impact of these actuators on the x-ray pulse cannot be predicted with sufficient precision. Furthermore, shot-to-shot instabilities that distort the pulse shape unpredictably cannot be fully suppressed. Therefore, the ability to directly characterize the x-rays is essential to ensure precise and consistent control. In this work, we have generated x-ray pulse pairs via electron bunch shaping and characterized them on a single-shot basis with femtosecond resolution through time-resolved photoelectron streaking spectroscopy. This achievement completes an important step toward future x-ray pulse shaping techniques.
THERMAL X-RAY EMISSION FROM THE SHOCKED STELLAR WIND OF PULSAR GAMMA-RAY BINARIES
Energy Technology Data Exchange (ETDEWEB)
Zabalza, V.; Paredes, J. M. [Departament d' Astronomia i Meteorologia, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E08028 Barcelona (Spain); Bosch-Ramon, V., E-mail: vzabalza@am.ub.es [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland)
2011-12-10
Gamma-ray-loud X-ray binaries are binary systems that show non-thermal broadband emission from radio to gamma rays. If the system comprises a massive star and a young non-accreting pulsar, their winds will collide producing broadband non-thermal emission, most likely originated in the shocked pulsar wind. Thermal X-ray emission is expected from the shocked stellar wind, but until now it has neither been detected nor studied in the context of gamma-ray binaries. We present a semi-analytic model of the thermal X-ray emission from the shocked stellar wind in pulsar gamma-ray binaries, and find that the thermal X-ray emission increases monotonically with the pulsar spin-down luminosity, reaching luminosities of the order of 10{sup 33} erg s{sup -1}. The lack of thermal features in the X-ray spectrum of gamma-ray binaries can then be used to constrain the properties of the pulsar and stellar winds. By fitting the observed X-ray spectra of gamma-ray binaries with a source model composed of an absorbed non-thermal power law and the computed thermal X-ray emission, we are able to derive upper limits on the spin-down luminosity of the putative pulsar. We applied this method to LS 5039, the only gamma-ray binary with a radial, powerful wind, and obtain an upper limit on the pulsar spin-down luminosity of {approx}6 Multiplication-Sign 10{sup 36} erg s{sup -1}. Given the energetic constraints from its high-energy gamma-ray emission, a non-thermal to spin-down luminosity ratio very close to unity may be required.
THE ORIGIN OF GAMMA RAYS FROM GLOBULAR CLUSTERS
International Nuclear Information System (INIS)
Cheng, K. S.; Chernyshov, D. O.; Dogiel, V. A.; Hui, C. Y.; Kong, A. K. H.
2010-01-01
Fermi has detected gamma-ray emission from eight globular clusters (GCs). It is commonly believed that the energy sources of these gamma rays are millisecond pulsars (MSPs) inside GCs. Also it has been standard to explain the spectra of most Fermi Large Area Telescope pulsars including MSPs resulting from the curvature radiation (CR) of relativistic electrons/positrons inside the pulsar magnetosphere. Therefore, gamma rays from GCs are expected to be the collection of CR from all MSPs inside the clusters. However, the angular resolution is not high enough to pinpoint the nature of the emission. In this paper, we calculate the gamma rays produced by the inverse Compton (IC) scattering between relativistic electrons/positrons in the pulsar wind of MSPs in the GCs and background soft photons including cosmic microwave/relic photons, background star lights in the clusters, the galactic infrared photons, and the galactic star lights. We show that the gamma-ray spectrum from 47 Tucanae can be explained equally well by upward scattering of either the relic photons, the galactic infrared photons, or the galactic star lights, whereas the gamma-ray spectra from the other seven GCs are best fitted by the upward scattering of either the galactic infrared photons or the galactic star lights. We also find that the observed gamma-ray luminosity is correlated better with the combined factor of the encounter rate and the background soft photon energy density. Therefore, the IC scattering may also contribute to the observed gamma-ray emission from GCs detected by Fermi in addition to the standard CR process. Furthermore, we find that the emission region of high-energy photons from GCs produced by the IC scattering is substantially larger than the cores of GCs with a radius >10 pc. The diffuse radio and X-rays emitted from GCs can also be produced by the synchrotron radiation and IC scattering, respectively. We suggest that future observations including radio, X-rays, and gamma rays
Wireless, low-cost, FPGA-based miniature gamma ray spectrometer
Energy Technology Data Exchange (ETDEWEB)
Becker, E.M., E-mail: beckere@engr.orst.edu; Farsoni, A.T.
2014-10-11
A compact, low-cost, wireless gamma-ray spectrometer is a tool sought by a number of different organizations in the field of radiation detection. Such a device has applications in emergency response, battlefield assessment, and personal dosimetry. A prototype device fitting this description has been constructed in the Advanced Radiation Instrumentation Laboratory at Oregon State University. The prototype uses a CsI(Tl) scintillator coupled to a solid-state photomultiplier and a 40 MHz, 12-bit, FPGA-based digital pulse processor to measure gamma radiation, and is able to be accessed wirelessly by mobile phone. The prototype device consumes roughly 420 mW, weighs about 28 g (not including battery), and measures 2.54×3.81 cm{sup 2}. The prototype device is able to achieve 5.9% FWHM energy resolution at 662 keV.
The early X-ray afterglows of optically bright and dark Gamma-Ray Bursts
Lin, Yi-Qing
2006-01-01
A systematical study on the early X-ray afterglows of both optically bright and dark gamma-ray bursts (B-GRBs and D-GRBs) observed by Swift has been presented. Our sample includes 25 GRBs. Among them 13 are B-GRBs and 12 are D-GRBs. Our results show that the distributions of the X-ray afterglow fluxes ($F_{X}$), the gamma-ray fluxes ($S_{\\gamma}$), and the ratio ($R_{\\gamma, X}$) for both the D-GRBs and B-GRBs are similar. The differences of these distributions for the two kinds of GRBs shoul...
Gamma ray bursts observed with WATCH‐EURECA
DEFF Research Database (Denmark)
Brandt, Søren; Lund, Niels; Castro-Tirado, A. J.
1994-01-01
The WATCH wide field x‐ray monitor has the capability of independently locating bright Gamma Ray Bursts to 1° accuracy. We report the preliminary positions of 12 Gamma Ray Bursts observed with the WATCH monitor flown on the ES spacecraft EURECA during its 11 month mission. Also the recurrence...
Technology Needs for Gamma Ray Astronomy
Gehrels, Neil
2011-01-01
Gamma ray astronomy is currently in an exciting period of multiple missions and a wealth of data. Results from INTEGRAL, Fermi, AGILE, Suzaku and Swift are making large contributions to our knowledge of high energy processes in the universe. The advances are due to new detector and imaging technologies. The steps to date have been from scintillators to solid state detectors for sensors and from light buckets to coded aperture masks and pair telescopes for imagers. A key direction for the future is toward focusing telescopes pushing into the hard X-ray regime and Compton telescopes and pair telescopes with fine spatial resolution for medium and high energy gamma rays. These technologies will provide finer imaging of gamma-ray sources. Importantly, they will also enable large steps forward in sensitivity by reducing background.
A study of gamma-ray bursts and a new detector for gamma-ray astronomy
International Nuclear Information System (INIS)
Carter, J.N.
1979-09-01
Three gamma-ray experiments flown on balloons between August 1975 and August 1976 are described in detail. The successful Transatlantic balloon flight enabled a rate of 3 bursts year -1 with energies > 7 x 10 -7 ergs cm -2 to be established. This result is discussed in the light of other work. The choice of γ-ray detector for optimum sensitivity is presented. In addition various techniques for determining the arrival direction of gamma-ray bursts are compared. A new balloon borne γ-ray burst telescope is proposed. The design, testing and results of the beam calibration of a new drift chamber detector system for high energy (> 50 MeV) γ-rays are presented. A projected angular resolution of 0.8 0 was obtained at 300 MeV. Techniques for the measurement of γ-ray energies are discussed in relation to this instrument. Finally the use of drift chambers in an integrated free flying satellite is illustrated, and the expected performance is presented. (author)
{gamma}-Ray background sources in the VESUVIO spectrometer at ISIS spallation neutron source
Energy Technology Data Exchange (ETDEWEB)
Pietropaolo, A. [CNISM Milano-Bicocca, Universita degli Studi di Milano-Bicocca, Dipartimento di Fisica ' G. Occhialini' , Piazza della Scienza 3, 20126 Milano (Italy); NAST Center (Nanoscienze-Nanotecnologie-Strumentazione), Universita degli Studi di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy)], E-mail: antonino.pietropaolo@mib.infn.it; Perelli Cippo, E. [Universita degli Studi di Milano-Bicocca, Dipartimento di Fisica ' G. Occhialini' , Piazza della Scienza 3, 20126 Milano (Italy); Gorini, G. [CNISM Milano-Bicocca, Universita degli Studi di Milano-Bicocca, Dipartimento di Fisica ' G. Occhialini' , Piazza della Scienza 3, 20126 Milano (Italy); NAST Center (Nanoscienze-Nanotecnologie-Strumentazione), Universita degli Studi di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Tardocchi, M. [Universita degli Studi di Milano-Bicocca, Dipartimento di Fisica ' G. Occhialini' , Piazza della Scienza 3, 20126 Milano (Italy); Schooneveld, E.M. [ISIS Facility, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire 0QX OX11 (United Kingdom); Andreani, C.; Senesi, R. [Universia degli Studi di Roma Tor Vergata, Dipartimento di Fisica and NAST Center (Nanoscienze-Nanotecnologie-Strumentazione), via della Ricerca Scientifica 1, 00133 Roma (Italy)
2009-09-01
An investigation of the gamma background was carried out in the VESUVIO spectrometer at the ISIS spallation neutron source. This study, performed with a yttrium-aluminum-perovskite (YAP) scintillator, follows high resolution pulse height measurements of the gamma background carried out on the same instrument with the use of a high-purity germanium detector. In this experimental work, a mapping of the gamma background was attempted, trying to find the spatial distribution and degree of directionality of the different contributions identified in the previous study. It is found that the gamma background at low times is highly directional and mostly due to the gamma rays generated in the moderator-decoupler system. The other contributions, consistently to the findings of a previous experiment, are identified as a nearly isotropic one due to neutron absorption in the walls of the experimental hall, and a directional one coming from the beam dump.
Energy Technology Data Exchange (ETDEWEB)
Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Tosti, G. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Nori, M. [Department of Physics and Astronomy, University of Bologna, viale Berti Pichat 6/2, I-40127 Bologna (Italy)
2013-07-01
About one-third of the {gamma}-ray sources listed in the second Fermi Large Area Telescope catalog (2FGL) have no firmly established counterpart at lower energies and so are classified as unidentified gamma-ray sources (UGSs). Here, we propose a new approach to find candidate counterparts for the UGSs based on the 325 MHz radio survey performed with the Westerbork Synthesis Radio Telescope in the northern hemisphere. First, we investigate the low-frequency radio properties of blazars, the largest known population of {gamma}-ray sources; then we search for sources with similar radio properties combining the information derived from the Westerbork Northern Sky Survey (WENSS) with those of the NRAO Very Large Array Sky Survey. We present a list of candidate counterparts for 32 UGSs with at least one counterpart in the WENSS. We also performed an extensive research in the literature to look for infrared and optical counterparts of the {gamma}-ray blazar candidates selected using the low-frequency radio observations to confirm their nature. On the basis of our multifrequency research, we identify 23 new {gamma}-ray blazar candidates out of the 32 UGSs investigated. Comparison with previous results on the UGSs is also presented. Finally, we speculate on the advantages of using low-frequency radio observations to associate UGSs and to search for {gamma}-ray pulsar candidates.
Contribution to gamma ray transport calculation in heterogeneous media
International Nuclear Information System (INIS)
Bourdet, L.
1985-04-01
This thesis presents the development of gamma transport calculation codes in three dimension heterogeneous geometries. These codes allow us to define the protection against gamma-rays or verify their efficiency. The laws that govern the interactions of gamma-rays with matters are briefly revised. A library with the all necessary constants for these codes is created. TRIPOLI-2, a code that treats in exact way the neutron transport in matters using Monte-Carlo method, has been adapted to deal with the transport of gamma-rays in matters as well. TRINISHI, a code which considers only one collision, has been realized to treat heterogeneous geometries containing voids. Elaborating a formula that calculates the albedo for gamma-ray reflection (the code ALBANE) allows us to solve the problem of gamma-ray reflection on plane surfaces. NARCISSE-2 deals with gamma-rays that suffer only one reflection on the inner walls of any closed volume (rooms, halls...) [fr
Ipe, N. E.; McCall, R. C.; Baker, E. D.
1986-05-01
The Stanford Linear Accelerator Center (SLAC) operates a high energy (up to 33 GeV) linear accelerator delivering pulses up to a few microseconds wide. The pulsed nature of the electron beam creates problems in the detection and measurement of radiation both from the accelerator beam and the klystrons that provide the RF power for the accelerator. Hence, a pulsed X-ray facility has been built at SLAC mainly for the purpose of testing the response of different radiation detection instruments to pulsed radiation fields. The X-ray tube consists of an electron gun with a control grid. This provides a stream of pulsed electrons that can be accelerated towards a confined target-window. The window is made up of aluminum 0.051 cm (20 mils) thick, plated on the vacuum side with a layer of gold 0.0006 cm (1/4 mil) thick. The frequency of electron pulses can be varied by an internal pulser from 60 to 360 pulses per second with pulse widths of 360 ns to 5 ms. The pulse amplitude can be varied over a wide range of currents. An external pulser can be used to obtain other frequencies or special pulse shapes. The voltage across the gun can be varied from 0 to 100 kV. The major part of the X-ray tube is enclosed in a large walk-in-cabinet made of 1.9 cm (3/4 in) plywood and lined with 0.32 cm (1/8 in) lead to make a very versatile facility.
International Nuclear Information System (INIS)
Ipe, N.E.; McCall, R.C.; Baker, E.D.
1986-05-01
The Stanford Linear Accelerator Center (SLAC) operates a high energy (up to 33 GeV) linear accelerator delivering pulses up to a few microseconds wide. The pulsed nature of the electron beam creates problems in the detection and measurement of radiation both from the accelerator beam and the klystrons that provide the rf power for the accelerator. Hence, a pulsed x-ray facility has been built at SLAC mainly for the purpose of testing the response of different radiation detection instruments to pulsed radiation fields. The x-ray tube consists of an electron gun with a control grid. This provides a stream of pulsed electrons that can be accelerated towards a confined target-window. The window is made up of aluminium 0.051 cm (20 mils) thick, plated on the vacuum side with a layer of gold 0.0006 cm (1/4 mil) thick. The frequency of electron pulses can be varied by an internal pulser from 60 to 360 pulses per second with pulse widths of 360 ns to 5 μs. The pulse amplitude can be varied over a wide range of currents. An external pulser can be used to obtain other frequencies or special pulse shapes. The voltage across the gun can be varied from 0 to 100 kV. The major part of the x-ray tube is enclosed in a large walk-in-cabinet made of 1.9 cm (3/4 in) plywood and lined with 0.32 cm (1/8 in) lead to make a very versatile facility. 3 refs., 5 figs
Gamma-ray astronomy and cosmic-ray origin theory
International Nuclear Information System (INIS)
Ginzburg, V.L.
1973-01-01
A theory of the origin of cosmic radiation is discussed in light of the advances made in gamma-ray astronomy. Arguments against metagalactic models for the origin of cosmic rays are emphasized. (U.S.)
Prompt gamma-ray analysis of steel slag in concrete
International Nuclear Information System (INIS)
Naqvi, Akhtar Abbas; Garwan, Muhammad Ahmad; Nagadi, Mahmoud Mohammad; Rehman, Khateeb-ur; Raashid, Mohammad; Masalehuddin Mohiuddin, Mohammad; Al-Amoudi, Omar Saeed Baghabra
2009-01-01
Blast furnace slag (BFS) is added to Portland cement concrete to increase its durability, particularly its corrosion resistance. Monitoring the concentration of BFS in concrete for quality control purposes is desired. In this study, the concentration of BFS in concrete was measured by utilizing an accelerator-based prompt gamma-ray neutron activation analysis (PGNAA) setup. The optimum size of the BFS cement concrete specimen that produces the maximum intensity of gamma rays at the detector location was calculated through Monte Carlo simulations. The simulation results were experimentally validated through the gamma-ray yield measurement from BFS cement concrete specimens having different radii. The concentration of BFS in the cement concrete specimens was assessed through calcium and silicon gamma-ray yield measurement from cement concrete specimens containing 5 to 80 wt% BFS. The yield of calcium gamma rays decreases with increasing BFS concentration in concrete while the yield of silicon gamma rays increases with increasing BFS concentration in concrete. The calcium-to-silicon gamma-ray yield ratio has an inverse relation with BFS concentration in concrete. (author)
Optimized blind gamma-ray pulsar searches at fixed computing budget
International Nuclear Information System (INIS)
Pletsch, Holger J.; Clark, Colin J.
