WorldWideScience

Sample records for pulsed vhe gamma-ray

  1. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  2. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  3. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  4. Simulated gamma-ray pulse profile of the Crab pulsar with the Cherenkov Telescope Array

    Science.gov (United States)

    Burtovoi, A.; Zampieri, L.

    2016-07-01

    We present simulations of the very high energy (VHE) gamma-ray light curve of the Crab pulsar as observed by the Cherenkov Telescope Array (CTA). The CTA pulse profile of the Crab pulsar is simulated with the specific goal of determining the accuracy of the position of the interpulse. We fit the pulse shape obtained by the Major Atmospheric Gamma-Ray Imaging Cherenkov (MAGIC) telescope with a three-Gaussian template and rescale it to account for the different CTA instrumental and observational configurations. Simulations are performed for different configurations of CTA and for the ASTRI (Astrofisica con Specchi a Tecnologia Replicante Italiana) mini-array. The northern CTA configuration will provide an improvement of a factor of ˜3 in accuracy with an observing time comparable to that of MAGIC (73 h). Unless the VHE spectrum above 1 TeV behaves differently from what we presently know, unreasonably long observing times are required for a significant detection of the pulsations of the Crab pulsar with the high-energy-range sub-arrays. We also found that an independent VHE timing analysis is feasible with Large Size Telescopes. CTA will provide a significant improvement in determining the VHE pulse shape parameters necessary to constrain theoretical models of the gamma-ray emission of the Crab pulsar. One of such parameters is the shift in phase between peaks in the pulse profile at VHE and in other energy bands that, if detected, may point to different locations of the emission regions.

  5. SEARCH FOR A CORRELATION BETWEEN VERY-HIGH-ENERGY GAMMA RAYS AND GIANT RADIO PULSES IN THE CRAB PULSAR

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail: schroedter@veritas.sao.arizona.edu, E-mail: mccann@kicp.uchicago.edu, E-mail: nepomuk.otte@gmail.com [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others

    2012-12-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  6. Search for a Correlation Between Very-High-Energy Gamma Rays and Giant Radio Pulses in the Crab Pulsar

    Science.gov (United States)

    Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; hide

    2012-01-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  7. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE

    2006-04-19

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  8. Terrestrial gamma ray flash production by lightning current pulses

    OpenAIRE

    İnan, Umran Savaş; Carlson, B. E.; Lehtinen, N. G.

    2017-01-01

    Terrestrial gamma ray flashes (TGFs) are brief bursts of gamma rays observed by satellites, typically in coincidence with detectable lightning. We incorporate TGF observations and the key physics behind current TGF production theories with lightning physics to produce constraints on TGF production mechanisms. The combined constraints naturally suggest a mechanism for TGF production by current pulses in lightning leader channels. The mechanism involves local field enhancements due to charge re...

  9. Research of pulse gamma ray radiation effect on microcontroller system

    International Nuclear Information System (INIS)

    Yang Shanchao; Ma Qiang; Jin Xiaoming; Li Ruibin; Lin Dongsheng; Chen Wei; Liu Yan

    2012-01-01

    An experimental result of power chip LM7805 and microcontroller EE80C196KC20 based on the EE80C196KC20 testing system was presented. The pulse gamma ray radiation effect was investigated using 'Qiangguang-Ⅰ' accelerator. Latchup threshold of the microcontroller was obtained, and the relationship of supply current and I/O output with the transient dose rate was observed. The result shows that the restrainability of power chip on pulse gamma ray radiation induces microcontroller latchup effect. (authors)

  10. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  11. Modeling of Pulses in Terrestrial Gamma-ray Flashes

    Science.gov (United States)

    Xu, Wei; Celestin, Sebastien; Pasko, Victor

    2015-04-01

    Terrestrial Gamma-ray Flashes (TGFs) are high-energy photon bursts originating from the Earth's atmosphere that are associated with lightning activities. After their discovery in 1994 by the Burst and Transient Source Experiment (BATSE) detector aboard the Compton Gamma-Ray Observatory [Fishman et al., Science, 264, 1313, 1994], this phenomenon has been further observed by the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI) [Smith et al., Science, 307, 1085, 2005], the Fermi Gamma-ray Space Telescope [Briggs et al., JGR, 115, A07323, 2010] and the Astrorivelatore Gamma a Immagini Leggero (AGILE) satellite [Marisaldi et al., JGR, 115, A00E13, 2010]. Photon spectra corresponding to the mechanism of relativistic runaway electron avalanches (RREAs) usually provide a very good agreement with satellite observations [Dwyer and Smith, GRL, 32, L22804, 2005]. On the other hand, Celestin and Pasko [JGR, 116, A03315, 2011] have shown theoretically that the large flux of thermal runaway electrons generated by streamers during the negative corona flash stage of stepping lightning leaders in intracloud lightning flashes could be responsible for TGFs. Recently, based on analysis of the temporal profiles of 278 TGF events observed by the Fermi Gamma-Ray Burst Monitor, Foley et al. [JGR, 119, 5931, 2014] have suggested that 67% of TGF pulses detected are asymmetric and these asymmetric pulses are consistent with the production mechanism of TGFs by relativistic feedback discharges. In the present work, we employ a Monte Carlo model to study the temporal distribution of photons at low-orbit satellite altitudes during TGF events. Using the pulse fitting method described in [Foley et al., 2014], we further investigate the characteristics of TGF pulses. We mainly focus on the effects of Compton scattering on the symmetry properties and the rise and fall times of TGF pulses.

  12. Timing of Pulsed Prompt Gamma Rays for Background Discrimination

    International Nuclear Information System (INIS)

    Hueso-Gonzalez, F.; Golnik, C.; Berthel, M.; Dreyer, A.; Kormoll, T.; Rohling, H.; Pausch, G.; Enghardt, W.; Fiedler, F.; Heidel, K.; Schoene, S.; Schwengner, R.; Wagner, A.

    2013-06-01

    In the context of particle therapy, particle range verification is a major challenge for the quality assurance of the treatment. One approach is the measurement of the prompt gamma rays resulting from the tissue irradiation. A Compton camera based on several planes of position sensitive gamma ray detectors, together with an imaging algorithm, is expected to reconstruct the prompt gamma ray emission density profile, which is correlated with the dose distribution. At Helmholtz- Zentrum Dresden-Rossendorf (HZDR) and OncoRay, a camera prototype has been developed consisting of two scatter planes (CdZnTe cross strip detectors) and an absorber plane (Lu 2 SiO 5 block detector). The data acquisition is based on VME electronics and handled by software developed on the ROOT platform. The prototype was tested at the linear electron accelerator ELBE at HZDR, which was set up to produce bunched bremsstrahlung photons. Their spectrum has similarities with the one expected from prompt gamma rays in the clinical case, and these are also bunched with the accelerator frequency. The time correlation between the pulsed prompt photons and the measured signals was used for background discrimination, achieving a time resolution of 3 ns (2 ns) FWHM for the CZT (LSO) detector. A time-walk correction was applied for the LSO detector and improved its resolution to 1 ns. In conclusion, the detectors are suitable for time-resolved background discrimination in pulsed clinical particle accelerators. Ongoing tasks are the test of the imaging algorithms and the quantitative comparison with simulations. Further experiments will be performed at proton accelerators. (authors)

  13. Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae

    Energy Technology Data Exchange (ETDEWEB)

    Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)

    2017-07-20

    The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.

  14. Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope

    International Nuclear Information System (INIS)

    Badran, H.M.

    2004-01-01

    Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV

  15. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    Science.gov (United States)

    Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong

    2014-01-01

    It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.

  16. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    International Nuclear Information System (INIS)

    Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao

    2014-01-01

    It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)

  17. Pulsed Gamma-Rays From PSR J2021 3651 with the Fermi Large Area Telescope

    International Nuclear Information System (INIS)

    Abdo, Aous A.; Ackermann, M.; Ajello, Marco; Atwood, William B.; Baldini, L.; Ballet, J.; Barbiellini, Guido; Bastieri, Denis; Battelino, Milan; Baughman, B.M.; Bechtol, K.; Bellazzini, Ronaldo; Berenji, Bijan; Bloom, Elliott D.; Bogaert, G.; Borgland, Anders W.; Bregeon, J.; Brez, A.; Brigida, M.; Bruel, P.; Burnett, Thompson H.

    2009-01-01

    We report the detection of pulsed gamma-rays from the young, spin-powered radio pulsar PSR J2021+3651 using data acquired with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). The light curve consists of two narrow peaks of similar amplitude separated by 0.468 ± 0.002 in phase. The first peak lags the maximum of the 2 GHz radio pulse by 0.162 ± 0.004 ± 0.01 in phase. The integral gamma-ray photon flux above 100 MeV is (56 ± 3 ± 11) x 10 -8 cm -2 s -1 . The photon spectrum is well-described by an exponentially cut-off power law of the form dF/dE = kE -# Gamma#e (-E/E c ) where the energy E is expressed in GeV. The photon index is Γ = 1.5 ± 0.1 ± 0.1 and the exponential cut-off is E c = 2.4 ± 0.3 ± 0.5 GeV. The first uncertainty is statistical and the second is systematic. The integral photon flux of the bridge is approximately 10% of the pulsed emission, and the upper limit on off-pulse gamma-ray emission from a putative pulsar wind nebula is -2 but a poorly constrained magnetic geometry. Re-analysis of Chandra data enhanced the significance of the weak X-ray pulsations, and the first peak is roughly phase-aligned with the first gamma-ray peak. We discuss the emission region and beaming geometry based on the shape and spectrum of the gamma-ray light curve combined with radio and X-ray measurements, and the implications for the pulsar distance. Gamma-ray emission from the polar cap region seems unlikely for this pulsar.

  18. Earth formation pulsed neutron porosity logging system utilizing epithermal neutron and inelastic scattering gamma ray detectors

    International Nuclear Information System (INIS)

    Smith, H.D. Jr.; Smith, M.P.; Schultz, W.E.

    1978-01-01

    An improved pulsed neutron porosity logging system is provided in the present invention. A logging tool provided with a 14 MeV pulsed neutron source, an epithermal neutron detector and an inelastic scattering gamma ray detector is moved through a borehole. The detection of inelastic gamma rays provides a measure of the fast neutron population in the vicinity of the detector. repetitive bursts of neutrons irradiate the earth formation and, during the busts, inelastic gamma rays representative of the fast neutron population is sampled. During the interval between bursts the epithermal neutron population is sampled along with background gamma radiation due to lingering thermal neutrons. the fast and epithermal neutron population measurements are combined to provide a measurement of formation porosity

  19. Component Analysis of Long-Lag, Wide-Pulse Gamma-Ray Burst ...

    Indian Academy of Sciences (India)

    Principal Component Analysis of Long-Lag, Wide-Pulse Gamma-Ray. Burst Data. Zhao-Yang Peng. ∗. & Wen-Shuai Liu. Department of Physics, Yunnan Normal University, Kunming 650500, China. ∗ e-mail: pzy@ynao.ac.cn. Abstract. We have carried out a Principal Component Analysis (PCA) of the temporal and spectral ...

  20. The effect of pulse pile-up on discrimination between neutrons and gamma rays

    International Nuclear Information System (INIS)

    Whittlestone, S.

    1980-01-01

    Pulse pile-up lengthens the rise-time of pulses. With an organic scintillator such as NE 213, pile-up can cause a short rise-time pulse originating from gamma rays to be interpreted by a rise-time analyser as a neutron. The degradation of pulse shape analyser performance at high count rates is shown to be directly related to pulse pile-up. Using this relationship, the contribution of piled-up gamma rays and neutrons to count rate related errors is calculated for a time-dependent fast neutron energy spectrum measurement. Errors of a few per cent occur even when the probability of a count per burst is as low as 0.01. (orig.)

  1. Computer model for calculating gamma-ray pulse-height spectra for logging applications

    International Nuclear Information System (INIS)

    Evans, M.L.

    1981-01-01

    A generalized computer model has been devised to simulate the emission, transport, and detection of natural gamma radiation from various logging environments. The model yields high-resolution gamma-ray pulse-height spectra that can be used to correct both gross gamma and spectral gamma-ray logs. The technique can help provide corrections to airborne and surface radiometric survey logs for the effects of varying altitude, formation composition, and overburden. Applied to borehole logging, the model can yield estimates of the effects of varying borehole fluid and casing attenuations, as well as varying formation porosity and saturation

  2. Catalogue of response spectra for unfolding in situ gamma-ray pulse-height distributions

    International Nuclear Information System (INIS)

    Dymke, N.

    1982-01-01

    To unfold in situ gamma-ray pulse-height distributions by means of a response matrix technique, the matrix must be in keeping with the measurement geometry, detector size, and energy range to be covered by the measurements. A methodology has been described for determination of standard gamma-ray spectra needed in deriving response matrices and a spectrum catalogue compiled containing graphs and data for the 0-3 MeV (4 x 4 in. NaI(Tl)) and 0-8 MeV (1.5 x 1.5 in. NaI(Tl)) ranges. (author)

  3. Random pulsing of neutron source for inelastic neutron scattering gamma ray spectroscopy

    International Nuclear Information System (INIS)

    Hertzog, R.C.

    1981-01-01

    Method and apparatus are described for use in the detection of inelastic neutron scattering gamma ray spectroscopy. Data acquisition efficiency is enhanced by operating a neutron generator such that a resulting output burst of fast neutrons is maintained for as long as practicably possible until a gamma ray is detected. Upon the detection of a gamma ray the generator burst output is terminated. Pulsing of the generator may be accomplished either by controlling the burst period relative to the burst interval to achieve a constant duty cycle for the operation of the generator or by maintaining the burst period constant and controlling the burst interval such that the resulting mean burst interval corresponds to a burst time interval which reduces contributions to the detected radiation of radiation occasioned by other than the fast neutrons

  4. SEARCH FOR PULSED {gamma}-RAY EMISSION FROM GLOBULAR CLUSTER M28

    Energy Technology Data Exchange (ETDEWEB)

    Wu, J. H. K.; Kong, A. K. H.; Huang, R. H. H.; Tam, P. H. T. [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu, Taiwan (China); Hui, C. Y. [Department of Astronomy and Space Science, Chungnam National University, Daejeon (Korea, Republic of); Wu, E. M. H.; Takata, J.; Cheng, K. S., E-mail: wuhkjason@gmail.com, E-mail: cyhui@cnu.ac.kr [Department of Physics, University of Hong Kong, Pokfulam Road (Hong Kong)

    2013-03-10

    Using the data from the Large Area Telescope on board the Fermi Gamma-ray Space Telescope, we have searched for {gamma}-ray pulsations from the direction of the globular cluster M28 (NGC 6626). We report the discovery of a signal with a frequency consistent with that of the energetic millisecond pulsar (MSP) PSR B1821-24 in M28. A weighted H-test test statistic of 28.8 is attained, which corresponds to a chance probability of {approx}10{sup -5} (4.3{sigma} detection). With a phase-resolved analysis, the pulsed component is found to contribute {approx}25% of the total observed {gamma}-ray emission from the cluster. However, the unpulsed level provides a constraint for the underlying MSP population and the fundamental plane relations for the scenario of inverse Compton scattering. Follow-up timing observations in radio/X-ray are encouraged to further investigate this periodic signal candidate.

  5. Pulsed Gamma-Rays From PSR J2021 3651 with the Fermi Large Area Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Battelino, Milan; /Royal Inst. Tech., Stockholm; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bogaert, G.; /Ecole Polytechnique; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /IASF, Milan /IASF, Milan /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /LPCE, Orleans /Montpellier U. /Sonoma State U. /Royal Inst. Tech., Stockholm /Stockholm U. /ASI, Rome /NRAO, Charlottesville /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Manchester U. /Montpellier U. /Bari U. /INFN, Bari; /more authors..