2014-01-01
The sensitivity of blind gamma-ray pulsar searches in multiple years worth of photon data, as from the Fermi LAT, is primarily limited by the finite computational resources available. Addressing this 'needle in a haystack' problem, here we present methods for optimizing blind searches to achieve the highest sensitivity at fixed computing cost. For both coherent and semicoherent methods, we consider their statistical properties and study their search sensitivity under computational constraints. The results validate a multistage strategy, where the first stage scans the entire parameter space using an efficient semicoherent method and promising candidates are then refined through a fully coherent analysis. We also find that for the first stage of a blind search incoherent harmonic summing of powers is not worthwhile at fixed computing cost for typical gamma-ray pulsars. Further enhancing sensitivity, we present efficiency-improved interpolation techniques for the semicoherent search stage. Via realistic simulations we demonstrate that overall these optimizations can significantly lower the minimum detectable pulsed fraction by almost 50% at the same computational expense.
Energy Technology Data Exchange (ETDEWEB)
Killian, E.W. [Idaho National Engineering Lab., Idaho Falls, ID (United States)
1997-11-01
A technique has been developed at the Idaho National Engineering Laboratory to sum high resolution gamma-ray pulse spectra from systems with multiple Ge detectors. Lockheed Martin Idaho Technologies Company operates a multi-detector spectrometer configuration at the Stored Waste Examination Pilot Plant facility which is used to characterize the radionuclide contents in waste drums destined for shipment to Waste Isolation Pilot Plant. This summing technique was developed to increase the sensitivity of the system, reduce the count times required to properly quantify the radio-nuclides and provide a more consistent methodology for combining data collected from multiple detectors. In spectrometer systems with multiple detectors looking at non homogeneous waste forms it is often difficult to combine individual spectrum analysis results from each detector to obtain a meaningful result for the total waste container. This is particularly true when the counting statistics in each individual spectrum are poor. The spectrum summing technique adds the spectra collected by each detector into a single spectrum which has better counting statistics than each individual spectrum. A normal spectral analysis program can then be used to analyze the sum spectrum to obtain radio-nuclide values which have smaller errors and do not have to be further manipulated to obtain results for the total waste container. 2 refs., 2 figs.
Interstellar medium structure and content and gamma ray astronomy
International Nuclear Information System (INIS)
Lebrun, F.
1982-05-01
A general description of gamma-ray astronomy is presented with special emphasis on the study of diffuse gamma-ray emission. This is followed by a collection of reflections and observations on the structure and the gas and dust content of the local interstellar medium. Results of gamma-ray observations on the local interstellar medium are given. The last part is devoted to the whole of the galactic gamma-ray emission and its interpretation [fr
Gamma Ray Tomographic Scan Method for Large Scale Industrial Plants
International Nuclear Information System (INIS)
Moon, Jin Ho; Jung, Sung Hee; Kim, Jong Bum; Park, Jang Geun
2011-01-01
The gamma ray tomography systems have been used to investigate a chemical process for last decade. There have been many cases of gamma ray tomography for laboratory scale work but not many cases for industrial scale work. Non-tomographic equipment with gamma-ray sources is often used in process diagnosis. Gamma radiography, gamma column scanning and the radioisotope tracer technique are examples of gamma ray application in industries. In spite of many outdoor non-gamma ray tomographic equipment, the most of gamma ray tomographic systems still remained as indoor equipment. But, as the gamma tomography has developed, the demand on gamma tomography for real scale plants also increased. To develop the industrial scale system, we introduced the gamma-ray tomographic system with fixed detectors and rotating source. The general system configuration is similar to 4 th generation geometry. But the main effort has been made to actualize the instant installation of the system for real scale industrial plant. This work would be a first attempt to apply the 4th generation industrial gamma tomographic scanning by experimental method. The individual 0.5-inch NaI detector was used for gamma ray detection by configuring circular shape around industrial plant. This tomographic scan method can reduce mechanical complexity and require a much smaller space than a conventional CT. Those properties make it easy to get measurement data for a real scale plant
Repeated pulsed x-ray emission equipment
International Nuclear Information System (INIS)
Terauchi, Hikaru; Iida, Satoshi
1982-01-01
X-ray diffraction technique has been applied to determine the spatial positions of atoms which compose a material, and it is needless to say that the technique is a fundamental means regardless of the fields of research. However, the application of X-ray diffraction to the research on physical properties has been so far limited to know the spatial positions of atoms or molecules under thermal equilibrium condition. The addition of time element to the conventional technique, that is, the analysis of material structure including the time-varying processes under non-equilibrium conditions, is considered to approach the elucidation of the essence of materials. The authors call this dynamic structural analysis. The authors have planned to analyze X-ray diffraction intensity which has the resolution of about 10 -8 s in the real time which is conjugate with energy. However, present pulsed X-ray sources are not suitable for diffraction experiment because the pulse width is too long or X-ray wavelength is too short. Accordingly, the authors have made for trial a pulsed X-ray source for diffraction experiment. Its specifications are: diode voltage (X-ray tube voltage) from 200 to 300 kV, diode current from 2 to 5 kA, pulse width of about 30ns, maximum repetition frequency 10 pps, and X-ray focus size of 2 mm diameter. One of the features of this source is the repeated generation of pulsed X-ray. This is the first trial in the world, and is indispensable to the dynamic structural analysis described above. The quality of the emitted X-ray is also written. (Wakatsuki, Y.)
Applications of Monte Carlo simulations of gamma-ray spectra
International Nuclear Information System (INIS)
Clark, D.D.
1995-01-01
A short, convenient computer program based on the Monte Carlo method that was developed to generate simulated gamma-ray spectra has been found to have useful applications in research and teaching. In research, we use it to predict spectra in neutron activation analysis (NAA), particularly in prompt gamma-ray NAA (PGNAA). In teaching, it is used to illustrate the dependence of detector response functions on the nature of gamma-ray interactions, the incident gamma-ray energy, and detector geometry
Fermi GBM Observations of Terrestrial Gamma-Ray Flashes
Wilson-Hodge, Colleen A.; Briggs, M. S.; Connaughton, V.; Fishman, G. J.; Bhat, P. N.; Paciesas, W. S.; Preece, R.; Kippen, R. M.; vonKienlin, A.; Dwyer, J. R.;
2010-01-01
This slide presentation explores the relationship between Terrestrial Gamma-Ray Flashes (TGF) and lightning. Using data from the World-Wide Lightning Location Network (WWLLN), and the gamma ray observations from Fermi's Gamma-ray Burst Monitor (GBM), the study reviews any causal relationship between TGFs and lightning. The conclusion of the study is that the TGF and lightning are simultaneous with out a causal relationship.
Cellular response to low Gamma-ray doses
Energy Technology Data Exchange (ETDEWEB)
Manzanares A, E; Vega C, H R; Leon, L.C. de . [Unidades Academicas de Estudios Nucleares, Universidad Autonoma de Zacatecas, A.P. 336, 98000 Zacatecas (Mexico); Rebolledo D, O; Radillo J, F [Facultad de Ciencias Biologicas y Agropecuarias de la Universidad de Colima, Colima (Mexico)
2002-07-01
Lymphocytes, obtained from healthy donors, were exposed to a low strength gamma-ray field to determine heat shock protein expression in function of radiation dose. Protein identification was carried out using mAb raised against Hsp70 and Hsc70.Hsp70 protein was detected after lymphocyte irradiation. In all cases, an increasing trend of relative amounts of Hsp70 in function to irradiation time was observed. After 1.25 c Gy gamma-ray dose, lymphocytes expressed Hsp70 protein, indicating a threshold response to gamma rays. (Author)
Cellular response to low Gamma-ray doses
International Nuclear Information System (INIS)
Manzanares A, E.; Vega C, H.R.; Leon, L.C. de; Rebolledo D, O.; Radillo J, F.
2002-01-01
Lymphocytes, obtained from healthy donors, were exposed to a low strength gamma-ray field to determine heat shock protein expression in function of radiation dose. Protein identification was carried out using mAb raised against Hsp70 and Hsc70.Hsp70 protein was detected after lymphocyte irradiation. In all cases, an increasing trend of relative amounts of Hsp70 in function to irradiation time was observed. After 1.25 c Gy gamma-ray dose, lymphocytes expressed Hsp70 protein, indicating a threshold response to gamma rays. (Author)
International Nuclear Information System (INIS)
Teegarden, B.J.
1982-01-01
A review of recent results in gamma-ray burst spectroscopy is given. Particular attention is paid to the recent discovery of emission and absorption features in the burst spectra. These lines represent the strongest evidence to date that gamma-ray bursts originate on or near neutron stars. Line parameters give information on the temperature, magnetic field and possibly the gravitational potential of the neutron star. The behavior of the continuum spectrum is also discussed. A remarkably good fit to nearly all bursts is obtained with a thermal-bremsstrahlung-like continuum. Significant evolution is observed of both the continuum and line features within most events
Energy Technology Data Exchange (ETDEWEB)
Vetter, K; Mihailescu, L; Nelson, K; Valentine, J; Wright, D
2006-10-05
In this document we discuss specific implementations for gamma-ray imaging instruments including the principle of operation and describe systems which have been built and demonstrated as well as systems currently under development. There are several fundamentally different technologies each with specific operational requirements and performance trade offs. We provide an overview of the different gamma-ray imaging techniques and briefly discuss challenges and limitations associated with each modality (in the appendix we give detailed descriptions of specific implementations for many of these technologies). In Section 3 we summarize the performance and operational aspects in tabular form as an aid for comparing technologies and mapping technologies to potential applications.
Pulse-to-pulse variations in accreting X-ray pulsars
Directory of Open Access Journals (Sweden)
Kretschmar Peter
2014-01-01
Full Text Available In most accreting X-ray pulsars, the periodic signal is very clear and easily shows up as soon as data covering sufficient pulse periods (a few ten are available. The mean pulse profile is often quite typical for a given source and with minor variations repeated and recognisable across observations done years or even decades apart. At the time scale of individual pulses, significant pulse-to-pulse variations are commonly observed. While at low energies some of these variations might be explained by absorption, in the hard X-rays they will reflect changes in the accretion and subsequent emission. The amount of these variations appears to be quite different between sources and contains information about the surrounding material as well ass possibly interactions at the magnetosphere. We investigate such variations for a sample of well-known sources.
Gamma-ray imaging spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy
International Nuclear Information System (INIS)
Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; MacCallum, C.J.; Stang, P.D.
1985-01-01
High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. Preliminary results such as the annihilation radiation from the galactic center, the 26 Al line from the galactic plane and cyclotron lines from neutron stars may well be just the initial discoveries of a rich and as yet undeveloped field. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload NASA decided to initiate a balloon program to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments. 6 refs., 2 figs
Effects of gamma irradiations on reactive pulsed laser deposited vanadium dioxide thin films
Energy Technology Data Exchange (ETDEWEB)
Madiba, I.G., E-mail: madibagiven@gmail.com [UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, P O Box 392, Pretoria (South Africa); Empa, Swiss Federal Laboratories Materials Science and Technology, CH-8600 Dübendorf (Switzerland); Émond, N.; Chaker, M. [Institut National de la Recherche Scientifique (INRS),1650 Blvd. Lionel-Boulet, Varennes, Québec J3X1S2 (Canada); Thema, F.T. [UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, P O Box 392, Pretoria (South Africa); iThemba LABS-National Research Foundation, 1 Old Faure Road, Somerset West 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); Tadadjeu, S.I. [iThemba LABS-National Research Foundation, 1 Old Faure Road, Somerset West 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa); Muller, U.; Zolliker, P. [Empa, Swiss Federal Laboratories Materials Science and Technology, CH-8600 Dübendorf (Switzerland); Braun, A. [ETH Zurich, Swiss Federal Institute of Technology, CH-8057, Zurich (Switzerland); Empa, Swiss Federal Laboratories Materials Science and Technology, CH-8600 Dübendorf (Switzerland); Kotsedi, L. [iThemba LABS-National Research Foundation, 1 Old Faure Road, Somerset West 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); and others
2017-07-31
Highlights: • Synthesis of VO{sub 2} thin films by Reactive pulsed laser deposition has been achieved. • Properties VO{sub 2} remain mainly unaffected when subjected to gamma ray doses similar to those encountered during space missions. • The long range crystal structure of VO{sub 2} remains intact upon irradiation on different doses up to 100 kGy. • XPS reveals a shift from V{sup 4+} to V{sup 5+} oxidation state upon irradiation, due to the frenkel pair formation on the surface. • Irradiated films show the characteristic SMT of VO{sub 2}, although the electrical and optical properties are slightly affected. - Abstract: Vanadium oxide films are considered suitable coatings for various applications such as thermal protective coating of small spacecrafts because of their thermochromic properties. While in outer space, such coating will be exposed to cosmic radiations which include γ-rays. To study the effect of these γ-rays on the coating properties, we have deposited vanadium dioxide (VO{sub 2}) films on silicon substrates and subjected them to extensive γ-irradiations with typical doses encountered in space missions. The prevalent crystallographic phase after irradiation remains the monoclinic VO{sub 2} phase but the films preferential orientation shifts to lower angles due to the presence of disordered regions caused by radiations. Raman spectroscopy measurements also evidences that the VO{sub 2} structure is slightly affected by gamma irradiation. Indeed, increasing the gamma rays dose locally alters the crystalline and electronic structures of the films by modifying the V–V inter-dimer distance, which in turns favours the presence of the VO{sub 2} metallic phase. From the XPS measurements of V2p and O1s core level spectra, an oxidation of vanadium from V{sup 4+} towards V{sup 5+} is revealed. The data also reveal a hydroxylation upon irradiation which is corroborated by the vanishing of a low oxidation state peak near the Fermi energy in the
Gamma-ray production cross-sections for the interactions of 14.9 MeV neutrons with Si, Cu, Nb and Pb
International Nuclear Information System (INIS)
Fan Guoying
1991-12-01
Gamma rays produced in the interactions of 14.9 MeV neutrons with Si, Cu, Nb and Pb targets were studied. The neutron beam was produced with the T(d,n)He reaction using 300 KeV Cockroft-Walton accelerator. Absolute neutron flux was determined by the associated particle technique. The time-of-flight technique was used to reduce the background. The FWHM of neutron pulses was 1.5 ns. A Ge(Li) detector was used for gamma-ray detection. 39 gamma lines for Si, 39 gamma lines for Cu, 79 for Nb and 39 for Pb were detected. Most of these gamma rays were emitted in (n,γ), (n,n') and (n,2n) reactions. The measurements were made at 40 deg. C, 55 deg. C, 125 deg. C and 140 deg. C relative to the incident neutron beam. The results are presented in the form of the data tables. 9 refs, 11 figs, 19 tabs
Shell-type SNRs as sources of cosmic rays
Sinitsyna, V. G.; Andreeva, M. S.; Balygin, K. A.; Borisov, S. S.; Ivanov, I. A.; Kirichenko, A. M.; Klimov, A. I.; Kozhukhova, I. P.; Mirzafatikhov, R. M.; Moseiko, N. I.; Ostashev, I. E.; Palamarchuk, A. I.; Sinitsyna, V. Y.; Volokh, I. G.
2017-06-01
Investigations of VHE gamma-ray sources by any methods, including mirror Cherenkov telescopes, touch on the problem of the cosmic ray origin and, accordingly, the role of the Galaxy in their generation. SHALON observations have yielded results on Galactic supernova remnants (SNR) of different ages. Among them are: the shell-type SNRs Tycho's SNR (1572y), Cas A (1680y), IC 443 (age ˜ (3 ÷ 30) × 103 y), Cygni SNR (age ˜ (5 ÷ 7) × 103 y), G166.0 + 4.3 (age ˜ 24 × 103 y) and the classical nova GK Per (Nova 1901). Observation results are presented for each of the SNRs with spectral energy distributions by SHALON in comparison with other experiment data and images by SHALON together with data from X-rays by Chandra and radio-data by CGPS. The collected experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy 800 GeV-100 TeV gamma-rays in Tycho's SNR, Cas A and IC443. For the first time, unique data on GK Per (Nova1901) TeV gamma-ray emission were obtained with the SHALON experiment. The X-ray data shows that the nova remnant of GK Per could be a younger remnant that will resemble older SNRs like IC 443 which interact with molecular clouds. GK Per is supposed to be a candidate for TeV gamma-ray emission due to accelerated particles in the reverse shock region.
Direct determination of the hit locations from experimental HPGe pulses
Energy Technology Data Exchange (ETDEWEB)
Désesquelles, P., E-mail: Pierre.Desesquelles@in2p3.fr [Univ. Paris-Sud, CSNSM CNRS/IN2P3, 15 rue G. Clémenceau, 91405 Orsay (France); Boston, A.J.; Boston, H.C.; Cresswell, J.R.; Dimmock, M.R. [Oliver Lodge Laboratory, The University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Lazarus, I.H. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Ljungvall, J. [Univ. Paris-Sud, CSNSM CNRS/IN2P3, 15 rue G. Clémenceau, 91405 Orsay (France); Nelson, L. [Oliver Lodge Laboratory, The University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Nga, D.-T. [Univ. Paris-Sud, CSNSM CNRS/IN2P3, 15 rue G. Clémenceau, 91405 Orsay (France); Nolan, P.J.; Rigby, S.V. [Oliver Lodge Laboratory, The University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Simpson, J. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Van-Oanh, N.-T. [Univ. Paris-Sud, LCP UMR8000 CNRS, 15 rue G. Clémenceau, 91405 Orsay (France)
2013-11-21
The gamma-tracking technique optimises the determination of the energy and emission angle of gamma-rays detected by modern segmented HPGe detectors. This entails the determination, using the delivered pulse shapes, of the interaction points of the gamma-ray within the crystal. The direct method presented here allows the localisation of the hits using only a large sample of pulses detected in the actual operating conditions. No external crystal scanning system or pulse shape simulation code is needed. In order to validate this method, it is applied to sets of pulses obtained using the University of Liverpool scanning system. The hit locations are determined by the method with good precision.