    2011-11-30

    We report the detection of pulsed gamma-rays from the young, spin-powered radio pulsar PSR J2021+3651 using data acquired with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). The light curve consists of two narrow peaks of similar amplitude separated by 0.468 {+-} 0.002 in phase. The first peak lags the maximum of the 2 GHz radio pulse by 0.162 {+-} 0.004 {+-} 0.01 in phase. The integral gamma-ray photon flux above 100 MeV is (56 {+-} 3 {+-} 11) x 10{sup -8} cm{sup -2} s{sup -1}. The photon spectrum is well-described by an exponentially cut-off power law of the form dF/dE = kE{sup -{Gamma}}e{sup (-E/E{sub c})} where the energy E is expressed in GeV. The photon index is {Gamma} = 1.5 {+-} 0.1 {+-} 0.1 and the exponential cut-off is E{sub c} = 2.4 {+-} 0.3 {+-} 0.5 GeV. The first uncertainty is statistical and the second is systematic. The integral photon flux of the bridge is approximately 10% of the pulsed emission, and the upper limit on off-pulse gamma-ray emission from a putative pulsar wind nebula is < 10% of the pulsed emission at the 95% confidence level. Radio polarization measurements yield a rotation measure of RM = 524 {+-} 4 rad m{sup -2} but a poorly constrained magnetic geometry. Re-analysis of Chandra data enhanced the significance of the weak X-ray pulsations, and the first peak is roughly phase-aligned with the first gamma-ray peak. We discuss the emission region and beaming geometry based on the shape and spectrum of the gamma-ray light curve combined with radio and X-ray measurements, and the implications for the pulsar distance. Gamma-ray emission from the polar cap region seems unlikely for this pulsar.

  6. Inter-pulse high-resolution gamma-ray spectra using a 14 MeV pulsed neutron generator

    Science.gov (United States)

    Evans, L.G.; Trombka, J.I.; Jensen, D.H.; Stephenson, W.A.; Hoover, R.A.; Mikesell, J.L.; Tanner, A.B.; Senftle, F.E.

    1984-01-01

    A neutron generator pulsed at 100 s-1 was suspended in an artificial borehole containing a 7.7 metric ton mixture of sand, aragonite, magnetite, sulfur, and salt. Two Ge(HP) gamma-ray detectors were used: one in a borehole sonde, and one at the outside wall of the sample tank opposite the neutron generator target. Gamma-ray spectra were collected by the outside detector during each of 10 discrete time windows during the 10 ms period following the onset of gamma-ray build-up after each neutron burst. The sample was measured first when dry and then when saturated with water. In the dry sample, gamma rays due to inelastic neutron scattering, neutron capture, and decay were counted during the first (150 ??s) time window. Subsequently only capture and decay gamma rays were observed. In the wet sample, only neutron capture and decay gamma rays were observed. Neutron capture gamma rays dominated the spectrum during the period from 150 to 400 ??s after the neutron burst in both samples, but decreased with time much more rapidly in the wet sample. A signal-to-noise-ratio (S/N) analysis indicates that optimum conditions for neutron capture analysis occurred in the 350-800 ??s window. A poor S/N in the first 100-150 ??s is due to a large background continuum during the first time interval. Time gating can be used to enhance gamma-ray spectra, depending on the nuclides in the target material and the reactions needed to produce them, and should improve the sensitivity of in situ well logging. ?? 1984.

  7. Baseline distortion effect on gamma-ray pulse-height spectra in neutron capture experiments

    International Nuclear Information System (INIS)

    Laptev, A.; Harada, H.; Nakamura, S.; Hori, J.; Igashira, M.; Ohsaki, T.; Ohgama, K.

    2005-01-01

    A baseline distortion effect due to gamma-flash at neutron time-of-flight measurement using a pulse neutron source has been investigated. Pulses from C 6 D 6 detectors accumulated by flash-ADC were processed with both standard analog-to-digital converter (ADC) and flash-ADC operational modes. A correction factor of gamma-ray yields, due to baseline shift, was quantitatively obtained by comparing the pulse height spectra of the two data-taking modes. The magnitude of the correction factor depends on the time after gamma-flash and has complex time dependence with a changing sign

  8. On the Time Evolution of Gamma-Ray Burst Pulses: A Self-Consistent Description.

    Science.gov (United States)

    Ryde; Svensson

    2000-01-20

    For the first time, the consequences of combining two well-established empirical relations that describe different aspects of the spectral evolution of observed gamma-ray burst (GRB) pulses are explored. These empirical relations are (1) the hardness-intensity correlation and (2) the hardness-photon fluence correlation. From these we find a self-consistent, quantitative, and compact description for the temporal evolution of pulse decay phases within a GRB light curve. In particular, we show that in the case in which the two empirical relations are both valid, the instantaneous photon flux (intensity) must behave as 1&solm0;&parl0;1+t&solm0;tau&parr0;, where tau is a time constant that can be expressed in terms of the parameters of the two empirical relations. The time evolution is fully defined by two initial constants and two parameters. We study a complete sample of 83 bright GRB pulses observed by the Compton Gamma-Ray Observatory and identify a major subgroup of GRB pulses ( approximately 45%) which satisfy the spectral-temporal behavior described above. In particular, the decay phase follows a reciprocal law in time. It is unclear what physics causes such a decay phase.

  9. Properties of gamma-ray burst time profiles using pulse decomposition analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, A.

    2000-02-08

    The time profiles of many gamma-ray bursts consist of distinct pulses, which offers the possibility of characterizing the temporal structure of these bursts using a relatively small set of pulse shape parameters. This pulse decomposition analysis has previously been performed on a small sample of bright long bursts using binned data from BATSE, which comes in several data types, and on a sample of short bursts using the BATSE Time-Tagged Event (TTE) data type. The authors have developed an interactive pulse-fitting program using the phenomenological pulse model of Norris, et. al. and a maximum-likelihood fitting routine. They have used this program to analyze the Time-to-Spill (TTS) data for all bursts observed by BATSE up through trigger number 2000, in all energy channels for which TTS data is available. They present statistical information on the attributes of pulses comprising these bursts, including relations between pulse characteristics through the course of a burst. They carry out simulations to determine the biases that their procedures may introduce. They find that pulses tend to have shorter rise times than decay times, and tend to be narrower and peak earlier at higher energies. They also find that pulse brightness, pulse width, and pulse hardness ratios do not evolve monotonically within bursts, but that the ratios of pulse rise times to decay times tends to decrease with time within bursts.

  10. Very high-energy gamma rays from gamma-ray bursts.

    Science.gov (United States)

    Chadwick, Paula M

    2007-05-15

    Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.

  11. Pulsed Gamma-Rays From the Millisecond Pulsar J0030+0451 with the Fermi Large Area Telescope

    International Nuclear Information System (INIS)

    Abdo, Aous A.; Ackermann, M.; Atwood, W.B.; Axelsson, M.; Baldini, L.; Ballet, J.; Barbiellini, Guido; Bastieri, Denis; Battelino, M.; Baughman, B.M.; Bechtol, K.; Bellazzini, R.; Berenji, B.; Bloom, Elliott D.; Bonamente, E.; Borgland, A.W.; Bregeon, J.; Brez, A.; Brigida, M.; Bruel, P.; Burnett, Thompson H.

    2009-01-01

    We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar PSR J0030+0451 with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second millisecond pulsar to be detected in gamma-rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma Ray Observatory. The spin-down power (dot E) = 3.5 x 10 33 ergs s -1 is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, respectively 0.07 ± 0.01 and 0.08 ± 0.02 wide, separated by 0.44 ± 0.02 in phase. The first gamma-ray peak falls 0.15 ± 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cut-off power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 ± 1.05 ± 1.35) x 10 -8 cm -2 s -1 with cut-off energy (1.7 ± 0.4 ± 0.5) GeV. Based on its parallax distance of (300 ± 90) pc, we obtain a gamma-ray efficiency L γ /(dot E) ≅ 15% for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.

  12. PULSED GAMMA RAYS FROM THE MILLISECOND PULSAR J0030+0451 WITH THE FERMI LARGE AREA TELESCOPE

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Battelino, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.; Bruel, P.

    2009-01-01

    We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar (MSP) PSR J0030+0451 with the Large Area Telescope on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second MSP to be detected in gamma rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma-Ray Observatory. The spin-down power E-dot=3.5x10 33 erg s -1 is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, 0.07 ± 0.01 and 0.08 ± 0.02 wide, respectively, separated by 0.44 ± 0.02 in phase. The first gamma-ray peak falls 0.15 ± 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cutoff power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 ± 1.05 ± 1.35) x 10 -8 cm -2 s -1 with cutoff energy (1.7 ± 0.4 ± 0.5) GeV. Based on its parallax distance of (300 ± 90) pc, we obtain a gamma-ray efficiency L γ /E-dot≅15 percent for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.

  13. Pulsed Gamma-Rays From the Millisecond Pulsar J0030+0451 with the Fermi Large Area Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M. /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Battelino, M.; /Stockholm U., OKC /Royal Inst. Tech., Stockholm; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Trieste /Hiroshima U.; /more authors..

    2011-11-17

    We report the discovery of gamma-ray pulsations from the nearby isolated millisecond pulsar PSR J0030+0451 with the Large Area Telescope (LAT) on the Fermi Gamma-ray Space Telescope (formerly GLAST). This discovery makes PSR J0030+0451 the second millisecond pulsar to be detected in gamma-rays after PSR J0218+4232, observed by the EGRET instrument on the Compton Gamma Ray Observatory. The spin-down power {dot E} = 3.5 x 10{sup 33} ergs s{sup -1} is an order of magnitude lower than the empirical lower bound of previously known gamma-ray pulsars. The emission profile is characterized by two narrow peaks, respectively 0.07 {+-} 0.01 and 0.08 {+-} 0.02 wide, separated by 0.44 {+-} 0.02 in phase. The first gamma-ray peak falls 0.15 {+-} 0.01 after the main radio peak. The pulse shape is similar to that of the 'normal' gamma-ray pulsars. An exponentially cut-off power-law fit of the emission spectrum leads to an integral photon flux above 100 MeV of (6.76 {+-} 1.05 {+-} 1.35) x 10{sup -8} cm{sup -2} s{sup -1} with cut-off energy (1.7 {+-} 0.4 {+-} 0.5) GeV. Based on its parallax distance of (300 {+-} 90) pc, we obtain a gamma-ray efficiency L{sub {gamma}}/{dot E} {approx_equal} 15% for the conversion of spin-down energy rate into gamma-ray radiation, assuming isotropic emission.

  14. LIMITS ON PROMPT, DISPERSED RADIO PULSES FROM GAMMA-RAY BURSTS

    International Nuclear Information System (INIS)

    Bannister, K. W.; Murphy, T.; Gaensler, B. M.; Reynolds, J. E.

    2012-01-01

    We have searched for prompt radio emission from nine gamma-ray bursts (GRBs) with a 12 m telescope at 1.4 GHz, with a time resolution of 64 μs to 1 s. We detected single dispersed radio pulses with significances >6σ in the few minutes following two GRBs. The dispersion measures of both pulses are well in excess of the expected Galactic values, and the implied rate is incompatible with known sources of single dispersed pulses. The arrival times of both pulses also coincide with breaks in the GRB X-ray light curves. A null trial and statistical arguments rule out random fluctuations as the origin of these pulses with >95% and ∼97% confidence, respectively, although a simple population argument supports a GRB origin with confidence of only 2%. We caution that we cannot rule out radio frequency interference (RFI) as the origin of these pulses. If the single pulses are not related to the GRBs, we set an upper limit on the flux density of radio pulses emitted between 200 and 1800 s after a GRB of 1.27w –1/2 Jy, where 6.4 × 10 –5 s –3 s is the pulse width. We set a limit of less than 760 Jy for long timescale (>1 s) variations. These limits are some of the most constraining at high time resolution and GHz frequencies in the early stages of the GRB phenomenon.

  15. Time profiles and pulse structure of bright, long gamma-ray bursts using BATSE TTS data

    International Nuclear Information System (INIS)

    Lee, A.; Bloom, E.; Scargle, J.

    1996-04-01

    The time profiles of many gamma-ray bursts observed by BATSE consist of distinct pulses, which offer the possibility of characterizing the temporal structure of these bursts using a relatively small set of pulse-shape parameters. This pulse analysis has previously been performed on some bright, long bursts using binned data, and on some short bursts using BATSE Time-Tagged Event (TTE) data. The BATSE Time- to-Spill (TTS) burst data records the times required to accumulate a fixed number of photons, giving variable time resolution. The spill times recorded in the TTS data behave as a gamma distribution. We have developed an interactive pulse-fitting program using the pulse model of Norris et al. and a maximum-likelihood fitting algorithm to the gamma distribution of the spill times. We then used this program to analyze a number of bright, long bursts for which TTS data is available. We present statistical information on the attributes of pulses comprising these bursts

  16. Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981

    International Nuclear Information System (INIS)

    Lamb, R.C.

    1981-04-01

    Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June

  17. Current Sheets in Pulsar Magnetospheres and Winds: Particle Acceleration and Pulsed Gamma Ray Emission

    Science.gov (United States)

    Arons, Jonathan

    electric current that separate regions of differing magnetization into the domain of highly relativistic magnetic fields - those with energy density large compared to the rest mass energy of the charged particles - the plasma - caught in that field. The investigators will create theoretical and computational models of the magnetic dissipation - a form of viscous flow in the thin sheets of electric current that form in the magnetized regions around the rotating stars - using Particle in-Cell plasma simulations. These simulations use a large computer to solve the equations of motion of many charged particles - millions to billions in the research that will be pursued - to unravel the dissipation of those fields and the acceleration of beams of particles in the thin sheets. The results will be incorporated into macroscopic MHD models of the magnetic structures around the stars which determine the location and strength of the current sheets, so as to model and analyze the pulsed gamma ray emission seen from hundreds of Rotation Powered Pulsars. The computational models will be assisted by ``pencil and paper'' theoretical modeling designed to motivate and interpret the computer simulations, and connect them to the observations.

  18. Pulse-shape discrimination of high-energy neutrons and gamma rays in NaI(Tl)

    International Nuclear Information System (INIS)

    Share, G.H.; Kurfess, J.D.; Theus, R.B.

    1978-01-01

    Pulse-shape discrimination can be used to separate neutron and gamma-ray interactions depositing energies up to in excess of 50 MeV in NaI(Tl) crystals. The secondary alpha particles, deuterons and protons produced in the neutron interactions are also resolvable. (Auth.)

  19. Application of bootstrap sampling in gamma-ray astronomy: Time variability in pulsed emission from crab pulsar

    International Nuclear Information System (INIS)

    Ozel, M.E.; Mayer-Hasselwander, H.

    1985-01-01

    This paper discusses the bootstrap scheme which fits well for many astronomical applications. It is based on the well-known sampling plan called ''sampling with replacement''. Digital computers make the method very practical for the investigation of various trends present in a limited set of data which is usually a small fraction of the total population. The authors attempt to apply the method and demonstrate its feasibility. The study indicates that the discrete nature of high energy gamma-ray data makes the bootstrap method especially attractive for gamma-ray astronomy. Present analysis shows that the ratio of pulse strengths is variable with a 99.8% confidence

  20. Pulse shape analysis for the gamma-ray tracking detector Agata

    International Nuclear Information System (INIS)

    Olariu, A.

    2007-10-01

    Agata is the European project for a 4π gamma-ray tracking array of 180 Ge detectors and is expected to have a detection sensitivity higher by 3 orders of magnitude than that of the present generation of gamma spectrometers. The trajectories of the photons inside a Ge crystal are reconstituted, which allows the determination of the initial energy of the incident photons as the total energy deposited along the track. The sequence of a γ-ray scattering process is too fast compared with the time resolution of the detector to be measured electronically, so tracking algorithms are necessary. Gamma-ray tracking detectors are operating in position sensitive mode it means that Ge crystal are segmented in order to facilitate the localization of the gamma interactions. It is possible to improve the position resolution by using the information conveyed by the shape of the detector signal. The task of the PSA (Pulse Shape Analysis) algorithm is to analyze this signal and extract the number of interactions, the position and the energy of each interaction. PSA algorithms rely on a basis of reference signals given by single interactions and that are obtained through an experimental characterization of the detector with scanning systems. The matrix method is a new PSA algorithm that consists in fitting linearly the detector signal with a set of calculated signals. We have tested this method with both simulated and measured signals. In the case of simulated single interactions the position resolution is 1.4 mm which is within Agata's specifications. For measured signals we have obtained mean positional errors of 3.2 mm at the front end of the detector an 4.8 mm at the back end

  1. Fieldable computer system for determining gamma-ray pulse-height distributions, flux spectra, and dose rates from Little Boy

    International Nuclear Information System (INIS)

    Moss, C.E.; Lucas, M.C.; Tisinger, E.W.; Hamm, M.E.

    1984-01-01

    Our system consists of a LeCroy 3500 data acquisition system with a built-in CAMAC crate and eight bismuth-germanate detectors 7.62 cm in diameter and 7.62 cm long. Gamma-ray pulse-height distributions are acquired simultaneously for up to eight positions. The system was very carefully calibrated and characterized from 0.1 to 8.3 MeV using gamma-ray spectra from a variety of radioactive sources. By fitting the pulse-height distributions from the sources with a function containing 17 parameters, we determined theoretical repsonse functions. We use these response functions to unfold the distributions to obtain flux spectra. A flux-to-dose-rate conversion curve based on the work of Dimbylow and Francis is then used to obtain dose rates. Direct use of measured spectra and flux-to-dose-rate curves to obtain dose rates avoids the errors that can arise from spectrum dependence in simple gamma-ray dosimeter instruments. We present some gamma-ray doses for the Little Boy assembly operated at low power. These results can be used to determine the exposures of the Hiroshima survivors and thus aid in the establishment of radation exposure limits for the nuclear industry

  2. Pulsed Gamma Rays from the Original Millisecond and Black Widow Pulsars: A Case for Caustic Radio Emission?

    Science.gov (United States)

    Guillemot, L.; Johnson, T. J.; Venter, C.; Kerr, M.; Pancrazi, B.; Livingstone, M.; Janssen, G. H.; Jaroenjittichai, P.; Kramer, M.; Cognard, I.; hide

    2011-01-01

    We report the detection of pulsed gamma-ray emission from the fast millisecond pulsars (MSPs) B1937+21 (also known as J1939+2134) and B1957+20 (J1959+2048) using 18 months of survey data recorded by the Fermi Large Area Telescope (LAT) and timing solutions based on radio observations conducted at the Westerbork and Nancay radio telescopes. In addition, we analyzed archival RXTE and XMM-Newton X-ray data for the two MSPs, confirming the X-ray emission properties of PSR B1937+21 and finding evidence (approx. 4(sigma)) for pulsed emission from PSR B1957+20 for the first time. In both cases the gamma-ray emission profile is characterized by two peaks separated by half a rotation and are in close alignment with components observed in radio and X-rays. These two pulsars join PSRs J0034..0534 and J2214+3000 to form an emerging class of gamma-ray MSPs with phase-aligned peaks in different energy bands. The modeling of the radio and gamma-ray emission pro les suggests co-located emission regions in the outer magnetosphere.

  3. Apparatus for reducing pulse pileup in an elemental analyzer measuring gamma rays arising from neutron capture in bulk substances

    International Nuclear Information System (INIS)

    Marshall, J.H. III.

    1979-01-01

    The active reduction of the number of analyzed events with pulse amplitudes which pileup has distorted improves measurement accuracy and response time in an apparatus for neutron-capture-based on-line elemental analysis of bulk substances. Within the apparatus, the analyzed bulk substance is exposed to neutrons, and neutron capture generates prompt gamma rays therefrom. A detector interacts with some of these gamma rays to produce electrical signals used to measure their energy spectrum by pulse-height analysis. Circuits associated with this pulse-height analysis also detect the pileup of the signals of two or more independent gamma rays using one or more of several techniques. These techniques include multiple outputs from a special amplifier-discriminator system, which has been optimized for low pulse-pair resolving time and may have adaptive thresholds, and the requirement that the relative amplitudes of the outputs of slow and fast amplifiers be consistent with a single event producing both outputs. Pulse-width measurements are also included in the pileup detection

  4. Gamma-ray pulse height spectrum analysis on systems with multiple Ge detectors using spectrum summing

    Energy Technology Data Exchange (ETDEWEB)

    Killian, E.W. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1997-11-01

    A technique has been developed at the Idaho National Engineering Laboratory to sum high resolution gamma-ray pulse spectra from systems with multiple Ge detectors. Lockheed Martin Idaho Technologies Company operates a multi-detector spectrometer configuration at the Stored Waste Examination Pilot Plant facility which is used to characterize the radionuclide contents in waste drums destined for shipment to Waste Isolation Pilot Plant. This summing technique was developed to increase the sensitivity of the system, reduce the count times required to properly quantify the radio-nuclides and provide a more consistent methodology for combining data collected from multiple detectors. In spectrometer systems with multiple detectors looking at non homogeneous waste forms it is often difficult to combine individual spectrum analysis results from each detector to obtain a meaningful result for the total waste container. This is particularly true when the counting statistics in each individual spectrum are poor. The spectrum summing technique adds the spectra collected by each detector into a single spectrum which has better counting statistics than each individual spectrum. A normal spectral analysis program can then be used to analyze the sum spectrum to obtain radio-nuclide values which have smaller errors and do not have to be further manipulated to obtain results for the total waste container. 2 refs., 2 figs.

  5. Pulsed neutron logging system for inelastic scattering gamma rays with gain compensation

    International Nuclear Information System (INIS)

    Schultz, W.E.; Smith, H.D. Jr.

    1976-01-01

    An illustrative embodiment of the invention includes methods for linearizing the gain of borehole gamma ray energy measurement apparatus. A known energy peak (or peaks) which is prominent in the gamma ray energy spectra of borehole measurements is monitored and any drift in its apparent location in the energy spectrum is used to generate an error voltage. The error voltage is applied in an inverse feedback manner to control the gain of system amplifiers to cancel the drift

  6. EJ-309 pulse shape discrimination performance with a high gamma-ray-to-neutron ratio and low threshold

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, A.C., E-mail: Alexis.C.Kaplan@gmail.com [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, 2355 Bonisteel Blvd., Ann Arbor, MI 48104 (United States); Nuclear Engineering and Nonproliferation Division, Los Alamos National Laboratory, Los Alamos, NM 87544 (United States); Flaska, M.; Enqvist, A.; Dolan, J.L.; Pozzi, S.A. [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, 2355 Bonisteel Blvd., Ann Arbor, MI 48104 (United States)

    2013-11-21

    Measuring neutrons in the presence of high gamma-ray fluence is a challenge with multi-particle detectors. Organic liquid scintillators such as the EJ-309 are capable of accurate pulse-shape discrimination (PSD) but the chance for particle misclassification is not negligible for some applications. By varying the distance from an EJ-309 scintillator to a strong-gamma-ray source and keeping a weak-neutron source at a fixed position, various gamma-to-neutron ratios can be measured and PSD performance can be quantified. Comparing neutron pulse-height distributions allows for pulse-height specific PSD evaluation, and quantification and visualization of deviation from {sup 252}Cf alone. Even with the addition of the misclassified gamma-rays, the PSD is effective in separating particles so that neutron count rate can be predicted with less than 10% error up to a gamma-to-neutron ratio of almost 650. For applications which can afford a reduction in neutron detection efficiency, PSD can be sufficiently effective in discriminating particles to measure a weak neutron source in a high gamma-ray background. -- Highlights: •We measure neutrons in a high photon background with EJ-309 liquid scintillators. •A low threshold is used to test the limits of particle discrimination. •A weak neutron signal is detectable with a gamma/neutron ratio as high as 770. •Photon pileup most commonly adds to error in classification of neutrons. •Neutron count rates are within 10% of expected rate under high gamma background.

  7. EJ-309 pulse shape discrimination performance with a high gamma-ray-to-neutron ratio and low threshold

    International Nuclear Information System (INIS)

    Kaplan, A.C.; Flaska, M.; Enqvist, A.; Dolan, J.L.; Pozzi, S.A.

    2013-01-01

    Measuring neutrons in the presence of high gamma-ray fluence is a challenge with multi-particle detectors. Organic liquid scintillators such as the EJ-309 are capable of accurate pulse-shape discrimination (PSD) but the chance for particle misclassification is not negligible for some applications. By varying the distance from an EJ-309 scintillator to a strong-gamma-ray source and keeping a weak-neutron source at a fixed position, various gamma-to-neutron ratios can be measured and PSD performance can be quantified. Comparing neutron pulse-height distributions allows for pulse-height specific PSD evaluation, and quantification and visualization of deviation from 252 Cf alone. Even with the addition of the misclassified gamma-rays, the PSD is effective in separating particles so that neutron count rate can be predicted with less than 10% error up to a gamma-to-neutron ratio of almost 650. For applications which can afford a reduction in neutron detection efficiency, PSD can be sufficiently effective in discriminating particles to measure a weak neutron source in a high gamma-ray background. -- Highlights: •We measure neutrons in a high photon background with EJ-309 liquid scintillators. •A low threshold is used to test the limits of particle discrimination. •A weak neutron signal is detectable with a gamma/neutron ratio as high as 770. •Photon pileup most commonly adds to error in classification of neutrons. •Neutron count rates are within 10% of expected rate under high gamma background

  8. A SEARCH FOR VERY HIGH ENERGY GAMMA RAYS FROM THE MISSING LINK BINARY PULSAR J1023+0038 WITH VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail: ester.aliu.fuste@gmail.com, E-mail: gtrichards@gatech.edu, E-mail: masha.chernyakova@dcu.ie, E-mail: malloryr@gmail.com [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2016-11-10

    The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.

  9. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  10. A pulse-shape discrimination method for improving Gamma-ray spectrometry based on a new digital shaping filter

    Science.gov (United States)

    Qin, Zhang-jian; Chen, Chuan; Luo, Jun-song; Xie, Xing-hong; Ge, Liang-quan; Wu, Qi-fan

    2018-04-01

    It is a usual practice for improving spectrum quality by the mean of designing a good shaping filter to improve signal-noise ratio in development of nuclear spectroscopy. Another method is proposed in the paper based on discriminating pulse-shape and discarding the bad pulse whose shape is distorted as a result of abnormal noise, unusual ballistic deficit or bad pulse pile-up. An Exponentially Decaying Pulse (EDP) generated in nuclear particle detectors can be transformed into a Mexican Hat Wavelet Pulse (MHWP) and the derivation process of the transform is given. After the transform is performed, the baseline drift is removed in the new MHWP. Moreover, the MHWP-shape can be discriminated with the three parameters: the time difference between the two minima of the MHWP, and the two ratios which are from the amplitude of the two minima respectively divided by the amplitude of the maximum in the MHWP. A new type of nuclear spectroscopy was implemented based on the new digital shaping filter and the Gamma-ray spectra were acquired with a variety of pulse-shape discrimination levels. It had manifested that the energy resolution and the peak-Compton ratio were both improved after the pulse-shape discrimination method was used.

  11. Discovery of Pulsed Gamma Rays from the Young Radio Pulsar PSR J1028-5819 with the Fermi Large Area Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Baring, Matthew G.; /Rice U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle; Caliandro, G.A.; /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /NASA, Goddard /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Bari U. /INFN, Bari /Ecole Polytechnique /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Trieste /Hiroshima U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..

    2009-05-15

    Radio pulsar PSR J1028-5819 was recently discovered in a high-frequency search (at 3.1 GHz) in the error circle of the Energetic Gamma-Ray Experiment Telescope (EGRET) source 3EG J1027-5817. The spin-down power of this young pulsar is great enough to make it very likely the counterpart for the EGRET source. We report here the discovery of {gamma}-ray pulsations from PSR J1028-5819 in early observations by the Large Area Telescope (LAT) on the Fermi Gamma-Ray Space Telescope. The {gamma}-ray light curve shows two sharp peaks having phase separation of 0.460 {+-} 0.004, trailing the very narrow radio pulse by 0.200 {+-} 0.003 in phase, very similar to that of other known {gamma}-ray pulsars. The measured {gamma}-ray flux gives an efficiency for the pulsar of {approx}10-20% (for outer magnetosphere beam models). No evidence of a surrounding pulsar wind nebula is seen in the current Fermi data but limits on associated emission are weak because the source lies in a crowded region with high background emission. However, the improved angular resolution afforded by the LAT enables the disentanglement of the previous COS-B and EGRET source detections into at least two distinct sources, one of which is now identified as PSR J1028-5819.

  12. THE Ep EVOLUTIONARY SLOPE WITHIN THE DECAY PHASE OF 'FAST RISE AND EXPONENTIAL DECAY' GAMMA-RAY BURST PULSES

    International Nuclear Information System (INIS)

    Peng, Z. Y.; Ma, L.; Yin, Y.; Zhao, X. H.; Fang, L. M.; Bao, Y. Y.

    2009-01-01

    Employing two samples containing of 56 and 59 well-separated fast rise and exponential decay gamma-ray burst pulses whose spectra are fitted by the Band spectrum and Compton model, respectively, we have investigated the evolutionary slope of E p (where E p is the peak energy in the νFν spectrum) with time during the pulse decay phase. The bursts in the samples were observed by the Burst and Transient Source Experiment on the Compton Gamma Ray Observatory. We first test the E p evolutionary slope during the pulse decay phase predicted by Lu et al. based on the model of highly symmetric expanding fireballs in which the curvature effect of the expanding fireball surface is the key factor concerned. It is found that the evolutionary slopes are normally distributed for both samples and concentrated around the values of 0.73 and 0.76 for Band and Compton model, respectively, which is in good agreement with the theoretical expectation of Lu et al.. However, the inconsistency with their results is that the intrinsic spectra of most of bursts may bear the Comptonized or thermal synchrotron spectrum, rather than the Band spectrum. The relationships between the evolutionary slope and the spectral parameters are also checked. We show that the slope is correlated with E p of time-integrated spectra as well as the photon flux but anticorrelated with the lower energy index α. In addition, a correlation between the slope and the intrinsic E p derived by using the pseudo-redshift is also identified. The mechanisms of these correlations are unclear currently and the theoretical interpretations are required.

  13. Very high energy gamma ray astronomy from Hanle

    International Nuclear Information System (INIS)

    Chitnis, Varsha R.

    2015-01-01

    Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)

  14. Inverse Compton gamma-rays from pulsars

    International Nuclear Information System (INIS)

    Morini, M.

    1983-01-01

    A model is proposed for pulsar optical and gamma-ray emission where relativistic electrons beams: (i) scatter the blackbody photons from the polar cap surface giving inverse Compton gamma-rays and (ii) produce synchrotron optical photons in the light cylinder region which are then inverse Compton scattered giving other gamma-rays. The model is applied to the Vela pulsar, explaining the first gamma-ray pulse by inverse Compton scattering of synchrotron photons near the light cylinder and the second gamma-ray pulse partly by inverse Compton scattering of synchrotron photons and partly by inverse Compton scattering of the thermal blackbody photons near the star surface. (author)

  15. A correlation-based pulse detection technique for gamma-ray/neutron detectors

    International Nuclear Information System (INIS)

    Faisal, Muhammad; Schiffer, Randolph T.; Flaska, Marek; Pozzi, Sara A.; Wentzloff, David D.

    2011-01-01

    We present a correlation-based detection technique that significantly improves the probability of detection for low energy pulses. We propose performing a normalized cross-correlation of the incoming pulse data to a predefined pulse template, and using a threshold correlation value to trigger the detection of a pulse. This technique improves the detector sensitivity by amplifying the signal component of incoming pulse data and rejecting noise. Simulation results for various different templates are presented. Finally, the performance of the correlation-based detection technique is compared to the current state-of-the-art techniques.

  16. FERMI-LAT DETECTION OF PULSED GAMMA-RAYS ABOVE 50 GeV FROM THE VELA PULSAR

    Energy Technology Data Exchange (ETDEWEB)

    Leung, Gene C. K.; Takata, J.; Ng, C. W.; Cheng, K. S. [Department of Physics, The University of Hong Kong, Pokfulam Road (Hong Kong); Kong, A. K. H.; Tam, P. H. T. [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu, Taiwan (China); Hui, C. Y., E-mail: gene930@connect.hku.hk, E-mail: takata@hku.hk [Department of Astronomy and Space Science, Chungnam National University, Daejeon (Korea, Republic of)

    2014-12-20

    The first Fermi-Large Area Telescope (LAT) catalog of sources above 10 GeV reported evidence of pulsed emission above 25 GeV from 12 pulsars, including the Vela pulsar, which showed evidence of pulsation at >37 GeV energy bands. Using 62 months of Fermi-LAT data, we analyzed the gamma-ray emission from the Vela pulsar and searched for pulsed emission above 50 GeV. Having confirmed the significance of the pulsation in 30-50 GeV with the H test (p-value ∼10{sup –77}), we extracted its pulse profile using the Bayesian block algorithm and compared it with the distribution of the five observed photons above 50 GeV using the likelihood ratio test. Pulsation was significantly detected for photons above 50 GeV with a p-value of =3 × 10{sup –5} (4.2σ). The detection of pulsation is significant above 4σ at >79 GeV and above 3σ at >90 GeV energy bands, making this the highest energy pulsation significantly detected by the LAT. We explore the non-stationary outer gap scenario of the very high-energy emissions from the Vela pulsar.

  17. Parallel processing method for high-speed real time digital pulse processing for gamma-ray spectroscopy

    International Nuclear Information System (INIS)

    Fernandes, A.M.; Pereira, R.C.; Sousa, J.; Neto, A.; Carvalho, P.; Batista, A.J.N.; Carvalho, B.B.; Varandas, C.A.F.; Tardocchi, M.; Gorini, G.