TARGET: A multi-channel digitizer chip for very-high-energy gamma-ray telescopes
Energy Technology Data Exchange (ETDEWEB)
Bechtol, K.; Funk, S.; /Stanford U., HEPL /KIPAC, Menlo Park; Okumura, A.; /JAXA, Sagamihara /Stanford U., HEPL /KIPAC, Menlo Park; Ruckman, L.; /Hawaii U.; Simons, A.; Tajima, H.; Vandenbroucke, J.; /Stanford U., HEPL /KIPAC, Menlo Park; Varner, G.; /Hawaii U.
2011-08-11
The next-generation very-high-energy (VHE) gamma-ray observatory, the Cherenkov Telescope Array, will feature dozens of imaging atmospheric Cherenkov telescopes (IACTs), each with thousands of pixels of photosensors. To be affordable and reliable, reading out such a mega-channel array requires event recording technology that is highly integrated and modular, with a low cost per channel. We present the design and performance of a chip targeted to this application: the TeV Array Readout with GSa/s sampling and Event Trigger (TARGET). This application-specific integrated circuit (ASIC) has 16 parallel input channels, a 4096-sample buffer for each channel, adjustable input termination, self-trigger functionality, and tight window-selected readout. We report the performance of TARGET in terms of sampling frequency, power consumption, dynamic range, current-mode gain, analog bandwidth, and cross talk. The large number of channels per chip allows a low cost per channel ($10 to $20 including front-end and back-end electronics but not including photosensors) to be achieved with a TARGET-based IACT readout system. In addition to basic performance parameters of the TARGET chip itself, we present a camera module prototype as well as a second-generation chip (TARGET 2), both of which have been produced.
CAMAC gamma ray scanning system
International Nuclear Information System (INIS)
Moss, C.E.; Pratt, J.C.; Shunk, E.R.
1981-01-01
A flexible gamma-ray scanning system, based on a LeCroy 3500 multichannel analyzer and CAMAC modules, is described. The system is designed for making simultaneous passive and active scans of objects of interest to nuclear safeguards. The scanner is a stepping-motor-driven carriage; the detectors, a bismuth-germanate scintillator and a high-purity germanium detector. A total of sixteen peaks in the two detector-produced spectra can be integrated simultaneously, and any scan can be viewed during data acquisition. For active scanning, the 2615-keV gamma-ray line from a 232 U source and the 4439-keV gamma-ray line from 9 Be(α,n) 12 C were selected. The system can be easily reconfigured to accommodate up to seven detectors because it is based on CAMAC modules and FORTRAN. The system is designed for field use and is easily transported. Examples of passive and active scans are presented
Population Studies of Radio and Gamma-Ray Pulsars
Harding, Alice K; Gonthier, Peter; Coltisor, Stefan
2004-01-01
Rotation-powered pulsars are one of the most promising candidates for at least some of the 40-50 EGRET unidentified gamma-ray sources that lie near the Galactic plane. Since the end of the EGRO mission, the more sensitive Parkes Multibeam radio survey has detected mere than two dozen new radio pulsars in or near unidentified EGRET sources, many of which are young and energetic. These results raise an important question about the nature of radio quiescence in gamma-ray pulsars: is the non-detection of radio emission a matter of beaming or of sensitivity? The answer is very dependent on the geometry of the radio and gamma-ray beams. We present results of a population synthesis of pulsars in the Galaxy, including for the first time the full geometry of the radio and gamma-ray beams. We use a recent empirically derived model of the radio emission and luminosity, and a gamma-ray emission geometry and luminosity derived theoretically from pair cascades in the polar slot gap. The simulation includes characteristics of eight radio surveys of the Princeton catalog plus the Parkes MB survey. Our results indicate that EGRET was capable of detecting several dozen pulsars as point sources, with the ratio of radio-loud to radio-quiet gamma-ray pulsars increasing significantly to about ten to one when the Parkes Survey is included. Polar cap models thus predict that many of the unidentified EGRET sources could be radio-loud gamma- ray pulsars, previously undetected as radio pulsars due to distance, large dispersion and lack of sensitivity. If true, this would make gamma-ray telescopes a potentially more sensitive tool for detecting distant young neutron stars in the Galactic plane.
Guideline of Monte Carlo calculation. Neutron/gamma ray transport simulation by Monte Carlo method
2002-01-01
This report condenses basic theories and advanced applications of neutron/gamma ray transport calculations in many fields of nuclear energy research. Chapters 1 through 5 treat historical progress of Monte Carlo methods, general issues of variance reduction technique, cross section libraries used in continuous energy Monte Carlo codes. In chapter 6, the following issues are discussed: fusion benchmark experiments, design of ITER, experiment analyses of fast critical assembly, core analyses of JMTR, simulation of pulsed neutron experiment, core analyses of HTTR, duct streaming calculations, bulk shielding calculations, neutron/gamma ray transport calculations of the Hiroshima atomic bomb. Chapters 8 and 9 treat function enhancements of MCNP and MVP codes, and a parallel processing of Monte Carlo calculation, respectively. An important references are attached at the end of this report.
Stonehill, L. C.; Coupland, D. D. S.; Dallmann, N. A.; Feldman, W. C.; Mesick, K.; Nowicki, S.; Storms, S.
2017-12-01
The Elpasolite Planetary Ice and Composition Spectrometer (EPICS) is an innovative, low-resource gamma-ray and neutron spectrometer for planetary science missions, enabled by new scintillator and photodetector technologies. Neutrons and gamma rays are produced by cosmic ray interactions with planetary bodies and their subsequent interactions with the near-surface materials produce distinctive energy spectra. Measuring these spectra reveals details of the planetary near-surface composition that are not accessible through any other phenomenology. EPICS will be the first planetary science instrument to fully integrate the neutron and gamma-ray spectrometers. This integration is enabled by the elpasolite family of scintillators that offer gamma-ray spectroscopy energy resolutions as good as 3% FWHM at 662 keV, thermal neutron sensitivity, and the ability to distinguish gamma-ray and neutron signals via pulse shape differences. This new detection technology will significantly reduce size, weight, and power (SWaP) while providing similar neutron performance and improved gamma energy resolution compared to previous scintillator instruments, and the ability to monitor the cosmic-ray source term. EPICS will detect scintillation light with silicon photomultipliers rather than traditional photomultiplier tubes, offering dramatic additional SWaP reduction. EPICS is under development with Los Alamos National Laboratory internal research and development funding. Here we report on the EPICS design, provide an update on the current status of the EPICS development, and discuss the expected sensitivity and performance of EPICS in several potential missions to airless bodies.
Gamma compensated pulsed ionization chamber wide range neutron/reactor power measurement system
International Nuclear Information System (INIS)
Ellis, W.H.
1975-01-01
An improved method and system of pulsed mode operation of ionization chambers is described in which a single sensor system with gamma compensation is provided by sampling, squaring, automatic gate selector, and differential amplifier circuit means, employed in relation to chambers sensitized to neutron plus gamma and gamma only to subtract out the gamma component, wherein squaring functions circuits, a supplemental high performance pulse rate system, and operational and display mode selection and sampling gate circuits are utilized to provide automatic wide range linear measurement capability for neutron flux and reactor power. Neon is employed as an additive in the ionization chambers to provide independence of ionized gas kinetics temperature effects, and the pulsed mode of operation provide independence of high temperature insulator leakage effects. (auth)
AGIS -- the Advanced Gamma-ray Imaging System
Krennrich, Frank
2009-05-01
The Advanced Gamma-ray Imaging System, AGIS, is envisioned to become the follow-up mission of the current generation of very high energy gamma-ray telescopes, namely, H.E.S.S., MAGIC and VERITAS. These instruments have provided a glimpse of the TeV gamma-ray sky, showing more than 70 sources while their detailed studies constrain a wealth of physics and astrophysics. The particle acceleration, emission and absorption processes in these sources permit the study of extreme physical conditions found in galactic and extragalactic TeV sources. AGIS will dramatically improve the sensitivity and angular resolution of TeV gamma-ray observations and therefore provide unique prospects for particle physics, astrophysics and cosmology. This talk will provide an overview of the science drivers, scientific capabilities and the novel technical approaches that are pursued to maximize the performance of the large array concept of AGIS.
Gamma-ray flares from the Crab Nebula.
Abdo, A A; Ackermann, M; Ajello, M; Allafort, A; Baldini, L; Ballet, J; Barbiellini, G; Bastieri, D; Bechtol, K; Bellazzini, R; Berenji, B; Blandford, R D; Bloom, E D; Bonamente, E; Borgland, A W; Bouvier, A; Brandt, T J; Bregeon, J; Brez, A; Brigida, M; Bruel, P; Buehler, R; Buson, S; Caliandro, G A; Cameron, R A; Cannon, A; Caraveo, P A; Casandjian, J M; Çelik, Ö; Charles, E; Chekhtman, A; Cheung, C C; Chiang, J; Ciprini, S; Claus, R; Cohen-Tanugi, J; Costamante, L; Cutini, S; D'Ammando, F; Dermer, C D; de Angelis, A; de Luca, A; de Palma, F; Digel, S W; do Couto e Silva, E; Drell, P S; Drlica-Wagner, A; Dubois, R; Dumora, D; Favuzzi, C; Fegan, S J; Ferrara, E C; Focke, W B; Fortin, P; Frailis, M; Fukazawa, Y; Funk, S; Fusco, P; Gargano, F; Gasparrini, D; Gehrels, N; Germani, S; Giglietto, N; Giordano, F; Giroletti, M; Glanzman, T; Godfrey, G; Grenier, I A; Grondin, M-H; Grove, J E; Guiriec, S; Hadasch, D; Hanabata, Y; Harding, A K; Hayashi, K; Hayashida, M; Hays, E; Horan, D; Itoh, R; Jóhannesson, G; Johnson, A S; Johnson, T J; Khangulyan, D; Kamae, T; Katagiri, H; Kataoka, J; Kerr, M; Knödlseder, J; Kuss, M; Lande, J; Latronico, L; Lee, S-H; Lemoine-Goumard, M; Longo, F; Loparco, F; Lubrano, P; Madejski, G M; Makeev, A; Marelli, M; Mazziotta, M N; McEnery, J E; Michelson, P F; Mitthumsiri, W; Mizuno, T; Moiseev, A A; Monte, C; Monzani, M E; Morselli, A; Moskalenko, I V; Murgia, S; Nakamori, T; Naumann-Godo, M; Nolan, P L; Norris, J P; Nuss, E; Ohsugi, T; Okumura, A; Omodei, N; Ormes, J F; Ozaki, M; Paneque, D; Parent, D; Pelassa, V; Pepe, M; Pesce-Rollins, M; Pierbattista, M; Piron, F; Porter, T A; Rainò, S; Rando, R; Ray, P S; Razzano, M; Reimer, A; Reimer, O; Reposeur, T; Ritz, S; Romani, R W; Sadrozinski, H F-W; Sanchez, D; Saz Parkinson, P M; Scargle, J D; Schalk, T L; Sgrò, C; Siskind, E J; Smith, P D; Spandre, G; Spinelli, P; Strickman, M S; Suson, D J; Takahashi, H; Takahashi, T; Tanaka, T; Thayer, J B; Thompson, D J; Tibaldo, L; Torres, D F; Tosti, G; Tramacere, A; Troja, E; Uchiyama, Y; Vandenbroucke, J; Vasileiou, V; Vianello, G; Vitale, V; Wang, P; Wood, K S; Yang, Z; Ziegler, M
2011-02-11
A young and energetic pulsar powers the well-known Crab Nebula. Here, we describe two separate gamma-ray (photon energy greater than 100 mega-electron volts) flares from this source detected by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. The first flare occurred in February 2009 and lasted approximately 16 days. The second flare was detected in September 2010 and lasted approximately 4 days. During these outbursts, the gamma-ray flux from the nebula increased by factors of four and six, respectively. The brevity of the flares implies that the gamma rays were emitted via synchrotron radiation from peta-electron-volt (10(15) electron volts) electrons in a region smaller than 1.4 × 10(-2) parsecs. These are the highest-energy particles that can be associated with a discrete astronomical source, and they pose challenges to particle acceleration theory.
Gamma-ray flares from the Crab nebula
International Nuclear Information System (INIS)
Abdo, A.A.; Ackermann, M.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Naumann-Godo, M.; Pierbattista, M.; Tibaldo, L.
2011-01-01
A young and energetic pulsar powers the well-known Crab Nebula. Here, we describe two separate gamma-ray (photon energy greater than 100 mega-electron volts) flares from this source detected by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. The first flare occurred in February 2009 and lasted approximately 16 days. The second flare was detected in September 2010 and lasted approximately 4 days. During these outbursts, the gamma-ray flux from the nebula increased by factors of four and six, respectively. The brevity of the flares implies that the gamma rays were emitted via synchrotron radiation from peta-electron-volt (10 15 electron volts) electrons in a region smaller than 1.4 * 10 -2 parsecs. These are the highest-energy particles that can be associated with a discrete astronomical source, and they pose challenges to particle acceleration theory. (authors)
Very high energy gamma-ray astronomy
International Nuclear Information System (INIS)
Weekes, T.C.
1988-01-01
Current interest in gamma-ray astronomy at energies above 100 GeV comes from the identification of Cygnus X-3 and other X-ray binaries as sources. In addition there are reports of emission from radio pulsars and a variety of other objects. The statistical significance of many of the observations is not high and many reported effects await confirmation, but there are a sufficient number of independent reports that very high energy gamma-ray astronomy must now be considered to have an observational basis. The observations are summarized with particular emphasis on those reported since 1980. The techniques used - the detection of small air showers using the secondary photons and particles at ground level - are unusual and are described. Future prospects for the field are discussed in relation to new ground-based experiments, satellite gamma-ray studies and proposed neutrino astronomy experiments. (orig.) With 296 refs
International Nuclear Information System (INIS)
Merriman, L.D.
1984-04-01
Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243 Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243 Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references
Aircraft gamma-ray spectrometry in snow-water equivalent measurement
International Nuclear Information System (INIS)
Kuittinen, R.; Vironmaeki, J.
1979-01-01
During the winter periods 1976-1977 and 1977-1978 the Hydrological Office at the National Board of Waters and the Geological Survey of Finland carried out a joint study to evaluate usefuluess of gamma-ray spectrometry in snow-water equivalent measurement. A multichannel gamma-ray spectrometer was fitted in a DC-3 aircraft. Fourteen snow courses were operated using both the gravimetric method and the gamma-ray method. The snow courses were located in southern Finland in forest, swamp and agricultural land. The results shows that the gamma ray method can be considered suitable for use in Finnish conditions and the accuracy of the gamma-ray method is almost of the same magnitude as the accuracy of the gravimetric method. (Auth.)
Aircraft gamma-ray spectrometry in snow-water equivalent measurement
Energy Technology Data Exchange (ETDEWEB)
Kuittinen, R [National Board of Waters (Finland); Vironmaeki, J [Geological Survey of Finland
1979-01-01
During the winter periods 1976-1977 and 1977-1978 the Hydrological Office at the National Board of Waters and the Geological Survey of Finland carried out a joint study to evaluate usefuluess of gamma-ray spectrometry in snow-water equivalent measurement. A multichannel gamma-ray spectrometer was fitted in a DC-3 aircraft. Fourteen snow courses were operated using both the gravimetric method and the gamma-ray method. The snow courses were located in southern Finland in forest, swamp and agricultural land. The results shows that the gamma ray method can be considered suitable for use in Finnish conditions and the accuracy of the gamma-ray method is almost of the same magnitude as the accuracy of the gravimetric method.
Aircraft gamma-ray spectrometry in snow-water equivalent measurement
Energy Technology Data Exchange (ETDEWEB)
Kuittinen, R; Vironmaeki, J
1979-01-01
During the winter periods of 1976 to 1977 and 1977 to 1978, the Hydrological Office at the National Boards of Waters and the Geological Survey of Finland carried out a joint study to evaluate usefulness of gamma-ray spectrometry in snowwater equivalent measurement. A multichannel gamma-ray spectrometry was fitted out in a DC-3 aircraft. Fourteen snow courses were operated using gravimetric method and gamma-ray method. The snow courses were located in southern Finland in forest, swamp and agricultural land. The results show that the gamma ray method can be considered suitable for use in Finnish conditions and the accuracy of the gamma-ray method is almost of the same magnitude of the accuracy of the gravimetric method.