    2010-01-01

    A new data acquisition (DAQ) system was developed to fulfil the requirements of the gamma-ray spectrometer (GRS) JET-EP2 (joint European Torus enhancement project 2), providing high-resolution spectroscopy at very high-count rate (up to few MHz). The system is based on the Advanced Telecommunications Computing Architecture TM (ATCA TM ) and includes a transient record (TR) module with 8 channels of 14 bits resolution at 400 MSamples/s (MSPS) sampling rate, 4 GB of local memory, and 2 field programmable gate array (FPGA) able to perform real time algorithms for data reduction and digital pulse processing. Although at 400 MSPS only fast programmable devices such as FPGAs can be used either for data processing and data transfer, FPGA resources also present speed limitation at some specific tasks, leading to an unavoidable data lost when demanding algorithms are applied. To overcome this problem and foreseeing an increase of the algorithm complexity, a new digital parallel filter was developed, aiming to perform real time pulse processing in the FPGAs of the TR module at the presented sampling rate. The filter is based on the conventional digital time-invariant trapezoidal shaper operating with parallelized data while performing pulse height analysis (PHA) and pile up rejection (PUR). The incoming sampled data is successively parallelized and fed into the processing algorithm block at one fourth of the sampling rate. The following data processing and data transfer is also performed at one fourth of the sampling rate. The algorithm based on data parallelization technique was implemented and tested at JET facilities, where a spectrum was obtained. Attending to the observed results, the PHA algorithm will be improved by implementing the pulse pile up discrimination.

  18. Gamma-rays generated from plasmas in the interaction of solid targets with femtosecond laser pulses

    International Nuclear Information System (INIS)

    He Jingtang; Zhang Ping; Chen Duanbao; Li Zuhao; Tang Xiaowei; Zhang Ying; Wang Long; Feng Baohua; Zhang Xiulan; Wei Zhiyi; Li Zanliang; Zhang Jie

    1998-01-01

    The γ-rays with energies up to 300 keV have been observed from plasmas produced by femtosecond laser pulses at a focused intensity of 5 x 10 15 W·cm -2 ·μm 2 irradiating Ta, Mo and Cu targets. By introducing an 8% prepulse of 70 ps before the main pulse, the fraction of high energy γ-ray photons (hν>100 keV) was significantly enhanced relative to low energy photons (hν<100 keV)

  19. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  20. Digital pulse shape discrimination between fast neutrons and gamma rays with para-terphenyl scintillator

    Science.gov (United States)

    Chepurnov, A. S.; Kirsanov, M. A.; Klenin, A. A.; Klimanov, S. G.; Kubankin, A. S.

    2017-12-01

    In the presented work, we investigated several digital methods of a discrimination signals from fast neutrons and gamma quanta. The experimental setup consists of a Pu-Be neutron source, a scintillation detector with an organic para-terphenyl monocrystal, and a digitizer (CAEN DT5730, 500 MS/s). Mixed waveform sequences were stored and then separated by pulse shape. Four methods were used for signals separation. Comparison of the traditional and the new methods of Figure of Merit (FOM) calculation is given. FOM = 1.5 was obtained in our setup for the minimum threshold value. A scintillation detector with a para-terphenyl crystal was used to measure neutron yield in the neutron generator with carbon nanotubes.

  1. Gamma ray generator

    Science.gov (United States)

    Firestone, Richard B; Reijonen, Jani

    2014-05-27

    An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.

  2. Fermi LAT Detection of Pulsed Gamma-Rays From the Vela-Like Pulsars PSR J1048-5832 and PSR J2229+6114

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A.A.; /Naval Research Lab, Wash., D.C. /Federal City Coll.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U. /Stockholm U., OKC; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Baring, M.G.; /Rice U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /INFN, Perugia /Perugia U. /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U. /Stockholm U., OKC /INFN, Trieste /Bari U. /INFN, Bari /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Montpellier U. /Bari U. /INFN, Bari /INFN, Trieste /Arecibo Observ. /Hiroshima U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Bari U. /INFN, Bari /INFN, Bari /NASA, Goddard /Maryland U. /INFN, Perugia /Perugia U.; /more authors..

    2012-03-29

    We report the detection of {gamma}-ray pulsations ({ge}0.1 GeV) from PSR J2229+6114 and PSR J1048-5832, the latter having been detected as a low-significance pulsar by EGRET. Data in the {gamma}-ray band were acquired by the Large Area Telescope (LAT) aboard the Fermi Gamma-ray Space Telescope, while the radio rotational ephemerides used to fold the {gamma}-ray light curves were obtained using the Green Bank Telescope, the Lovell telescope at Jodrell Bank, and the Parkes Telescope. The two young radio pulsars, located within the error circles of the previously unidentified EGRET sources 3EG J1048-5840 and 3EG J2227+6122, present spin-down characteristics similar to the Vela pulsar. PSR J1048-5832 shows two sharp peaks at phases 0.15 {+-} 0.01 and 0.57 {+-} 0.01 relative to the radio pulse confirming the EGRET light curve, while PSR J2229+6114 presents a very broad peak at phase 0.49 {+-} 0.01. The {gamma}-ray spectra above 0.1 GeV of both pulsars are fit with power laws having exponential cutoffs near 3 GeV, leading to integral photon fluxes of (2.19 {+-} 0.22 {+-} 0.32) x 10{sup -7} cm{sup -2} s{sup -1} for PSR J1048-5832 and (3.77 {+-} 0.22 {+-} 0.44) x 10{sup -7} cm{sup -2} s{sup -1} for PSR J2229+6114. The first uncertainty is statistical and the second is systematic. PSR J1048-5832 is one of the two LAT sources which were entangled together as 3EG J1048-5840. These detections add to the growing number of young {gamma}-ray pulsars that make up the dominant population of GeV {gamma}-ray sources in the Galactic plane.

  3. Search for pulsed gamma rays of approx.1013 eV from NP 0532

    International Nuclear Information System (INIS)

    Erickson, R.A.; Fickle, R.K.; Lamb, R.C.

    1976-01-01

    A ground-based Cerenkov light receiver located near Ames, Iowa, was aimed at the Crab Nebula during five nights of 1975 February and March to search for γ-ray emission from NP 0532. The time distribution of detected events shows no evidence for pulsation at either the main peak or interpulse phases. Data from one of the five nights show a statistically significant level of activity as determined by a X 2 test, incompatible with events random in time at less than the 1 percent level. This result and data from neighboring nights suggest the existence of a high-energy (approximately-greater-than2 x 10 13 eV) flux, variable on a time scale less than a day, which is not at the main or interpulse phases. The pulsed photon intensity averaged over all five nights is: I (approximately-greater-than2 x 10 13 eV) =1.2(+1.4, -0.9) x 10 12 photons cm -2 s -1

  4. Comparative study of neutron and gamma-ray pulse shape discrimination of anthracene, stilbene, and p-terphenyl

    International Nuclear Information System (INIS)

    Yanagida, Takayuki; Watanabe, Kenichi; Fujimoto, Yutaka

    2015-01-01

    Solid state organic scintillators, such as anthracene, stilbene, and p-terphenyl were investigated on their basic scintillation properties and neutron–gamma discrimination capabilities. Scintillation wavelengths under X-ray irradiation of anthracene, stilbene, and p-terphenyl were 445–525, 400–500, and 350–450 nm, respectively. Scintillation light yields of anthracene, stilbene, and p-terphenyl under 137 Cs gamma-ray irradiation were 20100, 16000, and 19400 ph/MeV, respectively. Neutron and gamma-ray events discrimination capabilities were examined and anthracene exhibited the best figure of merit among three organic scintillators

  5. Comparative study of neutron and gamma-ray pulse shape discrimination of anthracene, stilbene, and p-terphenyl

    Energy Technology Data Exchange (ETDEWEB)

    Yanagida, Takayuki, E-mail: yanagida@lsse.kyutech.ac.jp [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu, Kitakyushu, Fukuoka 808-0196 (Japan); Watanabe, Kenichi [Nagoya University, Furocho, Chikusa, Nagoya 464-8603 (Japan); Fujimoto, Yutaka [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu, Kitakyushu, Fukuoka 808-0196 (Japan)

    2015-06-01

    Solid state organic scintillators, such as anthracene, stilbene, and p-terphenyl were investigated on their basic scintillation properties and neutron–gamma discrimination capabilities. Scintillation wavelengths under X-ray irradiation of anthracene, stilbene, and p-terphenyl were 445–525, 400–500, and 350–450 nm, respectively. Scintillation light yields of anthracene, stilbene, and p-terphenyl under {sup 137}Cs gamma-ray irradiation were 20100, 16000, and 19400 ph/MeV, respectively. Neutron and gamma-ray events discrimination capabilities were examined and anthracene exhibited the best figure of merit among three organic scintillators.

  6. THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    OpenAIRE

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.

    2012-01-01

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...

  7. Pulse discrimination of background and gamma-ray source by digital pulse shape discrimination in a BF3 detector

    International Nuclear Information System (INIS)

    Kim, Jinhyung; Kim, J. H.; Choi, H. D.

    2014-01-01

    As a representative method of non-destructive assay, accurate neutron measurement is difficult due to large background radiation such as γ-ray, secondary radiation, spurious pulse, etc. In a BF 3 detector, the process of signal generation is different between neutron and other radiations. As the development of detection technique, all of signal data can be digitized by digital measurement method. In the previous study, Applied Nuclear Physics Group in Seoul National University has developed digital Pulse Shape Discrimination (PSD) method using digital oscilloscope. In this study, optimization of parameters for pulse discrimination is discussed and γ-ray region is determined by measuring 60 Co source. The background signal of BF 3 detector is discriminated by digital PSD system. Parameters for PSD are optimized through FOM calculation. And the γ-ray region is determined by measuring 60 Co source. In the future, the performance of developed system will be tested in low and high intensity neutron field

  8. A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514

    OpenAIRE

    Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.

    2005-01-01

    The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...

  9. Energy resolution and throughput of a new real time digital pulse processing system for x-ray and gamma ray semiconductor detectors

    International Nuclear Information System (INIS)

    Abbene, L; Gerardi, G; Raso, G; Brai, M; Principato, F; Basile, S

    2013-01-01

    New generation spectroscopy systems have advanced towards digital pulse processing (DPP) approaches. DPP systems, based on direct digitizing and processing of detector signals, have recently been favoured over analog pulse processing electronics, ensuring higher flexibility, stability, lower dead time, higher throughput and better spectroscopic performance. In this work, we present the performance of a new real time DPP system for X-ray and gamma ray semiconductor detectors. The system is based on a commercial digitizer equipped with a custom DPP firmware, developed by our group, for on-line pulse shape and height analysis. X-ray and gamma ray spectra measurements with cadmium telluride (CdTe) and germanium (Ge) detectors, coupled to resistive-feedback preamplifiers, highlight the excellent performance of the system both at low and high rate environments (up to 800 kcps). A comparison with a conventional analog electronics showed the better high-rate capabilities of the digital approach, in terms of energy resolution and throughput. These results make the proposed DPP system a very attractive tool for both laboratory research and for the development of advanced detection systems for high-rate-resolution spectroscopic imaging, recently proposed in diagnostic medicine, industrial imaging and security screening

  10. PULSED VERY HIGH ENERGY γ-RAY EMISSION CONSTRAINTS FOR PSR B1951+32 FROM STACEE OBSERVATIONS

    International Nuclear Information System (INIS)

    Zweerink, J.; Ball, J.; Carson, J. E.; Jarvis, A.; Ong, R. A.; Kildea, J.; Hanna, D. S.; Lindner, T.; Mueller, C.; Ragan, K.; Covault, C. E.; Driscoll, D. D.; Fortin, P.; Mukherjee, R.; Gingrich, D. M.; Williams, D. A.

    2009-01-01

    The Solar Tower Atmospheric Cherenkov Effect Experiment (STACEE) is a ground-based telescope that uses the wave-front-sampling technique to detect very high energy (VHE) gamma rays. STACEE's sensitivity in the energy range near 100 GeV permits useful observations of pulsars with the potential to discriminate between various proposed mechanisms for pulsed gamma-ray emission. Based on the 11.3 hr of data taken during the 2005 and 2006 observing seasons, we derive an upper limit on the pulsed gamma-ray emission from PSR B1951+32 of -11 photons cm -2 s -1 above an energy threshold of 117 GeV.

  11. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Fichtel, C.E.

    1975-01-01

    The first certain detection of celestial high energy gamma rays came from a satellite experiment flown on the third Orbiting Solar Observatory (OSO-111). A Gamma ray spark chamber telescope with substantively greater sensitivity and angular resolution (a few degrees) flown on the second Small Astronomy Satellite (SAS-II) has now provided a better picture of the gamma ray sky, and particularly the galactic plane and pulsars. This paper will summarize the present picture of gamma ray astronomy as it has developed at this conference from measurements made with experiments carried out on balloons, those remaining on the ground, and ones flown on satellites. (orig.) [de

  12. Development of a computer program to determine the pulse-height distribution in a gamma-ray detector from an arbitrary geometry source -feasibility study

    International Nuclear Information System (INIS)

    Currie, G.D.; Marshall, M.

    1989-03-01

    The feasibility of developing a computer program suitable for evaluating the pulse-height spectrum in a gamma-ray detector from a complex geometry source has been examined. A selection of relevant programs, Monte Carlo radiation transport codes, have been identified and their applicability to this study discussed. It is proposed that the computation be performed in two parts: the evaluation of the photon fluence at the detector using a photon transport code, and calculation of the pulse-height distribution from this spectrum using response functions determined with an electron-photon transport code. The two transport codes selected to perform this procedure are MCNP (Monte Carlo Neutron Photon code), and EGS4 (Electron Gamma Shower code). (Author)

  13. Influence of sampling properties of fast-waveform digitizers on neutron−gamma-ray, pulse-shape discrimination for organic scintillation detectors

    International Nuclear Information System (INIS)

    Flaska, Marek; Faisal, Muhammad; Wentzloff, David D.; Pozzi, Sara A.

    2013-01-01

    One of the most important questions to be answered with regard to digital pulse-shape discrimination (PSD) systems based on organic scintillators is: What sampling properties are required for a fast-waveform digitizer used for digitizing neutron/gamma-ray pulses, while an accurate PSD is desired? Answering this question is the main objective of this paper. Specifically, the paper describes the influence of the resolution and sampling frequency of a waveform digitizer on the PSD performance of organic scintillators. The results presented in this paper are meant to help the reader choosing a waveform digitizer with appropriate bit resolution and sampling frequency. The results presented here show that a 12-bit, 250-MHz digitizer is a good choice for applications that require good PSD performance. However, when more accurate PSD performance is the main requirement, this paper presents PSD figures of merit to qualify the impact of further increasing either sampling frequency or resolution of the digitizer

  14. Exploring the extreme gamma-ray sky with HESS

    International Nuclear Information System (INIS)

    Sol, Helene

    2006-01-01

    The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond

  15. Gamma-ray sources

    International Nuclear Information System (INIS)

    Hermsen, W.

    1980-01-01

    Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)

  16. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Hillier, R.

    1984-01-01

    The book reviews the development of gamma ray astronomy over the past twenty five years. A large section of the book is devoted to the problems of background radiation and the design of detectors. Gamma rays from the sun, the galactic disc, the galaxy, and extra galactic sources; are also discussed. (U.K.)

  17. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  18. Programme in Basic-Applesoft language for microcomputer to analyse pulse spectra from a high-resolution gamma ray system

    International Nuclear Information System (INIS)

    Nascimento Filho, V.F. do; Marques, D.A.; Pessenda, L.C.R.; Barros Ferraz, E.S. de; Nadai, E.A. de; Sao Paulo Univ., Piracicaba

    1988-01-01

    A programme in BASIC-Applesoft language has been developed for low cost microcomputer to analyze spectra from a high-resolution gamma-ray system (high-purity germanium and 4096 channels analyzer). Data is received by the microcomputer directly from analyzer (4 min) or keyboard and shown on video (4 min) or printed (9,7 min). Graphics of parts of the spectrum can be either shown on video (a cursor is used to identify peaks) or printed. The peak search, centroid, energy, net photopeak area, standard deviation and relative standard deviation are included in the programme (5 min), besides filing of data in flexible disk (1,3 min). The programme was used on a 12 h real-time detection in Marinelli beaker of 1265 g sandy soil sample (Ref-Yellow Latosol, 0-3 cm layer). Thirty-one peaks from U-238 and Th-232 daughters were analyzed (rsd less than 20%), besides natural K-40 and artificial Cs-137, from fallout. (author) [pt

  19. Basics of Gamma Ray Detection

    Energy Technology Data Exchange (ETDEWEB)

    Stinnett, Jacob [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Venkataraman, Ram [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-09-13

    The objective of this training is to explain the origin of x-rays and gamma rays, gamma ray interactions with matter, detectors and electronics used in gamma ray-spectrometry, and features of a gamma-ray spectrum for nuclear material that is safeguarded.

  20. VERITAS OBSERVATIONS OF GAMMA-RAY BURSTS DETECTED BY SWIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Errando, M.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Collins-Hughes, E.; Cesarini, A.; Connolly, M. P.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.

    2011-01-01

    We present the results of 16 Swift-triggered Gamma-ray burst (GRB) follow-up observations taken with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) telescope array from 2007 January to 2009 June. The median energy threshold and response time of these observations were 260 GeV and 320 s, respectively. Observations had an average duration of 90 minutes. Each burst is analyzed independently in two modes: over the whole duration of the observations and again over a shorter timescale determined by the maximum VERITAS sensitivity to a burst with a t –1.5 time profile. This temporal model is characteristic of GRB afterglows with high-energy, long-lived emission that have been detected by the Large Area Telescope on board the Fermi satellite. No significant very high energy (VHE) gamma-ray emission was detected and upper limits above the VERITAS threshold energy are calculated. The VERITAS upper limits are corrected for gamma-ray extinction by the extragalactic background light and interpreted in the context of the keV emission detected by Swift. For some bursts the VHE emission must have less power than the keV emission, placing constraints on inverse Compton models of VHE emission.

  1. Use of delayed gamma rays for active non-destructive assay of {sup 235}U irradiated by pulsed neutron source (plasma focus)

    Energy Technology Data Exchange (ETDEWEB)

    Andola, Sanjay; Niranjan, Ram [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kaushik, T.C., E-mail: tckk@barc.gov.in [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Rout, R.K. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kumar, Ashwani; Paranjape, D.B.; Kumar, Pradeep; Tomar, B.S.; Ramakumar, K.L. [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Gupta, S.C. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2014-07-01

    A pulsed neutron source based on plasma focus device has been used for active interrogation and assay of {sup 235}U by monitoring its delayed high energy γ-rays. The method involves irradiation of fissile material by thermal neutrons obtained after moderation of a burst of neutrons emitted upon fusion of deuterium in plasma focus (PF) device. The delayed gamma rays emitted from the fissile material as a consequence of induced fission were detected by a large volume sodium iodide (NaI(Tl)) detector. The detector is coupled to a data acquisition system of 2k input size with 2k ADC conversion gain. Counting was carried out in pulse height analysis mode for time integrated counts up to 100 s while the temporal profile of delayed gamma has been obtained by counting in multichannel scaling mode with dwell time of 50 ms. To avoid the effect of passive (natural) and active (from surrounding materials) backgrounds, counts have been acquired for gamma energy between 3 and 10 MeV. The lower limit of detection of {sup 235}U in the oxide samples with this set-up is estimated to be 14 mg.

  2. Pulse height non-linearity in LaBr3:Ce crystal for gamma ray spectrometry and imaging

    International Nuclear Information System (INIS)

    Pani, R.; Cinti, M.N.; Pellegrini, R.; Bennati, P.; Ridolfi, S.; Scafe, R.; Orsolini Cencelli, V.; De Notaristefani, F.; Fabbri, A.; Navarria, F.L.; Lanconelli, N.; Moschini, G.; Boccaccio, P.

    2011-01-01

    In this paper the response in term of pulse height linearity of two Hamamatsu photomultipliers is investigated, when coupled to a LaBr 3 :Ce scintillation crystal. The two photodetectors have high quantum efficiency and in particular 30% for R6231-01 and 42% for R7600-200 tube. The substantial difference is in the dynode structure, linear focused and metal channel for R6231 and R7600 respectively. In this work in order to verify the non-linearity effects on the pulse height distribution, due principally to the high and fast light production of LaBr 3 :Ce scintillator, we propose a 'peak by peak' procedure to calibrate the pulse height distribution. Utilizing a specific fragmentation of the calibration curve in subsets, the calculated energy values are very similar for both PMTs. This result confirmed the potentiality of the procedure to highlight the non-linearity effects on pulse height distribution.

  3. Gamma-ray lasers or grasers

    International Nuclear Information System (INIS)

    Wilson, G.V.H.; George, E.P.; Hora, H.

    1976-01-01

    A method is described for controlling the emission and direction of gamma rays from excited nuclei contained in a sample source of suitable geometry having its major axis parallel to the proposed direction of gamma ray emission, comprising subjecting said sample source to thermal or dynamic polarization at temperatures approaching absolute zero in the presence of a strong magnetic field, and when a pulse of coherent gamma radiation is required along said major axis rotating the active nuclei through 90 0 by employing a short pulse of radio frequency oscillations in an auxilliary coil around the sample source

  4. Gamma-Ray Bursts

    Science.gov (United States)

    Pellizza, L. J.

    Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH

  5. Gamma Ray Bursts

    Science.gov (United States)

    Gehrels, Neil; Meszaros, Peter

    2012-01-01

    Gamma-ray bursts (GRBs) are bright flashes of gamma-rays coming from the cosmos. They occur roughly once per day ,last typically lOs of seconds and are the most luminous events in the universe. More than three decades after their discovery, and after pioneering advances from space and ground experiments, they still remain mysterious. The launch of the Swift and Fermi satellites in 2004 and 2008 brought in a trove of qualitatively new data. In this review we survey the interplay between these recent observations and the theoretical models of the prompt GRB emission and the subsequent afterglows.

  6. Pulser injection with subsequent removal for gamma-ray spectrometry

    International Nuclear Information System (INIS)

    Hartwell, J.K.; Goodwin, S.G.; Johnson, L.O.; Killian, E.W.

    1990-01-01

    This patent describes a module for use with a gamma-ray spectroscopy system. The system includes a gamma-ray detector for detecting gamma-ray events and producing a signal representing the gamma-ray events, a converter responsive to the detector and capable of converting the signal to a spectrum, a storage memory responsive to the converter and capable of storing the spectrum at address locations in memory, and a pulser capable of injecting pulses into the signal produced by the detector. The module comprises: means for generating a logic pulse for controlling the pulser, the controlling means adapted for coupling to the pulser; means for generating separation of events logic to isolate the components of a combined gamma-ray---pulse spectrum, the separation of events logic means adapted for coupling to the converter and the storage memory with the capability of storing pulses at address locations in the storage memory separate from the gamma-ray events; means for receiving an imitating signal from the converter to generate a plurality of operations by the module; means for tracking variations in a gamma-ray---pulse spectrum brought on by external parameter changes; and means for interfacing with commercially developed gamma-ray spectrometry equipment

  7. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Broomhead, Laurent.

    1980-01-01

    The nuclear gamma astronomy is presented, in particular the Gamma Ray Observatory, an enormous eight tonnes machine fitted with gamma telescopes, scheduled for launching around 1985. It is thereby hoped to study the natural nuclear reactions which occur when stars explode [fr

  8. Gamma ray calibration system

    International Nuclear Information System (INIS)

    Rosauer, P.J.; Flaherty, J.J.

    1981-01-01

    This invention is in the field of gamma ray inspection devices for tubular products and the like employing an improved calibrating block which prevents the sensing system from being overloaded when no tubular product is present, and also provides the operator with a means for visually detecting the presence of wall thicknesses which are less than a required minimum. (author)

  9. A pulse shape discriminator with high precision of neutron and gamma ray selection at high counting rate

    International Nuclear Information System (INIS)

    Bialkowski, J.; Moszynski, M.; Wolski, D.

    1989-01-01

    A pulse shape discriminator based on the zero-crossing principle is described. Due to dc negative feedback loops stabilizing the shaping amplifier and the zero-crossing discriminator, the working of the circuit is not affected by the high counting rate and the temperature variations. The pileup rejection circuit built into the discriminator improves the quality of the n-γ separation at high counting rates. A full γ-ray rejection is obtained for a recoil energy of electrons down to 25 keV. At high counting rates the remaining γ-ray contribution is evidently due to the pileup effect which is equal to about 2% at 4x10 5 counts/s. (orig.)

  10. Gamma-ray bursts observed by the INTEGRAL-SPI anticoincidence shield: A study of individual pulses and temporal variability

    DEFF Research Database (Denmark)

    Ryde, F.; Borgonovo, L.; Larsson, S.

    2003-01-01

    self-similar in shape. There is also a weak tendency for the pulses with steep power-law decays to be more asymmetric. Third, the variability of the complex light-curves is studied by analyzing their power-density-spectra (PDS) and their RMS variability. The averaged PDS, of the whole sample......, is a power-law with index of 1.60+/-0.05 and a break between 1-2 Hz. Fourth, we also discuss the background and noise levels. We found that the background noise has a Gaussian distribution and its power is independent of frequency, i.e., it is white noise. However, it does not follow a Poisson statistic...

  11. Dosimetry of steady-state gamma rays or pulsed X rays using liquid-core optical waveguides

    International Nuclear Information System (INIS)

    Radak, B.B.; McLaughlin, W.L.; Simic, M.G.; Warasawas, W.

    1987-01-01

    A liquid-core optical waveguide (OWG) sensor of ionizing radiation can be used for dosimetry over broad absorbed-dose ranges, by means of a relatively simple experimental arrangement. The analyzing visible light from one of several narrow wavelength-band sources at the proximal end of the OWG is propagated efficiently through a tightly coiled waveguide containing a radiochromic solution. This solution constitutes the sensor and attenuates the measuring light according to the simple Beer-Lambert relationship, where increases in the optical absorbance, measured photometrically at the distal end of the OWG, are proportional to the concentrations of the radiation-induced absorbing species (dye molecules), which in turn are proportional to the absorbed dose in the sensor. When the analyzing light is of broad spectral distribution, the absorbance vs dose relationship becomes sublinear. The apparatus may be adapted either to the spectrophotometric measurement of absorbed dose rate or integrated absorbed dose during gamma radiolysis or to dosimetry in the pulse radiolysis or flash photolysis of radiation-stimulated chromophores. The OWG principle works with any transparent liquid or gel sensor held as the core material of a flexible plastic tubing, whose refractive index is less than that of the light-propagating core. (author)

  12. CO2·- radical induced cleavage of disulfide bonds in proteins. A gamma-ray and pulse radiolysis mechanistic investigation

    International Nuclear Information System (INIS)

    Favaudon, V.; Tourbez, H.; Lhoste, J-M.; Houee-Levin, C.

    1990-01-01

    Disulfide bond reduction by the CO 2 ·- radical was investigated in aponeocarzinostatin, aporiboflavin-binding protein, and bovine immunoglobulin. Protein-bound cysteine free thiols were formed under γ-ray irradiation in the course of a pH-dependent and protein concentration dependent chain reaction. The chain efficiency increased upon acidification of the medium, with an apparent pK a around 5, and decreased abruptly below pH 3.6. It decreased also at neutral pH as cysteine accumulated. From pulse radiolysis analysis, CO 2 ·- proved able to induce rapid one-electron oxidation of thiols and of tyrosine phenolic groups in addition to one-electron donation to exposed disulfide bonds. The bulk rate constant of CO 2 ·- uptake by the native proteins was 5- to 10-fold faster at pH 3 than at pH 8, and the protonated form of the disulfide radical anion, appeared to be the major protein radical species formed under acidic conditions. Formation of the disulfide radical cation, phenoxyl radical Tyr-O · disproportionation, and phenoxyl radical induced oxidation of preformed thiol groups should also be taken into consideration to explain the fate of the oxygen-centered phenoxyl radical

  13. Gamma ray emission from pulsars

    International Nuclear Information System (INIS)

    Salvati, M.; Massaro, E.

    1978-01-01

    A model for the production of gamma rays in a pulsar environment is presented, together with numerical computations fitted to the observations of PSR 0833-45. It is assumed that the primary particles are accelerated close to the star surface and then injected along the open field lines, which cause them to emit curvature radiation. The equation describing the particles' braking is integrated exactly up to the first order in the pulsar rotational frequency, and the transfer problem for the curvature photons is solved with the aberration, the Doppler shif, and the pair production absorption being taken into account. The latter effect is due not only to the transverse component of the magnetic field, but also to the electric field induced by the rotation. The synchrotron radiation emitted by the secondary particles is also included, subject to the 'on-the-spot' approximation. It is found that the observed gamma rays originate in the innermost regions of the magnetosphere, where the open lines' bundle is narrow and the geometrical beaming is effective. As shown by the computed pulse profiles, the duty cycle turns out to be equal to a few percent, comparable to the one of PSR 0833-45. The averaged spectra indicate that a substantial fraction of the primary photons do outlive the interaction with the magnetisphere; furthermore, the agreement in shape with the observational curves suggests that the acceleration output is fiarly close to a monoenergetic beam of particles. (orig.) [de

  14. Event-sequence time series analysis in ground-based gamma-ray astronomy

    International Nuclear Information System (INIS)

    Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.

    2008-01-01

    The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.

  15. Gamma ray energy tracking in GRETINA

    Science.gov (United States)

    Lee, I. Y.

    2011-10-01

    The next generation of stable and exotic beam accelerators will provide physics opportunities to study nuclei farther away from the line of stability. However, these experiments will be more demanding on instrumentation performance. These come from the lower production rate for more exotic beams, worse beam impurities, and large beam velocity from the fragmentation and inverse reactions. Gamma-ray spectroscopy will be one of the most effective tools to study exotic nuclei. However, to fully exploit the physics reach provided by these new facilities, better gamma-ray detector will be needed. In the last 10 years, a new concept, gamma-ray energy tracking array, was developed. Tracking arrays will increase the detection sensitivity by factors of several hundred compared to current arrays used in nuclear physics research. Particularly, the capability of reconstructing the position of the interaction with millimeters resolution is needed to correct the Doppler broadening of gamma rays emitted from high velocity nuclei. GRETINA is a gamma-ray tracking array which uses 28 Ge crystals, each with 36 segments, to cover ¼ of the 4 π of the 4 π solid angle. The gamma ray tracking technique requires detailed pulse shape information from each of the segments. These pulses are digitized using 14-bit 100 MHz flash ADCs, and digital signal analysis algorithms implemented in the on-board FPGAs provides energy, time and selection of pulse traces. A digital trigger system, provided flexible trigger functions including a fast trigger output, and also allows complicated trigger decisions to be made up to 20 microseconds. Further analyzed, carried out in a computer cluster, determine the energy, time, and three-dimensional positions of all gamma-ray interactions in the array. This information is then utilized, together with the characteristics of Compton scattering and pair-production processes, to track the scattering sequences of the gamma rays. GRETINA construction is completed in

  16. Gamma-ray bursts

    CERN Document Server

    Wijers, Ralph A M J; Woosley, Stan

    2012-01-01

    Cosmic gamma ray bursts (GRBs) have fascinated scientists and the public alike since their discovery in the late 1960s. Their story is told here by some of the scientists who participated in their discovery and, after many decades of false starts, solved the problem of their origin. Fourteen chapters by active researchers in the field present a detailed history of the discovery, a comprehensive theoretical description of GRB central engine and emission models, a discussion of GRB host galaxies and a guide to how GRBs can be used as cosmological tools. Observations are grouped into three sets from the satellites CGRO, BeppoSAX and Swift, and followed by a discussion of multi-wavelength observations. This is the first edited volume on GRB astrophysics that presents a fully comprehensive review of the subject. Utilizing the latest research, Gamma-ray Bursts is an essential desktop companion for graduate students and researchers in astrophysics.

  17. Gamma ray camera

    International Nuclear Information System (INIS)

    Wang, S.-H.; Robbins, C.D.