The self-absorption effect of gamma rays in 239Pu
International Nuclear Information System (INIS)
Hsiaohua Hsu
1989-01-01
Nuclear materials assay with gamma-ray spectrum measurement is a well-established method for safeguards. However, for a thick source, the self-absorption of characteristic low-energy gamma rays has been a handicap to accurate assay. The author has carried out Monte Carlo simulations to study this effect using the 239 Pu α-decay gamma-ray spectrum as an example. The thickness of a plutonium metal source can be considered a function of gamma-ray intensity ratios. In a practical application, gamma-ray intensity ratios can be obtained from a measured spectrum. With the help of calculated curves, scientists can find the source thickness and make corrections to gamma-ray intensities, which then lead to an accurate quantitative determination of radioactive isotopes in the material
Supernova sheds light on gamma-ray bursts
2003-01-01
On 29 March the HETE-II satellite detected the most violent explosion in the universe to date - an enormous burst of gamma rays. Observers across the world recorded and studied the event. It appears to prove that gamma ray bursts originate in supernovae (1 page)
International Nuclear Information System (INIS)
Tavani, M.; Caraveo, P.; Mereghetti, S.; Perotti, F.; Vercellone, S.; Barbiellini, G.; Budini, G.; Longo, F.; Prest, M.; Vallazza, E.; Cocco, V.; Morselli, A.; Picozza, P.; Pittori, C.; Costa, E.; Feroci, M.; Lapshov, I.; Morelli, E.; Rubini, A.; Soffitta, P.
2000-01-01
AGILE is an innovative, cost-effective gamma-ray mission selected by the Italian Space Agency for a Program of Small Scientific Missions. The AGILE gamma-ray imaging detector (GRID, made of a Silicon tracker and CsI Mini-Calorimeter) is designed to detect and image photons in the 30 MeV-50 GeV energy band with good sensitivity and very large field of view (FOV ∼3 sr). The X-ray detector, Super-AGILE, sensitive in the 10-40 keV band and integrated on top of the GRID gamma-ray tracker will provide imaging (1-3 arcmin) and moderate spectroscopy. For selected sky areas, AGILE might achieve a flux sensitivity (above 100 MeV) better than 5x10 -8 ph cm 2 s -1 at the completion of its scientific program. AGILE will operate as an Observatory open to the international community and is planned to be operational during the year 2002 for a nominal 2-year mission. It will be an ideal 'bridge' between EGRET and GLAST, and the only mission entirely dedicated to high-energy astrophysics above 30 MeV during that period
Design Study for Direction Variable Compton Scattering Gamma Ray
Kii, T.; Omer, M.; Negm, H.; Choi, Y. W.; Kinjo, R.; Yoshida, K.; Konstantin, T.; Kimura, N.; Ishida, K.; Imon, H.; Shibata, M.; Shimahashi, K.; Komai, T.; Okumura, K.; Zen, H.; Masuda, K.; Hori, T.; Ohgaki, H.
2013-03-01
A monochromatic gamma ray beam is attractive for isotope-specific material/medical imaging or non-destructive inspection. A laser Compton scattering (LCS) gamma ray source which is based on the backward Compton scattering of laser light on high-energy electrons can generate energy variable quasi-monochromatic gamma ray. Due to the principle of the LCS gamma ray, the direction of the gamma beam is limited to the direction of the high-energy electrons. Then the target object is placed on the beam axis, and is usually moved if spatial scanning is required. In this work, we proposed an electron beam transport system consisting of four bending magnets which can stick the collision point and control the electron beam direction, and a laser system consisting of a spheroidal mirror and a parabolic mirror which can also stick the collision point. Then the collision point can be placed on one focus of the spheroid. Thus gamma ray direction and collision angle between the electron beam and the laser beam can be easily controlled. As the results, travelling direction of the LCS gamma ray can be controlled under the limitation of the beam transport system, energy of the gamma ray can be controlled by controlling incident angle of the colliding beams, and energy spread can be controlled by changing the divergence of the laser beam.
Analytical applications of neutron capture gamma-rays
International Nuclear Information System (INIS)
Lindstrom, R.M.; Paul, R.L.; Anderson, D.L.; Paul, R.L.
1997-01-01
Field and industrial applications of neutron capture gamma-ray spectrometry with isotopic sources or neutron generators are economically important. Geochemical exploration in boreholes is done routinely with neutron probes. Coal and ores are assayed with analyzers adjacent to a conveyor belt in dozens of industrial facilities. The use of capture gamma rays for explosives detection has been described in the literature, both for scanning airline baggage and for characterizing obsolete munitions; a packaged system for the latter is available commercially. Generalizations are drawn from the history of the field, and predictions are made about the future usefulness of capture gamma rays. (author)
International Nuclear Information System (INIS)
Ahmadov, G.; Madatov, R.; Sadigov, A.; Sadygov, Z.; Jafarova, E.; Ahmadov, G.; Sadygov, Z.; Olshevski, A.; Zerrouk, F.; Mukhtarov, R.
2015-01-01
Being capable measuring small lights gives possibility to use micro-pixel avalanche photodiodes with scintillators. It is shown two prototypes to use micro-pixel avalanche photodiodes with and without scintillators as alpha and gamma counters in this paper. First prototype is to use two micro-pixel avalanche photodiodes. One for detecting alpha particles and closer to it, the second one with a thin plastic scintillator for detecting gamma rays. Second prototype is called two-layers configuration in which it is used only one micro-pixel avalanche photodiode, but two scntillators with different decay times. One can distinquish alpha particle and gamma ray events by using pulse shape discrimination techniques in the two-layer configuration. In this work an alpha particle and gamma ray counting performance of micro-pixel avalanche photodiodes without scintillators and its combination of plastic and BGO+ plastic scintillators was investigated. Obtained results showed the detection performance of the micro-pixel avalanche photodiodes in combination with plastic scintillator was about the same as conventional semiconductor detectors
A silicon photomultiplier readout for time of flight neutron spectroscopy with {gamma}-ray detectors
Energy Technology Data Exchange (ETDEWEB)
Pietropaolo, A.; Gorini, G. [Dipartimento di Fisica ' ' G. Occhialini' ' and CNISM, Universita Degli Studi di Milano-Bicocca, Piazza della Scienza 3, 20126 Milano (Italy); Festa, G.; Andreani, C.; De Pascale, M. P.; Reali, E. [Dipartimento di Fisica and Centro NAST, Universita degli Studi di Roma Tor Vergata, Via della Ricerca Scientifica 1, 00133, Roma (Italy); Grazzi, F. [Istituto dei Sistemi Complessi-Consiglio Nazionale delle Ricerche, Via Madonna del Piano n.10, I-50019 Sesto Fiorentino, Firenze (Italy); Schooneveld, E. M. [ISIS Facility, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire, OX11 0QX (United Kingdom)
2009-09-15
The silicon photomultiplier (SiPM) is a recently developed photosensor used in particle physics, e.g., for detection of minimum ionizing particles and/or Cherenkov radiation. Its performance is comparable to that of photomultiplier tubes, but with advantages in terms of reduced volume and magnetic field insensitivity. In the present study, the performance of a gamma ray detector made of an yttrium aluminum perovskite scintillation crystal and a SiPM-based readout is assessed for use in time of flight neutron spectroscopy. Measurements performed at the ISIS pulsed neutron source demonstrate the feasibility of {gamma}-detection based on the new device.
100 MH/sub z/ fiber optic single transient gamma ray detection system
International Nuclear Information System (INIS)
Ogle, J.W.; Smith, R.C.; Ward, M.; Ramsey, R.; Hollabaugh, J.
1984-01-01
A fiber optic system has been developed to measure single transient gamma rays. The gamma ray signature is converted to light by the Cerenkov process in a 20 cm length of radiation resistant optical fiber. The signal is transmitted over 1 km of optical fiber and detected by state-of-the-art, 175 MHz analog receivers. The receivers are based on silicon PIN detectors with transimpedance hybrid amplifiers and two stages of power amplification. The dc coupled receivers have less than 2% distortion up to 5 volts with less than 10 mV rms noise and a responsivity of 37,500 V/watt at 800 nm. A calibration system measures relative fiber to fiber transit time delays and system sensitivity. System bandwidth measurements utilized an electron linear accelerator (Linac) with a 50 ps electron pulse as the Cerenkov light source. The system will be described with supporting calibration and characterization data of parts of the system and the whole system. 5 references, 7 figures, 4 tables
Summary of existing information on gamma-ray and X-ray attenuation coefficients of solutions
DEFF Research Database (Denmark)
Singh, K.; Gerward, Leif
2002-01-01
Accurate values of X-ray and gamma-ray attenuation coefficients of different chemicals are required in spectrometry as well as in many other scientific, engineering and medical disciplines involving photon radiation. The current state of knowledge of experimental and theoretical gamma-ray and X-r......-ray attenuation coefficients in aqueous solutions of salts is presented and exemplified by recent work. The results presented provide a basis for studying X-ray and gamma-ray photon interactions with ions in solution (hydrated ions) rather than ion compounds in solid form....
Guidelines for radioelement mapping using gamma ray spectrometry data
International Nuclear Information System (INIS)
2003-07-01
The purpose of the report is to provide an up-to-date review on the use of gamma ray spectrometry for radioelement mapping and, where appropriate, provide guidelines on the correct application of the method. It is a useful training guide for those new to the method. It gives a broad coverage of all aspects of the gamma ray method and provides a comprehensive list of references. The report gives an overview of the theoretical background to radioactivity and the gamma ray spectrometric method followed by a review of the application of the method to mapping the radiation environment. A brief outline is presented of the principles of radioactivity, the interaction of gamma rays with matter, instrumentation applied to the measurement of gamma rays, and the quantities and units in contemporary use in gamma ray spectrometry. This is followed by a review of the fundamentals of gamma ray spectrometry, and its application to ground and airborne mapping. Covered are also all aspects of the calibration and data processing procedures required for estimating the ground concentrations of the radioelements. The procedures required for the recovery of older survey data are also presented as well as an overview of data presentation and integration for mapping applications
Generation of laser Compton gamma-rays using Compact ERL
International Nuclear Information System (INIS)
Shizuma, Toshiyuki; Hajima, Ryoichi; Nagai, Ryoji; Hayakawa, Takehito; Mori, Michiaki; Seya, Michio
2015-01-01
Nondestructive isotope-specific assay system using nuclear resonance fluorescence has been developed at JAEA. In this system, intense, mono-energetic laser Compton scattering (LCS) gamma-rays are generated by combining an energy recovery linac (ERL) and laser enhancement cavity. As technical development for such an intense gamma-ray source, we demonstrated generation of LCS gamma-rays using Compact ERL (supported by the Ministry of Education, Culture, Sports, Science and Technology) developed in collaboration with KEK. We also measured X-ray fluorescence for elements near iron region by using mono-energetic LCS gamma-rays. In this presentation, we will show results of the experiment and future plan. (author)
International Nuclear Information System (INIS)
Gerber, M.S.; Muller, D.W.
1976-01-01
The analysis of an orthogonal strip, two-dimensional position sensitive high purity germanium gamma ray detector is discussed. Position sensitivity is obtained by connecting each electrode strip on the detector to a resistor network. Charge, entering the network, divides in relation to the resistance between its entry point and the virtual earth points of the charge sensitive preamplifiers located at the end of each resistor network. The difference of the voltage pulses at the output of each preamplifier is proportional to the position at which the charge entered the resistor network and the sum of the pulse is proportional to the energy of the detected gamma ray. The analysis and spatial noise resolution is presented for this type of position sensitive detector. The results of the analysis show that the position resolution is proportional to the square root of the filter amplifier's output pulse time constant and that for energy measurement the resolution is maximized at the filter amplifier's noise corner time constant. The design of the electronic noise filtering system for the prototype gamma ray camera was based on the mathematical energy and spatial resolution equations. For the spatial channel a Gaussian trapezoidal filtering system was developed. Gaussian filtering was used for the energy channel. The detector noise model was verified by taking rms noise measurements of the filtered energy and spatial pulses from resistive readout charge dividing detectors. These measurements were within 10% of theory. (Auth.)
International Nuclear Information System (INIS)
Bogomolov, V.V.; Svertilov, S.I.; Maximov, I.A.; Panasyuk, M.I.; Garipov, G.K.
2016-01-01
SINP MSU provided a number of experiments with scintillator gamma-spectrometers for study of spectral, temporal and spatial characteristics of TGEs as well as for search of fast hard x-ray and gamma-ray flashes probably appearing at the moment of lightning. The measurements were done in Moscow region and in Armenia at Aragats Mountain. Each instrument used in this work was able to record data in so called “event mode”: the time of each interaction was recorded with ∼15 mcs accuracy together with detailed spectral data. Such design allowed one to look for fast sequences of gamma-quanta, coming at the moments of discharges during thunderstorms. The pulse-shape analysis made by detector electronics was used to separate real gammaray events and possible imitations of flashes by electrical disturbances when discharges occur. During the time period from spring to autumn of 2015 a number of TGEs were detected. Spectral analysis of received data showed that the energy spectrum of coming radiation in 20-3000 kev range demonstrate a set of gamma-ray lines that can be interpreted as radiation from Rn-222 daughter isotopes. The increase of Rn-222 radiation was detected during rainfalls with thunderstorm as well as during rainy weather without thunderstorms. Variations of Rn-222 radiation dominate in low energies (<2.6MeV) and must be taken into account in the experiments performed to measure low energy gamma-radiation from the electrons accelerated in thunderclouds. In order to determine the direction from which the additional gamma-quanta come the experiment with collimated gamma-spectrometer placed on rotated platform was done. The results of this experiment realized in Moscow region from august, 2015 will be presented as well as the results of comparison of different TGEs measured in Moscow region and in Armenia. (author)
Gamma ray lines from a universal extra dimension
Energy Technology Data Exchange (ETDEWEB)
Bertone, Gianfranco; Jackson, C. B.; Shaughnessy, Gabe; Tait, Tim M.P.; Vallinotto, Alberto
2012-03-01
Indirect Dark Matter searches are based on the observation of secondary particles produced by the annihilation or decay of Dark Matter. Among them, gamma-rays are perhaps the most promising messengers, as they do not suffer deflection or absorption on Galactic scales, so their observation would directly reveal the position and the energy spectrum of the emitting source. Here, we study the detailed gamma-ray energy spectrum of Kaluza--Klein Dark Matter in a theory with 5 Universal Extra Dimensions. We focus in particular on the two body annihilation of Dark Matter particles into a photon and another particle, which produces monochromatic photons, resulting in a line in the energy spectrum of gamma rays. Previous calculations in the context of the five dimensional UED model have computed the line signal from annihilations into \\gamma \\gamma, but we extend these results to include \\gamma Z and \\gamma H final states. We find that these spectral lines are subdominant compared to the predicted \\gamma \\gamma signal, but they would be important as follow-up signals in the event of the observation of the \\gamma \\gamma line, in order to distinguish the 5d UED model from other theoretical scenarios.
Energy Technology Data Exchange (ETDEWEB)
Tornow, W., E-mail: tornow@tunl.duke.edu [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Esterline, J.H. [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Leckey, C.A. [Department of Physics, The College of William and Mary, Williamsburg, VA 23187 (United States); Weisel, G.J. [Department of Physics, Penn State Altoona, Altoona, PA 16601 (United States)
2011-08-11
We report on features of high-pressure {sup 3}He-Xe gas scintillators which have not been sufficiently addressed in the past. Such gas scintillators can be used not only for the efficient detection of low-energy neutrons but at the same time for the detection and identification of {gamma}-rays as well. Furthermore, {sup 3}He-Xe gas scintillators are also very convenient detectors for fast neutrons in the 1-10 MeV energy range and for high-energy {gamma}-rays in the 7-15 MeV energy range. Due to their linear pulse-height response and self calibration via the {sup 3}He(n,p){sup 3}H reaction, neutron and {gamma}-ray energies can easily be determined in this high-energy regime.
Gamma-ray spectrometry laboratory and in situ: developments and environmental applications
International Nuclear Information System (INIS)
Gasser, Estelle
2014-01-01
Gamma-ray spectrometry enables determining all γ-ray emitters in a sample with a single measurement. Self-absorption of γ-rays in samples is manifest by a loss or a gain of pulses that results in a poor estimation of the counting efficiency. To characterize a new counting geometry improvements of the existing set-up were made with MCNPX simulations. With the new geometry we could specify absorbed and annual effective doses as well as dose conversion factors for the natural radioisotopes of several building materials and soil samples. Simulations show the influence of detection limits of γ-radiation on dose conversion factors and the need for updating these factors. γ-ray measurements of soil in situ require different counting efficiencies simulated by MCNPX for a semi-infinite source. Two in-situ soil analyses were made, one around a nuclear power and the other for a private company. (author)
Gamma ray auto absorption correction evaluation methodology
International Nuclear Information System (INIS)
Gugiu, Daniela; Roth, Csaba; Ghinescu, Alecse
2010-01-01
Neutron activation analysis (NAA) is a well established nuclear technique, suited to investigate the microstructural or elemental composition and can be applied to studies of a large variety of samples. The work with large samples involves, beside the development of large irradiation devices with well know neutron field characteristics, the knowledge of perturbing phenomena and adequate evaluation of correction factors like: neutron self shielding, extended source correction, gamma ray auto absorption. The objective of the works presented in this paper is to validate an appropriate methodology for gamma ray auto absorption correction evaluation for large inhomogeneous samples. For this purpose a benchmark experiment has been defined - a simple gamma ray transmission experiment, easy to be reproduced. The gamma ray attenuation in pottery samples has been measured and computed using MCNP5 code. The results show a good agreement between the computed and measured values, proving that the proposed methodology is able to evaluate the correction factors. (authors)
Energy Technology Data Exchange (ETDEWEB)
Nocente, M., E-mail: massimo.nocente@mib.infn.it; Gorini, G. [Dipartimento di Fisica “G. Occhialini,” Università degli Studi di Milano-Bicocca, Milano (Italy); Istituto di Fisica del Plasma “P. Caldirola,” EURATOM-ENEA-CNR Association, Milano (Italy); Fazzi, A.; Lorenzoli, M.; Pirovano, C. [Dipartimento di Energia, CeSNEF, Politecnico di Milano, Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Milano, Milano (Italy); Tardocchi, M. [Istituto di Fisica del Plasma “P. Caldirola,” EURATOM-ENEA-CNR Association, Milano (Italy); Cazzaniga, C.; Rebai, M. [Dipartimento di Fisica “G. Occhialini,” Università degli Studi di Milano-Bicocca, Milano (Italy); Uboldi, C.; Varoli, V. [Dipartimento di Energia, CeSNEF, Politecnico di Milano, Milano (Italy)
2014-11-15
A matrix of Silicon Photo Multipliers has been developed for light readout from a large area 1 in. × 1 in. LaBr{sub 3} crystal. The system has been characterized in the laboratory and its performance compared to that of a conventional photo multiplier tube. A pulse duration of 100 ns was achieved, which opens up to spectroscopy applications at high counting rates. The energy resolution measured using radioactive sources extrapolates to 3%–4% in the energy range E{sub γ} = 3–5 MeV, enabling gamma-ray spectroscopy measurements at good energy resolution. The results reported here are of relevance in view of the development of compact gamma-ray detectors with spectroscopy capabilities, such as an enhanced gamma-ray camera for high power fusion plasmas, where the use of photomultiplier is impeded by space limitation and sensitivity to magnetic fields.