    1979-01-01

    An Anger gamma ray camera is improved by the substitution of a gamma ray sensitive, proximity type image intensifier tube for the scintillator screen in the Anger camera. The image intensifier tube has a negatively charged flat scintillator screen, a flat photocathode layer, and a grounded, flat output phosphor display screen, all of which have the same dimension to maintain unit image magnification; all components are contained within a grounded metallic tube, with a metallic, inwardly curved input window between the scintillator screen and a collimator. The display screen can be viewed by an array of photomultipliers or solid state detectors. There are two photocathodes and two phosphor screens to give a two stage intensification, the two stages being optically coupled by a light guide. (author)

  18. gamma. -ray. Present status and problems

    Energy Technology Data Exchange (ETDEWEB)

    Okudaira, K [Rikkyo Univ., Tokyo (Japan). Faculty of Science

    1975-01-01

    As ..gamma..-ray advances straightly through space, the study on cosmic ..gamma..-ray will give the information concerning the origin directly. However, the intensity is weak, and the avoidance of background is a serious problem. The wide-spread components were studied by OSO-3. The intensity of the galactic disc component around 100 MeV was reported as (3.4+-1.0)x10/sup -5/ photons (cm/sup 2/, radian, sec)/sup -1/ by OSO-3 and 0.2x10/sup -4/ photons (cm/sup 2/, radian sec)/sup -1/ by SAS-2, and corresponds to the calculated ..gamma.. yield from ..pi../sup 0/. The strong disc component, so-called galactic center region, has been observed, and is due to the mixture of ..gamma..-ray from ..pi../sup 0/ and inverse Compton ..gamma..-ray. A peak at 476+-24 KeV was found as well as the continuous component. Special care must be taken for the observation of isotropic component, since it is hardly distinguished from the background. It is considered that the isotropic component is due to the inverse Compton scattering of 3/sup 0/K radiation in super-galactic space and the contribution from outer galaxy. The nearest point source of ..gamma..-ray is the sun. Among the other point sources, the crab nebula is the most reliable one. The energy flux of pulse component showed the spectrum of E/sup -1/. ..gamma..-ray bursts were observed by man-made satellites Vela-5 and 6. Theoretical explanation is still incomplete regarding the bursts. (Kato, T.).

  19. Lunar based gamma ray astronomy

    International Nuclear Information System (INIS)

    Haymes, R.C.

    1985-01-01

    Gamma ray astronomy represents the study of the universe on the basis of the electromagnetic radiation with the highest energy. Gamma ray astronomy provides a crucial tool for the understanding of astronomical phenomena, taking into account nucleosynthesis in supernovae, black holes, active galaxies, quasars, the sources of cosmic rays, neutron stars, and matter-antimatter annihilation. Difficulties concerning the conduction of studies by gamma ray astronomy are related to the necessity to perform such studies far from earth because the atmosphere is a source of gamma rays. Studies involving the use of gamma ray instruments in earth orbit have been conducted, and more gamma ray astronomy observations are planned for the future. Imperfections of studies conducted in low earth orbit could be overcome by estalishing an observatory on the moon which represents a satellite orbiting at 60 earth radii. Details concerning such an observatory are discussed. 5 references

  20. THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others

    2012-02-20

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL

  1. Very-high-energy gamma-ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    Science.gov (United States)

    Lopez-Coto, Ruben

    2015-07-01

    The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the

  2. Science with the Advanced Gamma Ray Imaging System (AGIS)

    Science.gov (United States)

    Coppi, Paolo

    2009-05-01

    We present the scientific drivers for the Advanced Gamma Ray Imaging System (AGIS), a concept for the next-generation ground- based gamma-ray experiment, comprised of an array of ˜100 imaging atmospheric Cherenkov telescopes. Design requirements for AGIS include achieving a sensitivity an order of magnitude better than the current generation of space or ground-based instruments in the energy range of 40 GeV to ˜100 TeV. We present here an overview of the scientific goals of AGIS, including the prospects for understanding VHE phenomena in the vicinity of accreting black holes, particle acceleration in a variety of astrophysical environments, indirect detection of dark matter, study of cosmological background radiation fields, and particle physics beyond the standard model.

  3. Gamma ray beam transmutation

    International Nuclear Information System (INIS)

    Imasaki, K.; Li, D.; Miyamoto, S.; Amano, S.; Motizuki, T.

    2007-01-01

    We have proposed a new approach to nuclear transmutation by a gamma ray beam of Compton scattered laser photon. We obtained 20 MeV gamma ray in this way to obtain transmutation rates with the giant resonance of 1 97Au and 1 29Iodine. The rate of the transmutation agreed with the theoretical calculation. Experiments on energy spectrum of positron, electron and neutron from targets were performed for the energy balance and design of the system scheme. The reaction rate was about 1.5∼4% for appropriate photon energies and neutron production rate was up to 4% in the measurements. We had stored laser photon more than 5000 times in a small cavity which implied for a significant improvement of system efficiency. Using these technologies, we have designed an actual transmutation system for 1 29Iodine which has a 16 million year's activity. In my presentation, I will address the properties of this scheme, experiments results and transmutation system for iodine transmutation

  4. TEV GAMMA-RAY OBSERVATIONS OF THE GALACTIC CENTER RIDGE BY VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Fleischhack, H. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Flinders, A. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Fortson, L., E-mail: asmith44@umd.edu [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); and others

    2016-04-20

    The Galactic Center ridge has been observed extensively in the past by both GeV and TeV gamma-ray instruments revealing a wealth of structure, including a diffuse component and the point sources G0.9+0.1 (a composite supernova remnant) and Sgr A* (believed to be associated with the supermassive black hole located at the center of our Galaxy). Previous very high energy (VHE) gamma-ray observations with the H.E.S.S. experiment have also detected an extended TeV gamma-ray component along the Galactic plane in the >300 GeV gamma-ray regime. Here we report on observations of the Galactic Center ridge from 2010 to 2014 by the VERITAS telescope array in the >2 TeV energy range. From these observations we (1) provide improved measurements of the differential energy spectrum for Sgr A* in the >2 TeV gamma-ray regime, (2) provide a detection in the >2 TeV gamma-ray emission from the composite SNR G0.9+0.1 and an improved determination of its multi-TeV gamma-ray energy spectrum, and (3) report on the detection of VER J1746-289, a localized enhancement of >2 TeV gamma-ray emission along the Galactic plane.

  5. Gamma-ray Emission from Globular Clusters

    Directory of Open Access Journals (Sweden)

    Pak-Hin T. Tam

    2016-03-01

    Full Text Available Over the last few years, the data obtained using the Large Area Telescope (LAT aboard the Fermi Gamma-ray Space Telescope has provided new insights on high-energy processes in globular clusters, particularly those involving compact objects such as MilliSecond Pulsars (MSPs. Gamma-ray emission in the 100 MeV to 10 GeV range has been detected from more than a dozen globular clusters in our galaxy, including 47 Tucanae and Terzan 5. Based on a sample of known gammaray globular clusters, the empirical relations between gamma-ray luminosity and properties of globular clusters such as their stellar encounter rate, metallicity, and possible optical and infrared photon energy densities, have been derived. The measured gamma-ray spectra are generally described by a power law with a cut-off at a few gigaelectronvolts. Together with the detection of pulsed γ-rays from two MSPs in two different globular clusters, such spectral signature lends support to the hypothesis that γ-rays from globular clusters represent collective curvature emission from magnetospheres of MSPs in the clusters. Alternative models, involving Inverse-Compton (IC emission of relativistic electrons that are accelerated close to MSPs or pulsar wind nebula shocks, have also been suggested. Observations at >100 GeV by using Fermi/LAT and atmospheric Cherenkov telescopes such as H.E.S.S.-II, MAGIC-II, VERITAS, and CTA will help to settle some questions unanswered by current data.

  6. The Advanced Gamma-Ray Imaging System (AGIS)

    Science.gov (United States)

    Otte, Nepomuk

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.

  7. Gamma Ray Bursts - Observations

    Science.gov (United States)

    Gehrels, N.; Cannizzo, J. K.

    2010-01-01

    We are in an exciting period of discovery for gamma-ray bursts. The Swift observatory is detecting 100 bursts per year, providing arcsecond localizations and sensitive observations of the prompt and afterglow emission. The Fermi observatory is observing 250 bursts per year with its medium-energy GRB instrument and about 10 bursts per year with its high-energy LAT instrument. In addition, rapid-response telescopes on the ground are providing new capabilities to study optical emission during the prompt phase and spectral signatures of the host galaxies. The combined data set is enabling great advances in our understanding of GRBs including afterglow physics, short burst origin, and high energy emission.

  8. A gamma-ray discriminating neutron scintillator

    International Nuclear Information System (INIS)

    Eschbach, P.A.; Miller, S.D.; Cole, M.C.

    1994-01-01

    A neutron scintillator has been developed at Pacific Northwest Laboratory which responds directly to as little as 10 mrem/hour dose equivalent rate fast neutron fields. The scintillator is composed of CaF 2 :Eu or of NaI grains within a silicone rubber or polystyrene matrix, respectively. Neutrons colliding with the plastic matrix provide knockon protons, which in turn deposit energy within the grains of phosphor to produce pulses of light. Neutron interactions are discriminated from gamma-ray events on the basis of pulse height. Unlike NE-213 liquid scintillators, this solid scintillator requires no pulseshape discrimination and therefore requires less hardware. Neutron events are anywhere from two to three times larger than the gamma-ray exposures are compared to 0.7 MeV gamma-ray exposures. The CaF 2 :Eu/silicone rubber scintillator is nearly optically transparent, and can be made into a very sizable detector (4 cm x 1.5 cm) without degrading pulse height. This CaF 2 :Eu scintillator has been observed to have an absolute efficiency of 0.1% when exposed to 5-MeV accelerator-generated neutrons (where the absolute efficiency is the ratio of observed neutron events divided by the number of fast neutrons striking the detector)

  9. Gamma-Ray Pulsars Models and Predictions

    CERN Document Server

    Harding, A K

    2001-01-01

    Pulsed emission from gamma-ray pulsars originates inside the magnetosphere, from radiation by charged particles accelerated near the magnetic poles or in the outer gaps. In polar cap models, the high energy spectrum is cut off by magnetic pair production above an energy that is dependent on the local magnetic field strength. While most young pulsars with surface fields in the range B = 10^{12} - 10^{13} G are expected to have high energy cutoffs around several GeV, the gamma-ray spectra of old pulsars having lower surface fields may extend to 50 GeV. Although the gamma-ray emission of older pulsars is weaker, detecting pulsed emission at high energies from nearby sources would be an important confirmation of polar cap models. Outer gap models predict more gradual high-energy turnovers at around 10 GeV, but also predict an inverse Compton component extending to TeV energies. Detection of pulsed TeV emission, which would not survive attenuation at the polar caps, is thus an important test of outer gap models. N...

  10. Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC

    Directory of Open Access Journals (Sweden)

    López-Coto Rubén

    2016-01-01

    Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.

  11. Apparatus for gamma ray radiography

    International Nuclear Information System (INIS)

    Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi

    1979-01-01

    This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)

  12. Applied gamma-ray spectrometry

    CERN Document Server

    Dams, R; Crouthamel, Carl E

    1970-01-01

    Applied Gamma-Ray Spectrometry covers real life application of the gamma-ray and the devices used in their experimental studies. This book is organized into 9 chapters, and starts with discussions of the various decay processes, the possible interaction mechanisms of gamma radiation with matter, and the intrinsic and extrinsic variables, which affect the observed gamma-ray and X-ray spectra. The subsequent chapters deal with the properties and fabrication of scintillation detectors, semiconductor detectors, and proportional gas counters. These chapters present some of the most widely utilized

  13. Gamma rays at airplane altitudes

    International Nuclear Information System (INIS)

    Iwai, J.; Koss, T.; Lord, J.; Strausz, S.; Wilkes, J.; Woosley, J.

    1990-01-01

    An examination of the gamma ray flux above 1 TeV in the atmosphere is needed to better understand the anomalous showers from point sources. Suggestions are made for future experiments on board airplanes

  14. $\\gamma$-Ray Pulsars: Emission Zones and Viewing Geometries

    OpenAIRE

    Romani, Roger W.; Yadigaroglu, I. -A.

    1994-01-01

    There are now a half dozen young pulsars detected in high energy photons by the Compton GRO, showing a variety of emission efficiencies and pulse profiles. We present here a calculation of the pattern of high energy emission on the sky in a model which posits $\\gamma$-ray production by charge depleted gaps in the outer magnetosphere. This model accounts for the radio to $\\gamma$-ray pulse offsets of the known pulsars, as well as the shape of the high energy pulse profiles. We also show that $...

  15. About cosmic gamma ray lines

    Science.gov (United States)

    Diehl, Roland

    2017-06-01

    Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.

  16. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  17. Cosmic gamma-ray burst

    International Nuclear Information System (INIS)

    Yamagami, Takamasa

    1985-01-01

    Ballon experiments for searching gamma-ray burst were carried out by employing rotating-cross modulation collimators. From a very long observation of total 315 hours during 1975 to 1979, three gamma-ray intensity anomalies were observed which were speculated as a gamma-ray burst. As for the first gamma-ray intensity anomaly observed in 1975, the burst source could be located precisely but the source, heavenly body, could not be specified. Gamma-ray burst source estimation was made by analyzing distribution of burst source in the celestial sphere, burst size distribution, and burst peak. Using the above-mentioned data together with previously published ones, apparent inconsistency was found between the observed results and the adopted theory that the source was in the Galaxy, and this inconsistency was found due to the different time profiles of the burst observed with instruments of different efficiency. It was concluded by these analysis results that employment of logN - logP (relation between burst frequency and burst count) was better than that of logN - logS (burst size) in the examination of gamma-ray burst because the former was less uncertain than the latter. Analyzing the author's observed gamma-ray burst data and the related published data, it was clarified that the burst distribution was almost P -312 for the burst peak value larger than 10 -6 erg/cm 2 .sec. The author could indicate that the calculated celestial distribution of burst source was consistent with the observed results by the derivation using the logN - logP relationship and that the burst larger than 10 -6 erg/cm 2 .sec happens about one thousand times a year, about ten times of the previous value. (Takagi, S.)

  18. Compton Gamma-Ray Observatory

    Science.gov (United States)

    1991-01-01

    This photograph shows the Compton Gamma-Ray Observatory (GRO) being deployed by the Remote Manipulator System (RMS) arm aboard the Space Shuttle Atlantis during the STS-37 mission in April 1991. The GRO reentered Earth atmosphere and ended its successful mission in June 2000. For nearly 9 years, the GRO Burst and Transient Source Experiment (BATSE), designed and built by the Marshall Space Flight Center (MSFC), kept an unblinking watch on the universe to alert scientists to the invisible, mysterious gamma-ray bursts that had puzzled them for decades. By studying gamma-rays from objects like black holes, pulsars, quasars, neutron stars, and other exotic objects, scientists could discover clues to the birth, evolution, and death of stars, galaxies, and the universe. The gamma-ray instrument was one of four major science instruments aboard the Compton. It consisted of eight detectors, or modules, located at each corner of the rectangular satellite to simultaneously scan the entire universe for bursts of gamma-rays ranging in duration from fractions of a second to minutes. In January 1999, the instrument, via the Internet, cued a computer-controlled telescope at Las Alamos National Laboratory in Los Alamos, New Mexico, within 20 seconds of registering a burst. With this capability, the gamma-ray experiment came to serve as a gamma-ray burst alert for the Hubble Space Telescope, the Chandra X-Ray Observatory, and major gound-based observatories around the world. Thirty-seven universities, observatories, and NASA centers in 19 states, and 11 more institutions in Europe and Russia, participated in the BATSE science program.

  19. Gamma-ray pulsars: Emission zones and viewing geometries

    Science.gov (United States)

    Romani, Roger W.; Yadigaroglu, I.-A.

    1995-01-01

    There are now a half-dozen young pulsars detected in high-energy photons by the Compton Gamma-Ray Observatory (CGRO), showing a variety of emission efficiencies and pulse profiles. We present here a calculation of the pattern of high-energy emission on the sky in a model which posits gamma-ray production by charge-depleted gaps in the outer magnetosphere. This model accounts for the radio to gamma-ray pulse offsets of the known pulsars, as well as the shape of the high-energy pulse profiles. We also show that about one-third of emitting young radio pulsars will not be detected due to beaming effects, while approximately 2.5 times the number of radio-selected gamma-ray pulsars will be viewed only high energies. Finally we compute the polarization angle variation and find that the previously misunderstood optical polarization sweep of the Crab pulsar arises naturally in this picture. These results strongly support an outer magnetosphere location for the gamma-ray emission.

  20. Extragalactic Gamma-Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...

  1. Terrestrial gamma-ray flashes

    Science.gov (United States)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo

    2013-08-01

    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models.

  2. Terrestrial gamma-ray flashes

    International Nuclear Information System (INIS)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo

    2013-01-01

    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models

  3. The Gamma-ray Sky with Fermi

    Science.gov (United States)

    Thompson, David

    2012-01-01

    Gamma rays reveal extreme, nonthermal conditions in the Universe. The Fermi Gamma-ray Space Telescope has been exploring the gamma-ray sky for more than four years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge gamma-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  4. Gamma-ray burst spectra

    International Nuclear Information System (INIS)

    Teegarden, B.J.