Prompt gamma-ray imaging for small animals
Xu, Libai
Small animal imaging is recognized as a powerful discovery tool for small animal modeling of human diseases, which is providing an important clue to complete understanding of disease mechanisms and is helping researchers develop and test new treatments. The current small animal imaging techniques include positron emission tomography (PET), single photon emission tomography (SPECT), computed tomography (CT), magnetic resonance imaging (MRI), and ultrasound (US). A new imaging modality called prompt gamma-ray imaging (PGI) has been identified and investigated primarily by Monte Carlo simulation. Currently it is suggested for use on small animals. This new technique could greatly enhance and extend the present capabilities of PET and SPECT imaging from ingested radioisotopes to the imaging of selected non-radioactive elements, such as Gd, Cd, Hg, and B, and has the great potential to be used in Neutron Cancer Therapy to monitor neutron distribution and neutron-capture agent distribution. This approach consists of irradiating small animals in the thermal neutron beam of a nuclear reactor to produce prompt gamma rays from the elements in the sample by the radiative capture (n, gamma) reaction. These prompt gamma rays are emitted in energies that are characteristic of each element and they are also produced in characteristic coincident chains. After measuring these prompt gamma rays by surrounding spectrometry array, the distribution of each element of interest in the sample is reconstructed from the mapping of each detected signature gamma ray by either electronic collimations or mechanical collimations. In addition, the transmitted neutrons from the beam can be simultaneously used for very sensitive anatomical imaging, which provides the registration for the elemental distributions obtained from PGI. The primary approach is to use Monte Carlo simulation methods either with the specific purpose code CEARCPG, developed at NC State University or with the general purpose
Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the
Fuzzy correlations of gamma-ray bursts
International Nuclear Information System (INIS)
Hartmann, D.H.; Linder, E.V.; Blumenthal, G.R.
1991-01-01
The origin of gamma-ray bursts is not known, both in the sense of the nature of the source emitting the radiation and literally, the position of the burst on the sky. Lacking unambiguously identified counterparts in any wavelength band studied to date, statistical approaches are required to determine the burster distance scale. Angular correlation analysis is one of the most powerful tools in this regard. However, poor detector resolution gives large localization errors, effectively beam smearing the positions. The resulting fuzzy angular correlation function is investigated and the generic isotropization that smearing induces on any intrinsic clustering is discussed. In particular, the extent to which gamma-ray burst observations by the BATSE detector aboard the Gamma-Ray Observatory might recover an intrinsic source correlation is investigated. 16 refs
Saccharification of gamma-ray and alkali pretreated lignocellulosics
International Nuclear Information System (INIS)
Begum, A.; Choudhury, N.
1988-01-01
Enzymic saccharification of gamma ray and alkali pretreated sawdust, rice straw, and sugar cane bagasse showed higher release of reducing sugar from pretreated substrates. By gamma ray treatment alone (500 kGy) reducing sugar release of 2.8, 9.2, and 10 g/l was obtained from 7.5% (w/v) sawdust, rice straw, and bagasse and the same substrates showed reducing sugar release of 4.2, 30, and 20 g/l respectively when treated with alkali (0.1 g/g). Combination of gamma ray with alkali treatment further increased the reducing sugar release to 10.2, 33, and 36 g/l from sawdust, rice straw, and bagasse respectively. The effects of gamma ray and alkali treatment on saccharification varied with the nature of the substrate
Gamma-ray emission profile measurements during JET ICRH discharges
Energy Technology Data Exchange (ETDEWEB)
Howarth, P.J.A. [Birmingham Univ. (United Kingdom); Adams, J.M.; Bond, D.S.; Watkins, N. [AEA Technology, Harwell (United Kingdom); Jarvis, O.N.; Marcus, F.B.; Sadler, G.; Belle, P. van [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking
1994-12-31
Ion Cyclotron Resonant Heating (ICRH) that is tuned to minority fuel ions can induce an energy diffusion of the heated species and create high energy tail temperatures of {approx} 1 MeV. The most energetic of these accelerated minority ions can undergo nuclear reactions with impurity Be and C that produces {gamma}-ray emission from the decay of the excited product nuclei. This RF-induced {gamma}-ray emission has been recorded using the JET neutron emission profile diagnostic which is capable of distinguishing neutrons and {gamma}-rays. Appropriate data processing has enabled the RF-induced {gamma}-ray emission signals to be isolated from the {gamma}-ray emission signals associated with neutron interactions in the material surrounding the profile monitor. The 2-d {gamma}-ray emission profiles show that virtually all the radiation originates from the low field side of the RF resonance layer, as expected from RF-induced pitch angle diffusion. The emission profiles indicate the presence of a small population of resonant {sup 3}He ions that possess orbits lying near the passing-trapped boundary. (author) 6 refs., 4 figs.
Gamma-ray multiplicity distribution in ternary fission of {sup 252}Cf
Energy Technology Data Exchange (ETDEWEB)
Jandel, M [Department of Nuclear Physics, Slovak Academy of Sciences, Dubravska cesta 9, Bratislava (Slovakia); Kliman, J [Department of Nuclear Physics, Slovak Academy of Sciences, Dubravska cesta 9, Bratislava (Slovakia); Krupa, L [Department of Nuclear Physics, Slovak Academy of Sciences, Dubravska cesta 9, Bratislava (Slovakia); Morhac, M [Department of Nuclear Physics, Slovak Academy of Sciences, Dubravska cesta 9, Bratislava (Slovakia); Hamilton, J H [Department of Physics, Vanderbilt University, Nashville, TN (United States); Kormicki, J [Department of Physics, Vanderbilt University, Nashville, TN (United States); Ramayya, A V [Department of Physics, Vanderbilt University, Nashville, TN (United States); Hwang, J K [Department of Physics, Vanderbilt University, Nashville, TN (United States); Luo, Y X [Department of Physics, Vanderbilt University, Nashville, TN (United States); Fong, D [Department of Physics, Vanderbilt University, Nashville, TN (United States); Gore, P [Department of Physics, Vanderbilt University, Nashville, TN (United States); Akopian, G M Ter; Oganessian, Yu Ts; Rodin, A M; Fomichev, A S; Popeko, G S; Daniel, A V [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna (Russian Federation); Rasmussen, J O; Macchiavelli, A O [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Stoyer, M A [Lawrence Livermore National Laboratory, Livermore, CA (United States); Donangelo, R [Instituto de Fisica, Universidade Federal do Rio de Janeiro, 21945-970 Rio de Janeiro (Brazil); Cole, J D [Idaho National Engineering and Environmental Laboratory, Idaho Falls, ID (United States)
2002-12-01
From multiparameter data obtained at Lawrence Berkeley National Laboratory, the integral characteristics of the prompt {gamma}-ray emission were extracted for tripartition of {sup 252}Cf with He, Be and C being the third light charged particle. We used multifold {gamma}-ray coincidence spectra for the determination of {gamma}-ray multiplicities assuming a Gaussian distribution for {gamma}-ray multiplicity. The multiplicity distribution characteristics, i.e. mean multiplicity and its dispersion were obtained by minimizing with respect to the calculated values of probabilities of multifold {gamma}-ray coincidences using a combinatoric method. Comparison with the known experimental data from binary fission was made. Further, we investigated dependencies of the mean {gamma}-ray multiplicity on the kinetic energy of the light charged particle. The mean {gamma}-ray multiplicity for He ternary fission is found to increase rapidly with increasing kinetic energy of He in the region less than 11 MeV and then decrease slowly with increasing kinetic energy of He. The anomalous behaviour of {gamma}-ray emission is discussed. The mean {gamma}-ray multiplicity was determined for the first time for Be and C ternary fission. For Be, the {gamma}-ray multiplicity as a function of kinetic energy was obtained as well.
Prompt Gamma Ray Spectroscopy for process monitoring
International Nuclear Information System (INIS)
Zoller, W.H.; Holmes, J.L.
1991-01-01
Prompt Gamma Ray Spectroscopy (PGRS) is a very powerful analytical technique able to measure many metallic, contamination problem elements. The technique involves measurement of gamma rays that are emitted by nuclei upon capturing a neutron. This method is sensitive not only to the target element but also to the particular isotope of that element. PGRS is capable of measuring dissolved metal ions in a flowing system. In the field, isotopic neutron sources are used to produce the desired neutron flux ( 252 Cf can produce neutron flux of the order of 10 8 neutrons/cm 2 --sec.). Due to high penetrating power of gamma radiation, high efficiency gamma ray detectors can be placed in an appropriate geometry to maximize sensitivity, providing real-time monitoring with low detection level capabilities
Estulin, I. V.
1977-01-01
The progress made and techniques used by the Soviet-French group in the study of gamma and X ray pulses are described in abstracts of 16 reports. Experiments included calibration and operation of various recording instruments designed for measurements involving these pulses, specifically the location of sources of such pulses in outer space. Space vehicles are utilized in conjunction with ground equipment to accomplish these tests.
Continued Development of a Soft Gamma-Ray Concentrator
Bloser, Peter
We propose to continue our development of a concept for a soft gamma-ray (E > 100 keV) concentrator using thin-film multilayer structures. Alternating layers of low- and high-density materials will channel soft gamma-ray photons via total external reflection. A suitable arrangement of bent structures will then concentrate the incident radiation to a point. Gamma-ray optics made in this way offer the potential for soft gamma-ray telescopes with focal lengths of less than 10 m, removing the need for formation flying spacecraft and opening the field up to balloon-borne instruments. Under previous APRA funding we have been investigating methods for efficiently producing such multilayer structures and modeling their performance. We now propose to pursue magnetron sputtering (MS) techniques to quickly produce structures with the required smoothness and thickness, to measure their channeling efficiency and compare with calculations, and to design a "lens" with optimized bandpass and throughput and predict its scientific performance. If successful, this work will confirm that this innovative optics concept is suitable for a balloon-born soft gamma-ray telescope with unprecedented sensitivity.
Advanced Laser-Compton Gamma-Ray Sources for Nuclear Materials Detection, Assay and Imaging
Barty, C. P. J.
2015-10-01
Highly-collimated, polarized, mono-energetic beams of tunable gamma-rays may be created via the optimized Compton scattering of pulsed lasers off of ultra-bright, relativistic electron beams. Above 2 MeV, the peak brilliance of such sources can exceed that of the world's largest synchrotrons by more than 15 orders of magnitude and can enable for the first time the efficient pursuit of nuclear science and applications with photon beams, i.e. Nuclear Photonics. Potential applications are numerous and include isotope-specific nuclear materials management, element-specific medical radiography and radiology, non-destructive, isotope-specific, material assay and imaging, precision spectroscopy of nuclear resonances and photon-induced fission. This review covers activities at the Lawrence Livermore National Laboratory related to the design and optimization of mono-energetic, laser-Compton gamma-ray systems and introduces isotope-specific nuclear materials detection and assay applications enabled by them.
Development of Monte Carlo decay gamma-ray transport calculation system
Energy Technology Data Exchange (ETDEWEB)
Sato, Satoshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment; Kawasaki, Nobuo [Fujitsu Ltd., Tokyo (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Center for Promotion of Computational Science and Engineering, Tokai, Ibaraki (Japan)
2001-06-01
In the DT fusion reactor, it is critical concern to evaluate the decay gamma-ray biological dose rates after the reactor shutdown exactly. In order to evaluate the decay gamma-ray biological dose rates exactly, three dimensional Monte Carlo decay gamma-ray transport calculation system have been developed by connecting the three dimensional Monte Carlo particle transport calculation code and the induced activity calculation code. The developed calculation system consists of the following four functions. (1) The operational neutron flux distribution is calculated by the three dimensional Monte Carlo particle transport calculation code. (2) The induced activities are calculated by the induced activity calculation code. (3) The decay gamma-ray source distribution is obtained from the induced activities. (4) The decay gamma-rays are generated by using the decay gamma-ray source distribution, and the decay gamma-ray transport calculation is conducted by the three dimensional Monte Carlo particle transport calculation code. In order to reduce the calculation time drastically, a biasing system for the decay gamma-ray source distribution has been developed, and the function is also included in the present system. In this paper, the outline and the detail of the system, and the execution example are reported. The evaluation for the effect of the biasing system is also reported. (author)
Fermi Large Area Telescope Bright Gamma-ray Source List
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /KIPAC, Menlo Park /SLAC; Ajello, M.; /KIPAC, Menlo Park /SLAC; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Band, D.L.; /NASA, Goddard /NASA, Goddard; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Bechtol, K.; /KIPAC, Menlo Park /SLAC; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /KIPAC, Menlo Park /SLAC; Bignami, G.F.; /Pavia U.; Bloom, Elliott D.; /KIPAC, Menlo Park /SLAC; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /KIPAC, Menlo Park /SLAC; Bregeon, J.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /IASF, Milan /IASF, Milan /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /KIPAC, Menlo Park /SLAC /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /KIPAC, Menlo Park /SLAC /ASDC, Frascati /NASA, Goddard /Maryland U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /UC, Santa Cruz /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /Montpellier U. /Bari U. /INFN, Bari /Ecole Polytechnique /NASA, Goddard; /more authors..
2009-05-15
Following its launch in 2008 June, the Fermi Gamma-ray Space Telescope (Fermi) began a sky survey in August. The Large Area Telescope (LAT) on Fermi in three months produced a deeper and better resolved map of the {gamma}-ray sky than any previous space mission. We present here initial results for energies above 100 MeV for the 205 most significant (statistical significance greater than {approx}10{sigma}) {gamma}-ray sources in these data. These are the best characterized and best localized point-like (i.e., spatially unresolved) {gamma}-ray sources in the early mission data.
Large-Area Balloon-Borne Polarized Gamma Ray Observer (PoGO)
Energy Technology Data Exchange (ETDEWEB)
Blanford, R.
2005-04-06
We are developing a new balloon-borne instrument (PoGO), to measure polarization of soft gamma rays (25-200 keV) using asymmetry in azimuth angle distribution of Compton scattering. PoGO will detect 10% polarization in 100mCrab sources in a 6-8 hour observation and bring a new dimension to studies on gamma ray emission/transportation mechanism in pulsars, AGNs, black hole binaries, and neutron star surface. The concept is an adaptation to polarization measurements of well-type phoswich counter technology used in balloon-borne experiments (Welcome-1) and AstroE2 Hard X-ray Detector. PoGO consists of close-packed array of 397 hexagonal well-type phoswich counters. Each unit is composed of a long thin tube (well) of slow plastic scintillator, a solid rod of fast plastic scintillator, and a short BGO at the base. A photomultiplier coupled to the end of the BGO detects light from all 3 scintillators. The rods with decay times < 10 ns, are used as the active elements; while the wells and BGOs, with decay times {approx}250 ns are used as active anti-coincidence. The fast and slow signals are separated out electronically. When gamma rays entering the field-of-view (fwhm {approx} 3deg{sup 2}) strike a fast scintillator, some are Compton scattered. A fraction of the scattered photons are absorbed in another rod (or undergo a second scatter). A valid event requires one clean fast signal of pulse-height compatible with photo-absorption (> 20keV) and one or more compatible with Compton scattering (< 10keV). Studies based on EGS4 (with polarization features) and Geant4 predict excellent background rejection and high sensitivity.
The LASL gamma-ray burst astronomy program
International Nuclear Information System (INIS)
Klebesadel, R.W.; Evans, W.D.; Laros, J.G.