    1982-01-01

    A review of recent results in gamma-ray burst spectroscopy is given. Particular attention is paid to the recent discovery of emission and absorption features in the burst spectra. These lines represent the strongest evidence to date that gamma-ray bursts originate on or near neutron stars. Line parameters give information on the temperature, magnetic field and possibly the gravitational potential of the neutron star. The behavior of the continuum spectrum is also discussed. A remarkably good fit to nearly all bursts is obtained with a thermal-bremsstrahlung-like continuum. Significant evolution is observed of both the continuum and line features within most events

  5. Airborne gamma-ray spectrometry

    DEFF Research Database (Denmark)

    Hovgaard, Jens

    A new method - Noise Adjusted Singular Value Decomposition, NASVD - for processing gamma-ray spectra has been developed as part of a Ph.D. project. By using this technique one is able to decompose a large set of data - for example from airborne gamma-ray surveys - into a few spectral components....... By knowing the spectral components and their amplitudes in each of the measured spectra one is able to extract more information from the data than possible with the methods used otherwise....

  6. Gamma-ray Imaging Methods

    Energy Technology Data Exchange (ETDEWEB)

    Vetter, K; Mihailescu, L; Nelson, K; Valentine, J; Wright, D

    2006-10-05

    In this document we discuss specific implementations for gamma-ray imaging instruments including the principle of operation and describe systems which have been built and demonstrated as well as systems currently under development. There are several fundamentally different technologies each with specific operational requirements and performance trade offs. We provide an overview of the different gamma-ray imaging techniques and briefly discuss challenges and limitations associated with each modality (in the appendix we give detailed descriptions of specific implementations for many of these technologies). In Section 3 we summarize the performance and operational aspects in tabular form as an aid for comparing technologies and mapping technologies to potential applications.

  7. Optical observations of Gamma-Ray Bursts

    International Nuclear Information System (INIS)

    Hjorth, J.; Pian, E.; Fynbo, J.P.U.

    2004-01-01

    We briefly review the status and recent progress in the field of optical observations of gamma-ray burst afterglows. We will focus on the fundamental observational evidence for the relationship between gamma-ray bursts and the final evolutionary phases of massive stars. In particular, we will address (i) gamma-ray burst host galaxies, (ii) optically dark gamma-ray burst afterglows, (iii) the gamma-ray burst-supernova connection, and (iv) the relation between X-ray flashes, gamma-ray bursts, and supernovae

  8. Equipment for x- and gamma ray radiography

    International Nuclear Information System (INIS)

    Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail

    2004-01-01

    The following topics related to the equipment for x - and gamma ray radiography are discussed in this chapter. The topics are x-ray source for Industrial Radiography: properties of x-ray, generation of x-ray, mechanism of x-ray production, x-ray equipment, power supply, distribution of x-ray intensity along the tube: gamma ray source for Industrial Radiography: properties of gamma rays, gamma ray sources, gamma ray projectors on cameras, source changing. Care of Radiographic Equipments: Merits and Demerits of x and Gamma Rays

  9. Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.

  10. A method for synthesizing response functions of NaI detectors to gamma rays

    International Nuclear Information System (INIS)

    Sie, S.H.

    1978-08-01

    A simple method of parametrizing the response function of NaI detectors to gamma rays is described, based on decomposition of the pulse-height spectrum into components associated with the actual detection processes. Smooth dependence of the derived parameters on the gamma-ray energy made it possible to generate a lineshape for any gamma-ray energy by suitable interpolation techniques. The method is applied in analysis of spectra measured with a 7.6 x 7.6 cm NaI detector in continuum gamma-ray study following (HI,xn) reaction

  11. Technology Development for AGIS (Advanced Gamma-ray Imaging System).

    Science.gov (United States)

    Krennrich, Frank

    2008-04-01

    Next-generation arrays of atmospheric Cherenkov telescopes are at the conceptual planning stage and each could consist of on the order of 100 telescopes. The two currently-discussed projects AGIS in the US and CTA in Europe, have the potential to achieve an order of magnitude better sensitivity for Very High Energy (VHE) gamma-ray observations over state-to-the-art observatories. These projects require a substantial increase in scale from existing 4-telescope arrays such as VERITAS and HESS. The optimization of a large array requires exploring cost reduction and research and development for the individual elements while maximizing their performance as an array. In this context, the technology development program for AGIS will be discussed. This includes developing new optical designs, evaluating new types of photodetectors, developing fast trigger systems, integrating fast digitizers into highly-pixilated cameras, and reliability engineering of the individual components.

  12. The Gamma-ray Universe through Fermi

    Science.gov (United States)

    Thompson, David J.

    2012-01-01

    Gamma rays, the most powerful form of light, reveal extreme conditions in the Universe. The Fermi Gamma-ray Space Telescope and its smaller cousin AGILE have been exploring the gamma-ray sky for several years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge ga.nuna-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  13. Multifrequency Observations of Gamma-Ray Burst

    OpenAIRE

    Greiner, J.

    1995-01-01

    Neither a flaring nor a quiescent counterpart to a gamma-ray burst has yet been convincingly identified at any wavelength region. The present status of the search for counterparts of classical gamma-ray bursts is given. Particular emphasis is put on the search for flaring counterparts, i.e. emission during or shortly after the gamma-ray emission.

  14. Stellar Sources of Gamma-ray Bursts

    OpenAIRE

    Luchkov, B. I.

    2011-01-01

    Correlation analysis of Swift gamma-ray burst coordinates and nearby star locations (catalog Gliese) reveals 4 coincidences with good angular accuracy. The random probability is 4\\times 10^{-5}, so evidencing that coincident stars are indeed gamma-ray burst sources. Some additional search of stellar gamma-ray bursts is discussed.

  15. Gamma-rays from deep inelastic collisions

    International Nuclear Information System (INIS)

    Stephens, F.S.

    1981-01-01

    My objective in this talk is to consider the question: 'What can be learned about deep inelastic collisions (DIC) from studying the associated gamma-rays'. First, I discuss the origin and nature of the gamma-rays from DIC, then the kinds of information gamma-ray spectra contain, and finally come to the combination of these two subjects. (orig./HSI)

  16. Miniature gamma-ray camera for tumor localization

    International Nuclear Information System (INIS)

    Lund, J.C.; Olsen, R.W.; James, R.B.; Cross, E.

    1997-08-01

    The overall goal of this LDRD project was to develop technology for a miniature gamma-ray camera for use in nuclear medicine. The camera will meet a need of the medical community for an improved means to image radio-pharmaceuticals in the body. In addition, this technology-with only slight modifications-should prove useful in applications requiring the monitoring and verification of special nuclear materials (SNMs). Utilization of the good energy resolution of mercuric iodide and cadmium zinc telluride detectors provides a means for rejecting scattered gamma-rays and improving the isotopic selectivity in gamma-ray images. The first year of this project involved fabrication and testing of a monolithic mercuric iodide and cadmium zinc telluride detector arrays and appropriate collimators/apertures. The second year of the program involved integration of the front-end detector module, pulse processing electronics, computer, software, and display

  17. Materials testing by computerized tomography with neutrons and gamma-rays

    Energy Technology Data Exchange (ETDEWEB)

    El-Ghobary, A M; Bakkoush, F A; Megahid, R M [Reactor and Neutron Physics Department, Nuclear Research Center, A.E.A., Cairo (Egypt)

    1997-12-31

    The method of computerized tomography by fast neutrons and gamma-rays are used for inspecting and testing of materials by non-destructive technique. The transmission technique was applied using narrow collimated beams of reactor neutrons and gamma-ray. The neutron and gamma-rays transmitted through the object inspection were measured by means of a neutron gamma detector with Ne - 213 liquid organic scintillator. The undesired pulses of neutrons or gamma-rays are rejected from the transmitted beam by a discrimination technique based on the difference in the decay part of light pulse produced by recoil electrons or recoil protons. The transmitted neutrons or gamma-rays for different projections used to get the image of the section through the object investigated using the method of filtered back projection (FBP) algorithm. 8 figs.

  18. Airborne gamma ray spectrometer surveying

    International Nuclear Information System (INIS)

    1991-01-01

    The International Atomic Energy Agency (IAEA) in its role as collector and disseminator of information on nuclear techniques has long had an interest in gamma ray spectrometer methods and has published a number of Technical Reports on various aspects of the subject. At an Advisory Group Meeting held in Vienna in November 1986 to review appropriate activities the IAEA could take following the Chernobyl accident, it was recommended that preparation begin on a new Technical Report on airborne gamma ray spectrometer surveying, taking into account the use of the technique for environmental monitoring as well as for nuclear emergency response requirements. Shortly thereafter the IAEA became the lead organization in the Radioelement Geochemical Mapping section of the International Geological Correlation Programme/United Nations Educational, Scientific and Cultural Organization (UNESCO) Project on International Geochemical Mapping. These two factors led to the preparation of the present Technical Report. 18 figs, 4 tabs

  19. Compton suppression gamma ray spectrometry

    International Nuclear Information System (INIS)

    Landsberger, S.; Iskander, F.Y.; Niset, M.; Heydorn, K.

    2002-01-01

    In the past decade there have been many studies to use Compton suppression methods in routine neutron activation analysis as well as in the traditional role of low level gamma ray counting of environmental samples. On a separate path there have been many new PC based software packages that have been developed to enhance photopeak fitting. Although the newer PC based algorithms have had significant improvements, they still suffer from being effectively used in weak gamma ray lines in natural samples or in neutron activated samples that have very high Compton backgrounds. We have completed a series of experiments to show the usefulness of Compton suppression. As well we have shown the pitfalls when using Compton suppression methods for high counting deadtimes as in the case of neutron activated samples. We have also investigated if counting statistics are the same both suppressed and normal modes. Results are presented in four separate experiments. (author)

  20. CAMAC gamma ray scanning system

    International Nuclear Information System (INIS)

    Moss, C.E.; Pratt, J.C.; Shunk, E.R.

    1981-01-01

    A flexible gamma-ray scanning system, based on a LeCroy 3500 multichannel analyzer and CAMAC modules, is described. The system is designed for making simultaneous passive and active scans of objects of interest to nuclear safeguards. The scanner is a stepping-motor-driven carriage; the detectors, a bismuth-germanate scintillator and a high-purity germanium detector. A total of sixteen peaks in the two detector-produced spectra can be integrated simultaneously, and any scan can be viewed during data acquisition. For active scanning, the 2615-keV gamma-ray line from a 232 U source and the 4439-keV gamma-ray line from 9 Be(α,n) 12 C were selected. The system can be easily reconfigured to accommodate up to seven detectors because it is based on CAMAC modules and FORTRAN. The system is designed for field use and is easily transported. Examples of passive and active scans are presented

  1. Fast Fourier transformation results from gamma-ray burst profiles

    Science.gov (United States)

    Kouveliotou, Chryssa; Norris, Jay P.; Fishman, Gerald J.; Meegan, Charles A.; Wilson, Robert B.; Paciesas, W. S.

    1992-01-01

    Several gamma-ray bursts in the BATSE data have sufficiently long durations and complex temporal structures with pulses that appear to be spaced quasi-periodically. In order to test and quantify these periods we have applied fast Fourier transformations (FFT) to all these events. We have also performed cross spectral analyses of the FFT of the two extreme (high-low) energy bands in each case to determine the lead/lag of the pulses in different energies.

  2. Search for very high-energy gamma-ray emission from the microquasar Cygnus X-1 with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.

    2017-12-01

    The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.

  3. VLBI OBSERVATIONS OF THE JET IN M 87 DURING THE VERY HIGH ENERGY {gamma}-RAY FLARE IN 2010 APRIL

    Energy Technology Data Exchange (ETDEWEB)

    Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2012-11-20

    We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.

  4. An extremely bright gamma-ray pulsar in the Large Magellanic Cloud.

    Science.gov (United States)

    2015-11-13

    Pulsars are rapidly spinning, highly magnetized neutron stars, created in the gravitational collapse of massive stars. We report the detection of pulsed giga-electron volt gamma rays from the young pulsar PSR J0540-6919 in the Large Magellanic Cloud, a satellite galaxy of the Milky Way. This is the first gamma-ray pulsar detected in another galaxy. It has the most luminous pulsed gamma-ray emission yet observed, exceeding the Crab pulsar's by a factor of 20. PSR J0540-6919 presents an extreme test case for understanding the structure and evolution of neutron star magnetospheres. Copyright © 2015, American Association for the Advancement of Science.

  5. Space instrumentation for gamma-ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Teegarden, B.J

    1999-02-11

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world.

  6. Space instrumentation for gamma-ray astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.

    1999-01-01

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world

  7. Heterogeneity in Short Gamma-Ray Bursts

    Science.gov (United States)

    Norris, Jay P.; Gehrels Neil; Scargle, Jeffrey D.

    2011-01-01

    We analyze the Swift/BAT sample of short gamma-ray bursts, using an objective Bayesian Block procedure to extract temporal descriptors of the bursts' initial pulse complexes (IPCs). The sample comprises 12 and 41 bursts with and without extended emission (EE) components, respectively. IPCs of non-EE bursts are dominated by single pulse structures, while EE bursts tend to have two or more pulse structures. The medians of characteristic timescales - durations, pulse structure widths, and peak intervals - for EE bursts are factors of approx 2-3 longer than for non-EE bursts. A trend previously reported by Hakkila and colleagues unifying long and short bursts - the anti-correlation of pulse intensity and width - continues in the two short burst groups, with non-EE bursts extending to more intense, narrower pulses. In addition we find that preceding and succeeding pulse intensities are anti-correlated with pulse interval. We also examine the short burst X-ray afterglows as observed by the Swift/XRT. The median flux of the initial XRT detections for EE bursts (approx 6 X 10(exp -10) erg / sq cm/ s) is approx > 20 x brighter than for non-EE bursts, and the median X-ray afterglow duration for EE bursts (approx 60,000 s) is approx 30 x longer than for non-EE bursts. The tendency for EE bursts toward longer prompt-emission timescales and higher initial X-ray afterglow fluxes implies larger energy injections powering the afterglows. The longer-lasting X-ray afterglows of EE bursts may suggest that a significant fraction explode into more dense environments than non-EE bursts, or that the sometimes-dominant EE component efficiently p()wers the afterglow. Combined, these results favor different progenitors for EE and non-EE short bursts.

  8. HETEROGENEITY IN SHORT GAMMA-RAY BURSTS

    International Nuclear Information System (INIS)

    Norris, Jay P.; Gehrels, Neil; Scargle, Jeffrey D.

    2011-01-01

    We analyze the Swift/BAT sample of short gamma-ray bursts, using an objective Bayesian Block procedure to extract temporal descriptors of the bursts' initial pulse complexes (IPCs). The sample is comprised of 12 and 41 bursts with and without extended emission (EE) components, respectively. IPCs of non-EE bursts are dominated by single pulse structures, while EE bursts tend to have two or more pulse structures. The medians of characteristic timescales-durations, pulse structure widths, and peak intervals-for EE bursts are factors of ∼2-3 longer than for non-EE bursts. A trend previously reported by Hakkila and colleagues unifying long and short bursts-the anti-correlation of pulse intensity and width-continues in the two short burst groups, with non-EE bursts extending to more intense, narrower pulses. In addition, we find that preceding and succeeding pulse intensities are anti-correlated with pulse interval. We also examine the short burst X-ray afterglows as observed by the Swift/X-Ray Telescope (XRT). The median flux of the initial XRT detections for EE bursts (∼6x10 -10 erg cm -2 s -1 ) is ∼>20x brighter than for non-EE bursts, and the median X-ray afterglow duration for EE bursts (∼60,000 s) is ∼30x longer than for non-EE bursts. The tendency for EE bursts toward longer prompt-emission timescales and higher initial X-ray afterglow fluxes implies larger energy injections powering the afterglows. The longer-lasting X-ray afterglows of EE bursts may suggest that a significant fraction explode into denser environments than non-EE bursts, or that the sometimes-dominant EE component efficiently powers the afterglow. Combined, these results favor different progenitors for EE and non-EE short bursts.

  9. Coincidence gamma-ray spectrometry

    DEFF Research Database (Denmark)

    Markovic, Nikola; Roos, Per; Nielsen, Sven Poul

    2017-01-01

    Gamma-ray spectrometry with high-purity germanium (HPGe) detectors is often the technique of choice in an environmental radioactivity laboratory. When measuring environmental samples associated activities are usually low so an important parameter that describes the performance of the spectrometer...... for a nuclide of interest is the minimum detectable activity (MDA). There are many ways for lowering the MDAs in gamma spectrometry. Recently, developments of fast and compact digital acquisition systems have led to growing number of multiple HPGe detector spectrometers. In these applications all detected...