1981-01-01
Gamma-ray burst observations performed by LASL began with the identification and initial report of the phenomenon from data acquired by the Vela satellites. The Vela instruments have recorded responses to 73 gamma-ray bursts over a ten-year interval, and are continuing to contribute toward these observations. Similar instrumentation was included aboard the NRL SOLRAD 11 spacecraft. These performed well but suffered an early demise. Recently, the LASL gamma-ray burst astronomy program has been enhanced through the implementation of experiments aboard the Pioneer Venus Orbiter and ISEF-C spacecraft. Both of these experiments are continuing to contribute data vital to trigonometric directional analyses. (orig.)
International Nuclear Information System (INIS)
Kunwar, B.; Bhadra, A.; Gupta, S.K. Sen
2014-01-01
A preliminary, and perhaps the first, study of astrophysical applications of Delbrück scattering in a gamma-ray emitting celestial object like a gamma-ray burst (GRB) has been made. At energies≥100 MeV the elastic scattering of gamma-ray photons off the molecular dust surrounding the GRB site is dominated by Delbrück scattering. Expressions for Delbrück-scattered gamma-ray flux as a function of time has been obtained for a few selected energies by assuming a simple model of GRB. These are compared with Compton-scattered flux. At certain situations, interestingly, the former is found to exceed the latter for the first few milliseconds of the burst. The issue of detectability of Delbrück-scattered gamma-ray echo from the cloud of a GRB is discussed. Although it is observed that the detection of such an echo is not within the capability of the presently operating gamma-ray missions such as Fermi LAT, a rough estimate shows that one can be optimistic that future generation gamma-ray telescopes might be able to see such photons' contribution to the total flux. - Highlights: ► Astrophysical application of Delbrück scattering in a GRB has been made. ► Initially, the Delbrück scattering may dominate the scattering of GeV γ-rays. ► The issue of detectability of such radiations is discussed
X-ray and gamma ray waveguide, cavity and method
International Nuclear Information System (INIS)
Vali, V.; Krogstad, R.S.; Willard, H.R.
1978-01-01
An x-ray and gamma ray waveguide, cavity, and method for directing electromagnetic radiation of the x-ray, gamma ray, and extreme ultraviolet wavelengths are described. A hollow fiber is used as the waveguide and is manufactured from a material having an index of refraction less than unity for these wavelengths. The internal diameter of the hollow fiber waveguide and the radius of curvature for the waveguide are selectively predetermined in light of the wavelength of the transmitted radiation to minimize losses. The electromagnetic radiation is obtained from any suitable source ad upon introduction into the waveguide is transmitted along a curvilinear path. The waveguide may be formed as a closed loop to create a cavity or may be used to direct the electromagnetic radiation to a utilization site
Proceedings of the workshop on multiple prompt gamma-ray analysis
International Nuclear Information System (INIS)
Ebihara, Mitsuru; Hatsukawa, Yuichi; Oshima, Masumi
2006-10-01
The workshop on 'Multiple Prompt Gamma-ray Analysis' was held on March 8, 2006 at Tokai. It is based on a project, 'Developments of real time, non-destructive ultra sensitive elemental analysis using multiple gamma-ray detections and prompt gamma ray analysis and its application to real samples', one of the High priority Cooperative Research Programs performed by Japan Atomic Energy Agency and the University of Tokyo. In this workshop, the latest results of the Multiple Prompt Gamma ray Analysis (MPGA) study were presented, together with those of Neutron Activation Analysis with Multiple Gamma-ray Detection (NAAMG). The 9 of the presented papers are indexed individually. (J.P.N.)
Recent achievements in the field of gamma-ray bursts
International Nuclear Information System (INIS)
Lu Tan; Dai Zigao
2001-01-01
Recent progresses in the field of gamma-ray bursts is briefly introduced. Gamma-ray bursts are the most energetic explosion since the Big Bang of the universe. Within a few tens of seconds, the energy released in gamma-ray bursts could be several hundred times larger than that released form the sun in its whole life (about 10 billion years). The authors will first briefly discuss the observational facts, based on which the authors will discuss the standard fireball model, the dynamical behavior and evolution of gamma-ray bursts and their afterglows. Then, various observational phenomena that contradict the standard model are given and the importance of these post-standard effects are pointed out. The questions related to the energy source of gamma-ray bursts are still unanswered, and other important questions also remain to be solved
A high energy gamma ray astronomy experiment
International Nuclear Information System (INIS)
Hofstadter, R.
1988-01-01
The author describes work involving NASA's Gamma Ray Observatory (GRO). GRO exemplifies the near zero principle because it investigates new gamma ray phenomena by relying on the space program to take us into the region of zero interference above the earth's atmosphere. In its present form GRO has four experiments
Gamma-ray emission from internal shocks in novae
Martin, P.; Dubus, G.; Jean, P.; Tatischeff, V.; Dosne, C.
2018-04-01
Context. Gamma-ray emission at energies ≥100 MeV has been detected from nine novae using the Fermi Large Area Telescope (LAT), and can be explained by particle acceleration at shocks in these systems. Eight out of these nine objects are classical novae in which interaction of the ejecta with a tenuous circumbinary material is not expected to generate detectable gamma-ray emission. Aim. We examine whether particle acceleration at internal shocks can account for the gamma-ray emission from these novae. The shocks result from the interaction of a fast wind radiatively-driven by nuclear burning on the white dwarf with material ejected in the initial runaway stage of the nova outburst. Methods: We present a one-dimensional model for the dynamics of a forward and reverse shock system in a nova ejecta, and for the associated time-dependent particle acceleration and high-energy gamma-ray emission. Non-thermal proton and electron spectra are calculated by solving a time-dependent transport equation for particle injection, acceleration, losses, and escape from the shock region. The predicted emission is compared to LAT observations of V407 Cyg, V1324 Sco, V959 Mon, V339 Del, V1369 Cen, and V5668 Sgr. Results: The ≥100 MeV gamma-ray emission arises predominantly from particles accelerated up to 100 GeV at the reverse shock and undergoing hadronic interactions in the dense cooling layer downstream of the shock. The emission rises within days after the onset of the wind, quickly reaches a maximum, and its subsequent decrease reflects mostly the time evolution of the wind properties. Comparison to gamma-ray data points to a typical scenario where an ejecta of mass 10-5-10-4 M⊙ expands in a homologous way with a maximum velocity of 1000-2000 km s-1, followed within a day by a wind with a velocity values of which result in the majority of best-fit models having gamma-ray spectra with a high-energy turnover below 10 GeV. Our typical model is able to account for the main
Modelling gamma-ray light curves of phase-aligned millisecond pulsars
Chang, Shan; Zhang, Li; Li, Xiang; Jiang, Zejun
2018-04-01
Three gamma-ray millisecond pulsars (MSPs), PSR J1939+2134, PSR J1959+2048, and PSR J0034-0534, have been confirmed to have a common feature of phase-aligned in radio and gamma-ray bands. With a geometric (two-pole caustic) model and a physical outer gap model (revised 3D outer gap model) in a three dimensional (3D) retarded magnetic dipole with a perturbation magnetic field, the observed features of these MSPs are studied. In order to obtained the best-fitting model parameters, the Markov chain Monte Carlo technique is used and reasonable GeV band light curves for three MSPs are given. Our calculations indicate that MSPs emit high energy photons with smaller inclination angles (α ≈ 10°-50°), larger view angles (ζ ≈ 65°-100°), and smaller perturbation factor (ɛ ≈ -0.15-0.1). Note that the factor ɛ, describing the strength of the perturbed magnetic field, is all less than zero in these two models, so the magnetic field caused by current-induced play a leading role in the pulsed location of MSPs.
Using Gamma Rays to Improve Nutritional Value of Legumes
International Nuclear Information System (INIS)
Sajet, A.S.
2009-01-01
World is suffering from food shortages and rising prices of animal food, in particular. Therefore, attention turned to fill the shortfall by increasing the production and consumption of pulses. Beans are the most important types of legumes consumed in the countries of the Middle East. But there are some factors that reduce the expansion in the consumption of beans and some factors discourage feeding the trypsin inhibitor,phytic acid, causes of gases and allergens in some people, which negatively affect the bioavailability to absorb the vital minerals and proteins in addition to the length of time needed for cooking beans. There have been attempts to use gamma rays to improve strength and Leakage and cooking recipes for legumes, and reached results in other studies to reduce the efficiency of trypsin inhibitor in beans treated at a dose of 10 kGy as well as achieving the highest percentage reduction in phytic acid content of the same seed above. Also it was found that gamma rays affect negatively on the causes of gases in the beans, radiation works to break down some of the Oligosaccharides and turn it into simple sugars, as well as to break down some of the compounds which are responsible of disease in beans.
Probing Intrinsic Properties of Short Gamma-Ray Bursts with Gravitational Waves.
Fan, Xilong; Messenger, Christopher; Heng, Ik Siong
2017-11-03
Progenitors of short gamma-ray bursts are thought to be neutron stars coalescing with their companion black hole or neutron star, which are one of the main gravitational wave sources. We have devised a Bayesian framework for combining gamma-ray burst and gravitational wave information that allows us to probe short gamma-ray burst luminosities. We show that combined short gamma-ray burst and gravitational wave observations not only improve progenitor distance and inclination angle estimates, they also allow the isotropic luminosities of short gamma-ray bursts to be determined without the need for host galaxy or light-curve information. We characterize our approach by simulating 1000 joint short gamma-ray burst and gravitational wave detections by Advanced LIGO and Advanced Virgo. We show that ∼90% of the simulations have uncertainties on short gamma-ray burst isotropic luminosity estimates that are within a factor of two of the ideal scenario, where the distance is known exactly. Therefore, isotropic luminosities can be confidently determined for short gamma-ray bursts observed jointly with gravitational waves detected by Advanced LIGO and Advanced Virgo. Planned enhancements to Advanced LIGO will extend its range and likely produce several joint detections of short gamma-ray bursts and gravitational waves. Third-generation gravitational wave detectors will allow for isotropic luminosity estimates for the majority of the short gamma-ray burst population within a redshift of z∼1.
International Nuclear Information System (INIS)
Anderhub, H.; Biland, A.; Antonelli, L. A.; Antoranz, P.; Balestra, S.; Barrio, J. A.; Bose, D.; Backes, M.; Becker, J. K.; Baixeras, C.; Bastieri, D.; Bock, R. K.; Gonzalez, J. Becerra; Bednarek, W.; Berger, K.; Bernardini, E.; Bonnoli, G.; Bordas, P.; Bosch-Ramon, V.; Tridon, D. Borla
2010-01-01
The MAGIC collaboration has searched for high-energy gamma-ray emission of some of the most promising pulsar candidates above an energy threshold of 50 GeV, an energy not reachable up to now by other ground-based instruments. Neither pulsed nor steady gamma-ray emission has been observed at energies of 100 GeV from the classical radio pulsars PSR J0205+6449 and PSR J2229+6114 (and their nebulae 3C58 and Boomerang, respectively) and the millisecond pulsar PSR J0218+4232. Here, we present the flux upper limits for these sources and discuss their implications in the context of current model predictions.
Wijers, Ralph A M J; Woosley, Stan
2012-01-01
Cosmic gamma ray bursts (GRBs) have fascinated scientists and the public alike since their discovery in the late 1960s. Their story is told here by some of the scientists who participated in their discovery and, after many decades of false starts, solved the problem of their origin. Fourteen chapters by active researchers in the field present a detailed history of the discovery, a comprehensive theoretical description of GRB central engine and emission models, a discussion of GRB host galaxies and a guide to how GRBs can be used as cosmological tools. Observations are grouped into three sets from the satellites CGRO, BeppoSAX and Swift, and followed by a discussion of multi-wavelength observations. This is the first edited volume on GRB astrophysics that presents a fully comprehensive review of the subject. Utilizing the latest research, Gamma-ray Bursts is an essential desktop companion for graduate students and researchers in astrophysics.
The First Fermi-LAT Gamma-Ray Burst Catalog
Ackermann, M.; et al., [Unknown; van der Horst, A.J.
2013-01-01
In three years of observations since the beginning of nominal science operations in 2008 August, the Large Area Telescope (LAT) on board the Fermi Gamma-Ray Space Telescope has observed high-energy (gsim 20 MeV) γ-ray emission from 35 gamma-ray bursts (GRBs). Among these, 28 GRBs have been detected
Energy Technology Data Exchange (ETDEWEB)
Zhou Hongyu; Yan Yiming; Tang lin; Wen Chenlin; Zhang Shenji; Hua Ming; Han Chongzhan; Ding Xiaoji; Lan Liqiao; Fan Guoying; Yan Hua; Wang Xingfu; Wang Qi; Sun Suxu; Rong Yaning; Liu Shuzhen (Institute of Low Energy Nuclear Physics, Beijing Normal University, Beijing (CN))
1989-05-01
The cross sections of discrete gamma-ray produced by interactions of 14.9 MeV neutrons with carbon and niobium were investigated. A pulsed {ital T}({ital d},{ital n}){sup 4} He neutron source was used in the measurement. Neutron flux incident upon the sample was determined with the associated particle method. Technique of time-of-flight was used for reducing the background. A new method to calculate neutron flux attenuation in large cylindrical sample was proposed. The split of 4.439 MeV gamma-ray line from {sup 12}C({ital n},{ital n}{prime}{gamma}){sup 12}C reactions was confirmed. 79 discrete gamma-ray lines and their production cross sections for the interactions of 14.9 MeV neutrons with niobium were obtained for the first time.
Simulation Study on Identifiability of UHE Gamma-ray Air Showers
International Nuclear Information System (INIS)
Wada, Y.; Inoue, N.; Miyazawa, K.; Vankov, H.P.
2008-01-01
The chemical composition of Ultra-High-Energy (UHE) comic rays is one of unsolved mysteries, and its study will give us fruitful information on the origin and acceleration mechanism of UHE cosmic rays. Especially, a detection of UHE gamma-rays by hybrid experiments, such as AUGER and TA, will be a key to solve these questions. The characteristics of UHE gamma-ray showers have been studied by comparing the lateral and longitudinal structures of shower particles calculated with AIRES and our own simulation code, so far. There are apparent differences in a slope of lateral distribution (η) and a depth of shower maximum (Xmax) between gamma-ray and proton induced showers because UHE gamma-ray showers are affected by the LPM effect and the geomagnetic cascading process in an energy region of >10 19.5 eV. Different features between gamma-ray and proton showers are pointed out from the simulation study and an identifiability of gamma-ray showers from proton ones is also discussed by the method of Neural-Network-Analysis
Simulation Study on Identifiability of UHE Gamma-ray Air Showers
Energy Technology Data Exchange (ETDEWEB)
Wada, Y.; Inoue, N.; Miyazawa, K. [Graduate School of Science and Engineering, Saitama University, Saitama 338-8570 (Japan); Vankov, H.P. [Institute for Nuclear Research and Nuclear Energy, Bulgaria Academy, Sofia (Bulgaria)
2008-01-15
The chemical composition of Ultra-High-Energy (UHE) comic rays is one of unsolved mysteries, and its study will give us fruitful information on the origin and acceleration mechanism of UHE cosmic rays. Especially, a detection of UHE gamma-rays by hybrid experiments, such as AUGER and TA, will be a key to solve these questions. The characteristics of UHE gamma-ray showers have been studied by comparing the lateral and longitudinal structures of shower particles calculated with AIRES and our own simulation code, so far. There are apparent differences in a slope of lateral distribution ({eta}) and a depth of shower maximum (Xmax) between gamma-ray and proton induced showers because UHE gamma-ray showers are affected by the LPM effect and the geomagnetic cascading process in an energy region of >10{sup 19.5}eV. Different features between gamma-ray and proton showers are pointed out from the simulation study and an identifiability of gamma-ray showers from proton ones is also discussed by the method of Neural-Network-Analysis.
Cosmic very high-energy {gamma}-rays
Energy Technology Data Exchange (ETDEWEB)
Plaga, R. [Max-Planck-Institut fur Physik, Muenchen (Germany)
1998-12-31
The article gives a brief overview, aimed at nonspecialists, about the goals and selected recent results of the detection of very-high energy {gamma}-rays (energies above 100 GeV) with ground based detectors. The stress is on the physics questions, specially the origin of Galactic Cosmic Rays and the emission of TeV {gamma}-radiation from active galaxies. Moreover some particle-physics questions which are addressed in this area are discussed.
Studying the shielding properties of lead glass composites using neutrons and gamma rays
International Nuclear Information System (INIS)
Osman, A.M.; El-Sarraf, M.A.; Abdel-Monem, A.M.; El-Sayed Abdo, A.
2015-01-01
Highlights: • Samples of sodalime silica glass loaded with different ratios of PbO were prepared. • Leaded glass composites were investigated for radiation shielding. • Experimental and theoretical attenuation parameters were studied. • Experimental and theoretical (MCNP5) results were in good agreement. - Abstract: The present work deals with the shielding properties of lead glass composites to find out its integrity for practical shielding applications and radiological safety. Composites of different lead oxide ratios (x = 0, 5, 10, 15 and 25 wt.%) have been prepared by the Nasser Glass and Crystal Company (Egypt). Attenuation measurements have been carried out using a collimated emitted beam from a fission 252 Cf (100 μg) neutron source, and the neutron–gamma spectrometer with stilbene scintillator. The pulse shape discriminating (P.S.D.) technique based on the zero cross-over method was used to discriminate between neutron and gamma-ray pulses. Thermal neutron fluxes were measured using the BF3 detector and thermal neutron detection system. The attenuation relations were used to evaluate fast neutron macroscopic effective removal cross-section Σ R-Meas (cm −1 ), gamma rays total attenuation coefficient μ (cm −1 ) and thermal neutron macroscopic cross-section Σ Meas (cm −1 ). Theoretical calculations have been achieved using MCNP5 code to calculate the same two parameters. Also, MERCSF-N program was used to calculate fast neutron macroscopic removal cross-section Σ R-MER (cm −1 ). Measured and MCNP5 calculated results have been compared and were found to be in reasonable agreement
Gamma-ray production cross sections for MeV neutrons
International Nuclear Information System (INIS)
Kitazawa, Hideo; Harima, Yoshiko; Yamakoshi, Hisao; Sano, Yuji; Kobayashi, Tsuguyuki.
1979-01-01
Gamma-ray production cross section and spectra for 1- to 20-MeV neutrons were theoretically obtained, which were requested for heating calculations, for shielding design calculations, and for material damage estimates. Calculations were carried out for Al, Si, Ca, Fe, Ni, Cu, Nb, Ta, Au, and Pb, using a spin-dependent evaporation model without the parity conservation and including the dipole and quardupole gamma-ray transitions. The results were compared with the experimental data measured in ORNL to confirm the availability of this model in applications. In addition, the effects on the gamma-ray production cross section of the optical potential, level density, yrast level, and radiation width were investigated in detail. The conclusions are: 1) the use of the optical potential which gives the correct total reaction cross section is essential to gamma-ray production calculations, 2) the gamma-ray production cross section is not so sensitive to the choice of level density parameters, 3) the inclusion of yrast levels is necessary in dealing with the competition of the neutron and gamma-ray emissions from highly excited states, and 4) the Brink-Axel type's radiation width is unsuitable to be applied to radiative capture processes. (author)
International Nuclear Information System (INIS)
Yildiz, Nihat; Akkoyun, Serkan
2013-01-01
Highlights: ► Detector responses in neutron–gamma discrimination were estimated by neural networks. ► Novel consistent neural network empirical physical formulas (EPFs) were constructed for detector responses. ► The EPFs are of explicit mathematical functional form. ► The EPFs can be used to derive various physical functions relevant to neutron–gamma discrimination in gamma ray tracking. -- Abstract: Gamma ray tracking is an efficient detection technique in studying exotic nuclei which lies far from beta stability line. To achieve very powerful and extraordinary resolution ability, new detectors based on gamma ray tracking are currently being developed. To reach this achievement, the neutron–gamma discrimination in these detectors is also an important task. In this paper, by suitable layered feedforward neural networks (LFNNs), we have constructed novel and consistent empirical physical formulas (EPFs) for some highly nonlinear detector counts measured in neutron–gamma discrimination. The detector counts data used in the discrimination was actually borrowed from our previous paper. The counts used here had been originally measured versus the following parameters: energy deposited in the first interaction points, difference in the incoming direction of initial gamma rays, and finally figure of merit values of the clusters determined by tracking. The LFNN–EPFs are of explicit mathematical functional form. Therefore, by various suitable operations of mathematical analysis, these LFNN–EPFs can be used to derivate further physical functions which might be potentially relevant to neutron–gamma discrimination performance of gamma ray tracking.
Simulating Gamma-Ray Emission in Star-forming Galaxies
Energy Technology Data Exchange (ETDEWEB)
Pfrommer, Christoph [Leibniz-Institut für Astrophysik Potsdam (AIP), An der Sternwarte 16, D-14482 Potsdam (Germany); Pakmor, Rüdiger; Simpson, Christine M.; Springel, Volker, E-mail: cpfrommer@aip.de [Heidelberg Institute for Theoretical Studies, Schloss-Wolfsbrunnenweg 35, D-69118 Heidelberg (Germany)
2017-10-01
Star-forming galaxies emit GeV and TeV gamma-rays that are thought to originate from hadronic interactions of cosmic-ray (CR) nuclei with the interstellar medium. To understand the emission, we have used the moving-mesh code Arepo to perform magnetohydrodynamical galaxy formation simulations with self-consistent CR physics. Our galaxy models exhibit a first burst of star formation that injects CRs at supernovae. Once CRs have sufficiently accumulated in our Milky Way–like galaxy, their buoyancy force overcomes the magnetic tension of the toroidal disk field. As field lines open up, they enable anisotropically diffusing CRs to escape into the halo and to accelerate a bubble-like, CR-dominated outflow. However, these bubbles are invisible in our simulated gamma-ray maps of hadronic pion-decay and secondary inverse-Compton emission because of low gas density in the outflows. By adopting a phenomenological relation between star formation rate (SFR) and far-infrared emission and assuming that gamma-rays mainly originate from decaying pions, our simulated galaxies can reproduce the observed tight relation between far-infrared and gamma-ray emission, independent of whether we account for anisotropic CR diffusion. This demonstrates that uncertainties in modeling active CR transport processes only play a minor role in predicting gamma-ray emission from galaxies. We find that in starbursts, most of the CR energy is “calorimetrically” lost to hadronic interactions. In contrast, the gamma-ray emission deviates from this calorimetric property at low SFRs due to adiabatic losses, which cannot be identified in traditional one-zone models.
Simulating Gamma-Ray Emission in Star-forming Galaxies
Pfrommer, Christoph; Pakmor, Rüdiger; Simpson, Christine M.; Springel, Volker
2017-10-01
Star-forming galaxies emit GeV and TeV gamma-rays that are thought to originate from hadronic interactions of cosmic-ray (CR) nuclei with the interstellar medium. To understand the emission, we have used the moving-mesh code Arepo to perform magnetohydrodynamical galaxy formation simulations with self-consistent CR physics. Our galaxy models exhibit a first burst of star formation that injects CRs at supernovae. Once CRs have sufficiently accumulated in our Milky Way-like galaxy, their buoyancy force overcomes the magnetic tension of the toroidal disk field. As field lines open up, they enable anisotropically diffusing CRs to escape into the halo and to accelerate a bubble-like, CR-dominated outflow. However, these bubbles are invisible in our simulated gamma-ray maps of hadronic pion-decay and secondary inverse-Compton emission because of low gas density in the outflows. By adopting a phenomenological relation between star formation rate (SFR) and far-infrared emission and assuming that gamma-rays mainly originate from decaying pions, our simulated galaxies can reproduce the observed tight relation between far-infrared and gamma-ray emission, independent of whether we account for anisotropic CR diffusion. This demonstrates that uncertainties in modeling active CR transport processes only play a minor role in predicting gamma-ray emission from galaxies. We find that in starbursts, most of the CR energy is “calorimetrically” lost to hadronic interactions. In contrast, the gamma-ray emission deviates from this calorimetric property at low SFRs due to adiabatic losses, which cannot be identified in traditional one-zone models.
Swift pointing and gravitational-wave bursts from gamma-ray burst events
International Nuclear Information System (INIS)
Sutton, Patrick J; Finn, Lee Samuel; Krishnan, Badri
2003-01-01
The currently accepted model for gamma-ray burst phenomena involves the violent formation of a rapidly rotating solar-mass black hole. Gravitational waves should be associated with the black-hole formation, and their detection would permit this model to be tested. Even upper limits on the gravitational-wave strength associated with gamma-ray bursts could constrain the gamma-ray burst model. This requires joint observations of gamma-ray burst events with gravitational and gamma-ray detectors. Here we examine how the quality of an upper limit on the gravitational-wave strength associated with gamma-ray bursts depends on the relative orientation of the gamma-ray-burst and gravitational-wave detectors, and apply our results to the particular case of the Swift Burst-Alert Telescope (BAT) and the LIGO gravitational-wave detectors. A result of this investigation is a science-based 'figure of merit' that can be used, together with other mission constraints, to optimize the pointing of the Swift telescope for the detection of gravitational waves associated with gamma-ray bursts
Cosmic Connections:. from Cosmic Rays to Gamma Rays, Cosmic Backgrounds and Magnetic Fields
Kusenko, Alexander
2013-12-01
Combined data from gamma-ray telescopes and cosmic-ray detectors have produced some new surprising insights regarding intergalactic and galactic magnetic fields, as well as extragalactic background light. We review some recent advances, including a theory explaining the hard spectra of distant blazars and the measurements of intergalactic magnetic fields based on the spectra of distant sources. Furthermore, we discuss the possible contribution of transient galactic sources, such as past gamma-ray bursts and hypernova explosions in the Milky Way, to the observed ux of ultrahigh-energy cosmicrays nuclei. The need for a holistic treatment of gamma rays, cosmic rays, and magnetic fields serves as a unifying theme for these seemingly unrelated phenomena.
Intercomparison of gamma ray analysis software packages
International Nuclear Information System (INIS)
1998-04-01
The IAEA undertook an intercomparison exercise to review available software for gamma ray spectra analysis. This document describes the methods used in the intercomparison exercise, characterizes the software packages reviewed and presents the results obtained. Only direct results are given without any recommendation for a particular software or method for gamma ray spectra analysis
Mutagenic effectiveness and efficiency of EMS, DES and gamma-rays in rice
International Nuclear Information System (INIS)
Kaul, M.L.H.; Bhan, A.K.
1977-01-01
Data on chlorophyll mutation frequency after treatment with EMS, DES and gamma-rays and sequential administration of gamma-rays and the two alkylating agents in three varieties of rice have been used to work out quantitatively the effectiveness and efficiency of each mutagen and combination treatment. For effectiveness, the order is EMS > DES and for efficiency it is EMS > DES > gamma-rays. In some sequential treatments (Gamma-rays + DES in 'IR8' and 'Basmati'; DES + gamma-rays in 'IR8' and 'Jhona'; Gamma-rays + EMS in 'IR8' and 'Basmati'; and EMS + gamma-rays in 'IR8', 'Jhona' and 'Basmati') mutation frequency is more than additive (synergistic) but these treatments are decisively less efficient because of their relatively high injurious effects in the M 1 generation. EMS induces more albinas than gamma-rays do. The mutational spectrum patterns induced by gamma-rays and DES are alike. In general, combination treatments tend to increase the frequency of albinas over other types of chlorophyll mutants. (orig.) [de
Plutonium isotopic measurements by gamma-ray spectroscopy
International Nuclear Information System (INIS)
Haas, F.X.; Lemming, J.F.
1976-01-01
A nondestructive technique is described for calculating plutonium-238, plutonium-240, plutonium-241 and americium-241 relative to plutonium-239 from measured peak areas in the high resolution gamma-ray spectra of solid plutonium samples. Gamma-ray attenuation effects were minimized by selecting sets of neighboring peaks in the spectrum whose components are due to the different isotopes. Since the detector efficiencies are approximately the same for adjacent peaks, the accuracy of the isotopic ratios is dependent on the half-lives, branching intensities, and measured peak areas. The data presented describe the results obtained by analyzing gamma-ray spectra in the energy region from 120 to 700 keV. Most of the data analyzed were obtained from plutonium material containing 6 percent plutonium-240. Sample weights varied from 0.25 g to approximately 1.2 kg. The methods were also applied to plutonium samples containing up to 23 percent plutonium-240 with weights of 0.25 to 200 g. Results obtained by gamma-ray spectroscopy are compared to chemical analyses of aliquots taken from the bulk samples
Energy spectrum of extragalactic gamma-ray sources
Protheroe, R. J.
1985-01-01
The result of Monte Carlo electron photon cascade calculations for propagation of gamma rays through regions of extragalactic space containing no magnetic field are given. These calculations then provide upper limits to the expected flux from extragalactic sources. Since gamma rays in the 10 to the 14th power eV to 10 to the 17th power eV energy range are of interest, interactions of electrons and photons with the 3 K microwave background radiation are considered. To obtain an upper limit to the expected gamma ray flux from sources, the intergalactic field is assumed to be so low that it can be ignored. Interactions with photons of the near-infrared background radiation are not considered here although these will have important implications for gamma rays below 10 to the 14th power eV if the near infrared background radiation is universal. Interaction lengths of electrons and photons in the microwave background radiation at a temperature of 2.96 K were calculated and are given.
International Nuclear Information System (INIS)
Shani, G.; Cojocaru, M.
1977-01-01
A method for measurement of low level alpha particles in high level gamma background is investigated. Because of its pulse-shape-discrimination properties and being a solid scintillator, trans-stilbene seems to be the proper scintillator, for this purpose. The investigation was done by measuring the effect of different gamma background level (from very low to very high) on constant alpha count rate. Two different pulse-shape-discrimination systems were used and compared. The Ortec system measures the pulse fall time and supplies a corresponding pulse height and the Elscint system checks whether the pulse is what is expected to be the gamma pulse, or is a longer pulse. Both systems yielded good results and were found to be adequate for alpha-gamma separation with trans-stilbene. (Auth.)
Self-powered neutron and gamma-ray flux detector
International Nuclear Information System (INIS)
Allan, C.J.; Shields, R.B.; Lynch, G.F.; Cuttler, J.M.
1980-01-01
A new type of self-powered neutron detector was developed which is sensitive to both the neutron and gamma-ray fluxes. The emitter comprises two parts. The central emitter core is made of materials that generate high-energy electrons on exposure to neutrons. The outer layer acts as a gamma-ray/electron converter, and since it has a higher atomic number and higher back-scattering coefficient than the collector, increases the net outflow or emmission of electrons. The collector, which is around the emitter outer layer, is insulated from the outer layer electrically with dielectric insulation formed from compressed metal-oxide powder. The fraction of electrons given off by the emitter that is reflected back by the collector is less than the fraction of electrons emitted by the collector that is reflected back by the emitter. The thickness of the outer layer needed to achieve this result is very small. A detector of this design responds to external reactor gamma-rays as well as to neutron capture gamma-rays from the collector. The emitter core is either nickel, iron or titanium, or alloys based on these metals. The outer layer is made of platinum, tantalum, osmium, molybdenum or cerium. The detector is particularly useful for monitoring neutron and gamma ray flux intensities in nuclear reactor cores in which the neutron and gamma ray flux intensities are closely proportional, are unltimately related to the fission rate, and are used as measurements of nuclear reactor power. (DN)
Search for a Signature of Interaction between Relativistic Jet and Progenitor in Gamma-Ray Bursts
Yoshida, Kazuki; Yoneoku, Daisuke; Sawano, Tatsuya; Ito, Hirotaka; Matsumoto, Jin; Nagataki, Shigehiro
2017-11-01
The time variability of prompt emission in gamma-ray bursts (GRBs) is expected to originate from the temporal behavior of the central engine activity and the jet propagation in the massive stellar envelope. Using a pulse search algorithm for bright GRBs, we investigate the time variability of gamma-ray light curves to search a signature of the interaction between the jet and the inner structure of the progenitor. Since this signature might appear in the earlier phase of prompt emission, we divide the light curves into the initial phase and the late phase by referring to the trigger time and the burst duration of each GRB. We also adopt this algorithm for GRBs associated with supernovae/hypernovae that certainly are accompanied by massive stars. However, there is no difference between each pulse interval distribution described by a lognorma distribution in the two phases. We confirm that this result can be explained by the photospheric emission model if the energy injection of the central engine is not steady or completely periodic but episodic and described by the lognormal distribution with a mean of ˜1 s.
Search for a Signature of Interaction between Relativistic Jet and Progenitor in Gamma-Ray Bursts
Energy Technology Data Exchange (ETDEWEB)
Yoshida, Kazuki; Yoneoku, Daisuke; Sawano, Tatsuya [College of Science and Engineering, School of Mathematics and Physics, Kanazawa University, Kakuma, Kanazawa, Ishikawa 920-1192 (Japan); Ito, Hirotaka; Matsumoto, Jin; Nagataki, Shigehiro, E-mail: yoshida@astro.s.kanazawa-u.ac.jp, E-mail: yonetoku@astro.s.kanazawa-u.ac.jp [Astrophysical Big Ban Laboratory, RIKEN, Saitama 351-0198 (Japan)
2017-11-01
The time variability of prompt emission in gamma-ray bursts (GRBs) is expected to originate from the temporal behavior of the central engine activity and the jet propagation in the massive stellar envelope. Using a pulse search algorithm for bright GRBs, we investigate the time variability of gamma-ray light curves to search a signature of the interaction between the jet and the inner structure of the progenitor. Since this signature might appear in the earlier phase of prompt emission, we divide the light curves into the initial phase and the late phase by referring to the trigger time and the burst duration of each GRB. We also adopt this algorithm for GRBs associated with supernovae/hypernovae that certainly are accompanied by massive stars. However, there is no difference between each pulse interval distribution described by a lognorma distribution in the two phases. We confirm that this result can be explained by the photospheric emission model if the energy injection of the central engine is not steady or completely periodic but episodic and described by the lognormal distribution with a mean of ∼1 s.
High energy gamma-ray production in nuclear reactions
International Nuclear Information System (INIS)
Pinston, J.A.; Nifenecker, H.; Nifenecker, H.
1989-01-01
Experimental techniques used to study high energy gamma-ray production in nuclear reactions are reviewed. High energy photon production in nucleus-nucleus collisions is discussed. Semi-classical descriptions of the nucleus-nucleus gamma reactions are introduced. Nucleon-nucleon gamma cross sections are considered, including theoretical aspects and experimental data. High energy gamma ray production in proton-nucleus reactions is explained. Theoretical explanations of photon emission in nucleus-nucleus collisions are treated. The contribution of charged pion currents to photon production is mentioned
Laser Compton Scattering Gamma Ray Induced Photo-Trasmutation
Li, Dazhi
2004-01-01
High brightness beams of gamma rays produced with laser Compton scattering have the potential to realize photo-transmutation through (γ,n) reaction, implying an efficient method to dispose long-lived fission products. Preliminary investigations have been carried out in understanding the feasibility of development of a transmutation facility to repose nuclear waste. A laser Compton scattering experimental setup based on a storage ring started to generate gamma-ray beams for studying the coupling of gamma photons and nuclear giant resonance. This paper demonstrates the dependency of nuclear transmutation efficiency on target dimensions and gamma ray features. 197Au sample was adopted in our experiment, and experimental results correspond to the theoretical estimations.
Studies of weak capture-gamma-ray resonances via coincidence techniques
Rowland, C; Champagne, A E; Dummer, A K; Fitzgerald, R; Harley, E C T; Mosher, J; Runkle, R
2002-01-01
A method for measuring weak capture-gamma-ray resonances via gamma gamma-coincidence counting techniques is described. The coincidence apparatus consisted of a large-volume germanium detector and an annular NaI(Tl) crystal. The setup was tested by measuring the weak E sub R =227 keV resonance in sup 2 sup 6 Mg(p,gamma) sup 2 sup 7 Al. Absolute germanium and NaI(Tl) counting efficiencies for a range of gamma-ray energies and for different detector-target geometries are presented. Studies of the gamma-ray background in our spectra are described. Compared to previous work, our method improves the detection sensitivity for weak capture-gamma-ray resonances by a factor of approx 100. The usefulness of the present technique for investigations of interest to nuclear astrophysics is discussed.
Gamma-ray bursts from black hole accretion disks
International Nuclear Information System (INIS)
Strong, I.B.
1975-01-01
The suggestion was first made more than a year ago that gamma-ray bursts might originate in the neighborhood of black holes, based on some rather circumstantial evidence linking Cygnus X-1, the prime black-hole candidate, with two of the then-known gamma-ray bursts. Since then additional evidence makes the idea still more plausible. The evidence is summarized briefly, a physical model for production of gamma-ray bursts is given, and several of the more interesting consequences of such an origin are pointed out. (orig.) [de
Synchronization of x-ray pulses to the pump laser in an ultrafast x-ray facility
International Nuclear Information System (INIS)
Corlett, J.N.; Barry, W.; Byrd, J.M.; Schoenlein, R.; Zholents, A.
2002-01-01
Accurate timing of ultrafast x-ray probe pulses emitted from a synchrotron radiation source with respect to a pump laser exciting processes in the sample under study is critical for the investigation of structural dynamics in the femtosecond regime. We describe a scheme for synchronizing femtosecond x-ray pulses relative to a pump laser. X-ray pulses of <100 fs duration are generated from a proposed source based on a recirculating superconducting linac [1,2,3]. Short x-ray pulses are obtained by a process of electron pulse compression, followed by transverse temporal correlation of the electrons, and ultimately x-ray pulse compression. Timing of the arrival of the x-ray pulse with respect to the pump laser is found to be dominated by the operation of the deflecting cavities which provide the transverse temporal correlation of the electrons. The deflecting cavities are driven from a highly stable RF signal derived from a modelocked laser oscillator which is also the origin of the pump l aser pulses
Computational techniques in gamma-ray skyshine analysis
International Nuclear Information System (INIS)
George, D.L.
1988-12-01
Two computer codes were developed to analyze gamma-ray skyshine, the scattering of gamma photons by air molecules. A review of previous gamma-ray skyshine studies discusses several Monte Carlo codes, programs using a single-scatter model, and the MicroSkyshine program for microcomputers. A benchmark gamma-ray skyshine experiment performed at Kansas State University is also described. A single-scatter numerical model was presented which traces photons from the source to their first scatter, then applies a buildup factor along a direct path from the scattering point to a detector. The FORTRAN code SKY, developed with this model before the present study, was modified to use Gauss quadrature, recent photon attenuation data and a more accurate buildup approximation. The resulting code, SILOGP, computes response from a point photon source on the axis of a silo, with and without concrete shielding over the opening. Another program, WALLGP, was developed using the same model to compute response from a point gamma source behind a perfectly absorbing wall, with and without shielding overhead. 29 refs., 48 figs., 13 tabs
Magic gamma rays, extra-atmospheric source
International Nuclear Information System (INIS)
Bolufer, P.
2010-01-01
Without the atmospheric layer, the cosmos radiation would kill every living, our planet would be like the moon. The cosmic gamma ray to collide with gases in land cover, as it is disintegrated. They are harmless, they form a cone of light that points to the cosmic source comes from. On April 25, 2009 was born on the island of Palma Magic II and Magic I the best observer of atmospheric gamma rays of low intensity. (Author)
Gamma ray energy loss spectra simulation in NaI detectors with the Monte Carlo method
International Nuclear Information System (INIS)
Vieira, W.J.
1982-01-01
With the aim of studying and applying the Monte Carlo method, a computer code was developed to calculate the pulse height spectra and detector efficiencies for gamma rays incident on NaI (Tl) crystals. The basic detector processes in NaI (Tl) detectors are given together with an outline of Monte Carlo methods and a general review of relevant published works. A detailed description of the application of Monte Carlo methods to ν-ray detection in NaI (Tl) detectors is given. Comparisons are made with published, calculated and experimental, data. (Author) [pt
The measurement of gamma ray induced heating in a mixed neutron and gamma ray environment
International Nuclear Information System (INIS)
Chiu, H.K.
1991-10-01
The problem of measuring the gamma heating in a mixed DT neutron and gamma ray environment was explored. A new detector technique was developed to make this measurement. Gamma heating measurements were made in a low-Z assembly irradiated with 14-Mev neutrons and (n, n') gammas produced by a Texas Nuclear Model 9400 neutron generator. Heating measurements were made in the mid-line of the lattice using a proportional counter operating in the Continuously-varied Bias-voltage Acquisition mode. The neutron-induced signal was separated from the gamma-induced signal by exploiting the signal rise-time differences inherent to radiations of different linear energy transfer coefficient, which are observable in a proportional counter. The operating limits of this measurement technique were explored by varying the counter position in the low-Z lattice, hence changing the irradiation spectrum observed. The experiment was modelled numerically to help interpret the measured results. The transport of neutrons and gamma rays in the assembly was modelled using the one- dimensional radiation transport code ANISN/PC. The cross-section set used for these calculations was derived from the ENDF/B-V library using the code MC 2 -2 for the case of DT neutrons slowing down in a low-Z material. The calculated neutron and gamma spectra in the slab and the relevant mass-stopping powers were used to construct weighting factors which relate the energy deposition in the counter fill-gas to that in the counter wall and in the surrounding material. The gamma energy deposition at various positions in the lattice is estimated by applying these weighting factors to the measured gamma energy deposition in the counter at those locations
AGIS: A Next-generation TeV Gamma-ray Observatory
Vandenbroucke, Justin
2010-05-01
The Advanced Gamma-ray Imaging System (AGIS) is a next-generation array of imaging atmospheric Cherenkov telescopes for gamma-ray astronomy in the 100 GeV to 100 TeV band. TeV astronomy has flourished in the last few years. Together with the extremely successful first year of the Fermi LAT telescope for GeV gamma-ray astronomy, we are now in a golden age of gamma-ray astronomy. AGIS seeks to continue the success of gamma-ray astronomy by discovering hundreds of new TeV sources and improving our understanding of known sources, as well as searching for signals from dark matter annihilation. AGIS will feature 36 Schwarzschild-Couder (SC) telescopes spanning 1 km2. The two-mirror SC design allows a wide field of view (8 deg diameter) and high-resolution (0.05 deg diameter) pixellation. I will present the science capabilities of the AGIS observatory as well as the technical design and current status of the project.
Plasma driven neutron/gamma generator
Leung, Ka-Ngo; Antolak, Arlyn
2015-03-03
An apparatus for the generation of neutron/gamma rays is described including a chamber which defines an ion source, said apparatus including an RF antenna positioned outside of or within the chamber. Positioned within the chamber is a target material. One or more sets of confining magnets are also provided to create a cross B magnetic field directly above the target. To generate neutrons/gamma rays, the appropriate source gas is first introduced into the chamber, the RF antenna energized and a plasma formed. A series of high voltage pulses are then applied to the target. A plasma sheath, which serves as an accelerating gap, is formed upon application of the high voltage pulse to the target. Depending upon the selected combination of source gas and target material, either neutrons or gamma rays are generated, which may be used for cargo inspection, and the like.
Energy Technology Data Exchange (ETDEWEB)
Hamada, M [Shimonoseki Univ. of Fisheries, Yamaguchi (Japan); Gohya, Y; Ishio, S
1981-08-01
The effect of ..gamma..-ray irradiation on monosodium glutamate (MSG) in aqueous solution and in ''kamaboko'' was investigated to evaluate the rate of decomposition of MSG and to elucidate the safety of the decomposed products, under the concentration of 106.9 mmol/l aqueous solution and 1% content of MSG in ''kamaboko''. In aqueous solution, MSG was decomposed by ..gamma..-ray irradiation, and G value was estimated to be 1.24. The decomposition of MSG resulted from deamination reaction was estimated to be 40% of the total decomposition. Glutamic acid content decreased as the dose of ..gamma..-ray increased in MSG-enriched ''kamaboko'', while it increased as the dose of ..gamma..-ray increased in MSG-free ''kamaboko''. Glutamic acid was liberated from the protein in ''kamaboko'', therefore the apparent decomposition rate of MSG in ''kamaboko'' was regarded as lower than actual.
European team gauges a gamma-ray star
1996-03-01
satellite COS-B had defined the position of the gamma-ray source to within half a degree -- well enough to prompt renewed efforts to identify it. Radio searches still drew a blank, but in the early 1980s Bignami and others found X-rays coming from Geminga in observations with NASA's Einstein satellite. They narrowed down Geminga's position to within a twentieth of a degree. There was no obvious counterpart to Geminga in visible light. Between 1983 and 1987 the Milanese team hunted for it with large telescopes in Hawaii and Chile. Eventually they selected a very faint object, peculiar in colour, as the visible Geminga. In 1992 a further sighting from Chile established Geminga's rate of movement across the sky. Meanwhile, the German/US/UK satellite Rosat revealed that Geminga pulsates in X-rays four times a second -- every 237 milliseconds to be precise. The same pulsation was found in gamma-rays by NASA's Gamma-Ray Observatory. Bignami and his colleagues then returned to the gamma-ray data from ESA's COS-B. They found the pulsation hidden there too and were able to compute the slowdown in Geminga's pulse-rate. From the slowdown they estimated the age of Geminga at 340,000 years. The distance measurement completes the gradual transformation of the enigmatic gamma-ray source into a well-characterized object. The Italian team calculates that Geminga is travelling at a speed of at least 120 kilometres per second. The neutron star's radiation in gamma-rays and X-rays is equivalent in energy to ten times the visible light of the Sun. More importantly, the way in which the neutron star distributes its energy output at different wavelengths is now known. "Neutron stars are radio sources for only a small fraction of their lives," says Giovanni Bignami. "So while we know 700 pulsars, there are probably millions of radio-silent neutron stars like Geminga. Thousands of them may be among X-ray sources already known but so far unidentified. I look forward to searching for new Gemingas
Hughes, E. B.; Hofstadter, R.; Rolfe, J.; Johansson, A.; Bertsch, D. L.; Cruickshank, W. J.; Ehrmann, C. H.; Fichtel, C. E.; Hartman, R. C.; Kniffen, D. A.
1980-01-01
The high energy gamma-ray telescope selected for definition studies on the Gamma Ray Observatory provides a substantial improvement in observational capability over earlier instruments. It will have about 20 times more sensitivity, cover a much broader energy range, have considerably better energy resolution and provide a significantly improved angular resolution. The design and performance are described.
Gamma-ray emission profile measurements during JET ICRH discharges
Energy Technology Data Exchange (ETDEWEB)
Jarvis, O N; Marcus, F B; Sadler, G; Van Belle, P [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Howarth, P J.A. [Birmingham Univ. (United Kingdom); Adams, J M; Bond, D S [UKAEA Harwell Lab. (United Kingdom). Energy Technology Div.
1994-07-01
Gamma-ray emission from plasma-impurity reactions caused by minority ICRH accelerating fuel ions to MeV energies has been measured using the JET neutron profile monitor. A successful data analysis technique has been used to isolate the RF-induced gamma-ray emission that was detected, enabling profiles of gamma-ray emission to be obtained. The 2-d gamma-ray emission profiles show that virtually all the radiation originates from the low field side of the RF resonance layer, as expected from RF-induced pitch angle diffusion. The emission profiles indicate the presence of a small population of resonant {sup 3}He ions that possess orbits lying near the passing-trapped boundary. 6 refs., 4 figs.
High energy astrophysics with ground-based gamma ray detectors
International Nuclear Information System (INIS)
Aharonian, F; Buckley, J; Kifune, T; Sinnis, G
2008-01-01
Recent advances in ground-based gamma ray astronomy have led to the discovery of more than 70 sources of very high energy (E γ ≥ 100 GeV) gamma rays, falling into a number of source populations including pulsar wind nebulae, shell type supernova remnants, Wolf-Rayet stars, giant molecular clouds, binary systems, the Galactic Center, active galactic nuclei and 'dark' (yet unidentified) galactic objects. We summarize the history of TeV gamma ray astronomy up to the current status of the field including a description of experimental techniques and highlight recent astrophysical results. We also discuss the potential of ground-based gamma ray astronomy for future discoveries and describe possible directions for future instrumental developments
Six Years of Gamma Ray Burst Observations with BeppoSAX
Frontera, Filippo
2004-01-01
I give a summary of the prompt X-/gamma-ray detections of Gamma Ray Bursts (GRBs) with the BeppoSAX satellite and discuss some significant results obtained from the study of the prompt emission of these GRBs obtained with the BeppoSAX Gamma Ray Burst Monitor and Wide Field Cameras.
X-ray and gamma-ray standards for detector calibration
International Nuclear Information System (INIS)
1991-09-01
The IAEA established a Co-ordinated Research Programme (CRP) on the Measurements and Evaluation of X- and Gamma-Ray Standards for Detector Efficiency Calibration in 1986 with the aim of alleviating the generation of such discrepancies. Within the framework of this CRP, representatives of nine research groups from six Member States and one international organization performed a number of precise measurements and systematic in-depth evaluations of the required decay data. They have also contributed to the development of evaluation methodology and measurement techniques, and stimulated a number of such studies at laboratories not directly involved in the IAEA project. The results of the work of the CRP, which was finished in 1990, are presented in this report. Recommended values of half-lives and photon emission probabilities are given for a carefully selected set of radionuclides that are suitable for detector efficiency calibration (X-rays from 5 to 90 keV and gamma-rays from 30 to about 3000 keV). Detector efficiency calibration for higher gamma-ray energies (up to 14 MeV) is also considered. The evaluation procedures used to obtain the recommended values and their estimated uncertainties are reported, and a summary of the remaining discrepancies is given. Refs and tabs
Method for spatially modulating X-ray pulses using MEMS-based X-ray optics
Lopez, Daniel; Shenoy, Gopal; Wang, Jin; Walko, Donald A.; Jung, Il-Woong; Mukhopadhyay, Deepkishore
2015-03-10
A method and apparatus are provided for spatially modulating X-rays or X-ray pulses using microelectromechanical systems (MEMS) based X-ray optics. A torsionally-oscillating MEMS micromirror and a method of leveraging the grazing-angle reflection property are provided to modulate X-ray pulses with a high-degree of controllability.
Population Synthesis of Radio & Gamma-Ray Millisecond Pulsars
Frederick, Sara; Gonthier, P. L.; Harding, A. K.
2014-01-01
In recent years, the number of known gamma-ray millisecond pulsars (MSPs) in the Galactic disk has risen substantially thanks to confirmed detections by Fermi Gamma-ray Space Telescope (Fermi). We have developed a new population synthesis of gamma-ray and radio MSPs in the galaxy which uses Markov Chain Monte Carlo techniques to explore the large and small worlds of the model parameter space and allows for comparisons of the simulated and detected MSP distributions. The simulation employs empirical radio and gamma-ray luminosity models that are dependent upon the pulsar period and period derivative with freely varying exponents. Parameters associated with the birth distributions are also free to vary. The computer code adjusts the magnitudes of the model luminosities to reproduce the number of MSPs detected by a group of ten radio surveys, thus normalizing the simulation and predicting the MSP birth rates in the Galaxy. Computing many Markov chains leads to preferred sets of model parameters that are further explored through two statistical methods. Marginalized plots define confidence regions in the model parameter space using maximum likelihood methods. A secondary set of confidence regions is determined in parallel using Kuiper statistics calculated from comparisons of cumulative distributions. These two techniques provide feedback to affirm the results and to check for consistency. Radio flux and dispersion measure constraints have been imposed on the simulated gamma-ray distributions in order to reproduce realistic detection conditions. The simulated and detected distributions agree well for both sets of radio and gamma-ray pulsar characteristics, as evidenced by our various comparisons.