  10. Cosmic gamma-ray bursts

    International Nuclear Information System (INIS)

    Hurley, K.

    1989-01-01

    This paper reviews the essential aspects of the gamma-ray burst (GRB) phenomenon, with emphasis on the more recent results. GRBs are introduced by their time histories, which provide some evidence for a compact object origin. The energy spectra of bursts are presented and they are seen to demonstrate practically unambiguously that the origin of some GRBs involves neutron stars. Counterpart searches are reviewed briefly and the statistical properties of bursters treated. This paper presents a review of the three known repeating bursters (the Soft Gamma Repeaters). Extragalactic and galactic models are discussed and future prospects are assessed

  11. Detection of 16 Gamma-Ray Pulsars Through Blind Frequency Searches Using the Fermi LAT

    International Nuclear Information System (INIS)

    Anderson, B.; Atwood, W.B.; Dormody, M.; Johnson, R.P.; Porter, T.A.; Primack, J.R.; Sadrozinski, H.F.W.; Parkinson, P.M.S.; Ziegler, M.; Abdo, A.A.; Dermer, C.D.; Grove, J.E.; Gwon, C.; Johnson, W.N.; Lovellette, M.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wolff, M.T.; Wood, K.S.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Funk, S.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Axelsson, M.; Conrad, J.; Meurer, C.; Ryde, F.; Ylinen, T.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Spandre, G.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Pierbattista, M.; Starck, J.L.

    2009-01-01

    Pulsars are rapidly rotating, highly magnetized neutron stars emitting radiation across the electromagnetic spectrum. Although there are more than 1800 known radio pulsars, until recently only seven were observed to pulse in gamma rays, and these were all discovered at other wavelengths. The Fermi Large Area Telescope (LAT) makes it possible to pinpoint neutron stars through their gamma-ray pulsations. We report the detection of 16 gamma-ray pulsars in blind frequency searches using the LAT. Most of these pulsars are coincident with previously unidentified gamma-ray sources, and many are associated with supernova remnants. Direct detection of gamma-ray pulsars enables studies of emission mechanisms, population statistics, and the energetics of pulsar wind nebulae and supernova remnants. (authors)

  12. Precision linac and laser technologies for nuclear photonics gamma-ray sources

    Energy Technology Data Exchange (ETDEWEB)

    Albert, F.; Hartemann, F. V.; Anderson, S. G.; Cross, R. R.; Gibson, D. J.; Hall, J.; Marsh, R. A.; Messerly, M.; Wu, S. S.; Siders, C. W.; Barty, C. P. J. [Lawrence Livermore National Laboratory, NIF and Photon Science, 7000 East Avenue, Livermore, California 94550 (United States)

    2012-05-15

    Tunable, high precision gamma-ray sources are under development to enable nuclear photonics, an emerging field of research. This paper focuses on the technological and theoretical challenges related to precision Compton scattering gamma-ray sources. In this scheme, incident laser photons are scattered and Doppler upshifted by a high brightness electron beam to generate tunable and highly collimated gamma-ray pulses. The electron and laser beam parameters can be optimized to achieve the spectral brightness and narrow bandwidth required by nuclear photonics applications. A description of the design of the next generation precision gamma-ray source currently under construction at Lawrence Livermore National Laboratory is presented, along with the underlying motivations. Within this context, high-gradient X-band technology, used in conjunction with fiber-based photocathode drive laser and diode pumped solid-state interaction laser technologies, will be shown to offer optimal performance for high gamma-ray spectral flux, narrow bandwidth applications.

  13. Investigation of the effects of head irradiation with gamma rays and protons on startle and pre-pulse inhibition behavior in mice.

    Science.gov (United States)

    Haerich, Paul; Eggers, Cara; Pecaut, Michael J

    2012-05-01

    With the increased international emphasis on manned space exploration, there is a growing need to understand the impact of the spaceflight environment on health and behavior. One particularly important aspect of this environment is low-dose radiation. In the present studies, we first characterized the γ- and proton-irradiation dose effect on acoustic startle and pre-pulse inhibition behaviors in mice exposed to 0-5 Gy brain-localized irradiation, and assessed these effects 2 days later. Subsequently, we used 2 Gy to assess the time course of γ- and proton-radiation effects on startle reactivity 0-8 days after exposure. Exposures targeted the brain to minimize the impact of peripheral inflammation-induced sickness behavior. The effects of radiation on startle were subtle and acute. Radiation reduced the startle response at 2 and 5 Gy. Following a 2-Gy exposure, the response reached a minimum at the 2-day point. Proton and γ-ray exposures did not differ in their impact on startle. We found there were no effects of radiation on pre-pulse inhibition of the startle response.

  14. Measurements of Cyclotron Features and Pulse Periods in the High-Mass X-Ray Binaries 4U 1538-522 and 4U 1907+09 with the International Gamma-Ray Astrophysics Laboratory

    Science.gov (United States)

    Hemphill, Paul B.; Rothschild, Richard E.; Caballero, Isabel; Pottschmidt, Katja; Kuhnel, Matthias; Furst, Felix; Wilms, Jorn

    2013-01-01

    We present a spectral and timing analysis of International Gamma-Ray Astrophysics Laboratory (INTEGRAL) observations of two high-mass X-ray binaries, 4U 1538-522 and 4U 1907+09. Our timing measurements for 4U 1538-522 find the pulse period to have exhibited a spin-up trend until approximately 2009, after which there is evidence for a torque reversal, with the source beginning to spin down to the most recently measured period of 525.407 plus or minus 0.001 seconds. The most recent INTEGRAL observations of 4U 1907+09 are not found to yield statistically significant pulse periods due to the significantly lower flux from the source compared with 4U 1538-522. A spectral model consisting of a power-law continuum with an exponential cutoff and modified by two cyclotron resonance scattering features is found to fit both sources well, with the cyclotron scattering features detected at approximately 22 and approximately 49 kiloelectronvolts for 4U 1538-522 and at approximately 18 and approximately 36 kiloelectronvolts for 4U 1907+09. The spectral parameters of 4U 1538-522 are generally not found to vary significantly with flux and there is little to no variation across the torque reversal. Examining our results in conjunction with previous work, we find no evidence for a correlation between cyclotron line energy and luminosity for 4U 1538-522. 4U 1907+09 shows evidence for a positive correlation between cyclotron line energy and luminosity, which would make it the fourth, and lowest luminosity, cyclotron line source to exhibit this relationship.

  15. Gamma-ray burst polarimeter (GAP)

    International Nuclear Information System (INIS)

    Mihara, Tatehiro; Murakami, Toshio; Yonetoku, Daisuke; Gunji, Shuichi; Kubo, Shin

    2013-01-01

    The gamma-ray burst polarimeter (GAP: GAmma-ray burst Polarimeter), which had been almost handcrafted by scientists, has succeeded in working normally in interplanetary space, and in detecting the polarization of the gamma-ray from a mysterious astronomical object 'gamma-ray burst'. It is the first result of the detectors in the world exclusively aiming at detecting gamma-ray polarization. We mainly describe the hardware of our GAP equipment and show the method of preparing equipment to work in the cosmic space with a tight budget. The mechanical structure, the electronic circuits, the software on the equipment, the data analysis on the earth, and the scientific results gained by the observation just over one year, are presented after explaining the principle of gamma-ray polarization detection. Our design to protect equipment against mechanical shock and cosmic radiation may provide useful information for future preparation of compact satellite. (J.P.N.)

  16. Searching for gamma-ray counterparts to gravitational waves from merging binary neutron stars with the Cherenkov Telescope Array

    Science.gov (United States)

    Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.

    2018-05-01

    The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.

  17. A study of the scintillation induced by alpha particles and gamma rays in liquid xenon in an electric field

    International Nuclear Information System (INIS)

    Dawson, J.V.; Howard, A.S.; Akimov, D.; Araujo, H.; Bewick, A.; Davidge, D.C.R.; Jones, W.G.; Joshi, M.; Lebedenko, V.N.; Liubarsky, I.; Quenby, J.J.; Rochester, G.; Shaul, D.; Sumner, T.J.; Walker, R.J.

    2005-01-01

    Scintillation produced in liquid xenon by alpha particles and gamma rays has been studied as a function of applied electric field. For back scattered gamma rays with energy of about 200keV, the number of scintillation photons was found to decrease by 64±2% with increasing field strength. Consequently, the pulse shape discrimination power between alpha particles and gamma rays is found to reduce with increasing field, but remaining non-zero at higher fields

  18. GAMMA-RAY SIGNAL FROM THE PULSAR WIND IN THE BINARY PULSAR SYSTEM PSR B1259-63/LS 2883

    Energy Technology Data Exchange (ETDEWEB)

    Khangulyan, Dmitry [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Aharonian, Felix A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Bogovalov, Sergey V. [National Research Nuclear University-MEPHI, Kashirskoe Shosse 31, Moscow 115409 (Russian Federation); Ribo, Marc, E-mail: khangul@astro.isas.jaxa.jp, E-mail: felix.aharonian@dias.ie, E-mail: svbogovalov@mephi.ru, E-mail: mribo@am.ub.es [Departament d' Astronomia i Meteorologia, Institut de Ciences del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain)

    2011-12-01

    Binary pulsar systems emit potentially detectable components of gamma-ray emission due to Comptonization of the optical radiation of the companion star by relativistic electrons of the pulsar wind, both before and after termination of the wind. The recent optical observations of binary pulsar system PSR B1259-63/LS 2883 revealed radiation properties of the companion star which differ significantly from previous measurements. In this paper, we study the implications of these observations for the interaction rate of the unshocked pulsar wind with the stellar photons and the related consequences for fluxes of high energy and very high energy (VHE) gamma rays. We show that the signal should be strong enough to be detected with Fermi close to the periastron passage, unless the pulsar wind is strongly anisotropic or the Lorentz factor of the wind is smaller than 10{sup 3} or larger than 10{sup 5}. The higher luminosity of the optical star also has two important implications: (1) attenuation of gamma rays due to photon-photon pair production and (2) Compton drag of the unshocked wind. While the first effect has an impact on the light curve of VHE gamma rays, the second effect may significantly decrease the energy available for particle acceleration after termination of the wind.

  19. FERMI LAT OBSERVATIONS OF LS I +610303: FIRST DETECTION OF AN ORBITAL MODULATION IN GeV GAMMA RAYS

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.

    2009-01-01

    This Letter presents the first results from the observations of LS I +61 0 303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 ± 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 ± 0.03(stat) ± 0.07(syst) 10 -6 ph cm -2 s -1 , with a cutoff at 6.3 ± 1.1(stat) ± 0.4(syst) GeV and photon index Γ = 2.21 ± 0.04(stat) ± 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  20. Fermi LAT Observations of LS I +61 303: First Detection of an Orbital Modulation in GeV Gamma Rays

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A.A.; /Federal City Coll. /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, R.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /DAPNIA, Saclay /NASA, Goddard /CSST, Baltimore /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /SLAC /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Grenoble, CEN; /more authors..

    2012-04-02

    This Letter presents the first results from the observations of LS I +61{sup o}303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 {+-} 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 {+-} 0.03(stat) {+-} 0.07(syst) 10{sup -6} ph cm{sup -2} s{sup -1}, with a cutoff at 6.3 {+-} 1.1(stat) {+-} 0.4(syst) GeV and photon index {Gamma} = 2.21 {+-} 0.04(stat) {+-} 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  1. Gamma-Ray Astronomy Technology Needs

    Science.gov (United States)

    Gehrels, N.; Cannizzo, J. K.

    2012-01-01

    In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.

  2. Relation between gamma-ray emission, radio bursts, and proton fluxes from solar flares

    International Nuclear Information System (INIS)

    Fomichev, V.V.; Chertok, I.M.

    1985-01-01

    Data on solar gamma-ray flares, including 24 flares with gamma-ray lines, recorded up to June 1982, are analyzed. It is shown that from the point of view of radio emission the differences between flares with and without gamma-ray lines has a purely quantitative character: the former are accompanied by the most intense microwave bursts. Meter type II bursts are not a distinctive feature of flares with gamma-ray lines. Pulsed flares, regardless of the presence or absence of gamma-ray lines, are not accompanied by significant proton fluxes at the earth. On the whole, contrary to the popular opinion in the literature, flares with gamma-ray lines do not display a deficit of proton flux in interplanetary space in comparison with similar flares without gamma-ray lines. The results of quantitative diagnostics of proton flares based on radio bursts are not at variance with the presence of flares without detectable gamma-ray emission in lines but with a pronounced increase in the proton flux at the earth. 23 references

  3. Janus probe, a detection system for high energy reactor gamma-ray spectrometry

    International Nuclear Information System (INIS)

    Gold, R.; Kaiser, B.J.

    1980-03-01

    In reactor environments, gamma-ray spectra are continuous and the absolute magnitude as well as the general shape of the gamma continuum are of paramount importance. Consequently, conventional methods of gamma-ray detection are not suitable for in-core gamma-ray spectrometry. To meet these specific needs, a method of continuous gamma-ray spectrometry, namely Compton Recoil Gamma-Ray Spectrometry, was developed for in-situ observations of reactor environments. A new gamma-ray detection system has been developed which extends the applicability of Compton Recoil Gamma-Ray Spectrometry up to roughly 7 MeV. This detection system is comprised of two separate Si(Li) detectors placed face-to-face. Hence this new detection system is called the Janus probe. Also shown is the block diagram of pulse processing instrumentation for the Janus probe. This new gamma probe not only extends the upper energy limit of in-core gamma-ray spectrometry, but in addition possesses other fundamental advantages

  4. Distribution of iron and titanium on the lunar surface from lunar prospector gamma ray spectra

    International Nuclear Information System (INIS)

    Prettyman, T.H.; Feldman, W.C.; Lawrence, David J.; Elphic, R.C.; Gasnault, O.M.; Maurice, S.; Moore, K.R.; Binder, A.B.

    2001-01-01

    Gamma ray pulse height spectra acquired by the Lunar Prospector (LP) Gamma-Ray Spectrometer (GRS) contain information on the abundance of major elements in the lunar surface, including O, Si, Ti, Al, Fe, Mg, Ca, K, and Th. With the exception of Th and K, prompt gamma rays produced by cosmic ray interactions with surface materials are used to determine elemental abundance. Most of these gamma rays are produced by inelastic scattering of fast neutrons and by neutron capture. The production of neutron-induced gamma rays reaches a maximum deep below the surface (e.g. ∼140 g/cm 2 for inelastic scattering and ∼50 g/cm 2 for capture). Consequently, gamma rays sense the bulk composition of lunar materials, in contrast to optical methods (e.g. Clementine Spectral Reflectance (CSR)), which only sample the top few microns. Because most of the gamma rays are produced deep beneath the surface, few escape unscattered and the continuum of scattered gamma rays dominates the spectrum. In addition, due to the resolution of the spectrometer, there are few well-isolated peaks and peak fitting algorithms must be used to deconvolve the spectrum in order to determine the contribution of individual elements.

  5. Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst

    Directory of Open Access Journals (Sweden)

    Julian Sitarek

    2016-09-01

    Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.

  6. Gamma-ray burst models.

    Science.gov (United States)

    King, Andrew

    2007-05-15

    I consider various possibilities for making gamma-ray bursts, particularly from close binaries. In addition to the much-studied neutron star+neutron star and black hole+neutron star cases usually considered good candidates for short-duration bursts, there are also other possibilities. In particular, neutron star+massive white dwarf has several desirable features. These systems are likely to produce long-duration gamma-ray bursts (GRBs), in some cases definitely without an accompanying supernova, as observed recently. This class of burst would have a strong correlation with star formation and occur close to the host galaxy. However, rare members of the class need not be near star-forming regions and could have any type of host galaxy. Thus, a long-duration burst far from any star-forming region would also be a signature of this class. Estimates based on the existence of a known progenitor suggest that this type of GRB may be quite common, in agreement with the fact that the absence of a supernova can only be established in nearby bursts.

  7. Dark gamma-ray bursts

    Science.gov (United States)

    Brdar, Vedran; Kopp, Joachim; Liu, Jia

    2017-03-01

    Many theories of dark matter (DM) predict that DM particles can be captured by stars via scattering on ordinary matter. They subsequently condense into a DM core close to the center of the star and eventually annihilate. In this work, we trace DM capture and annihilation rates throughout the life of a massive star and show that this evolution culminates in an intense annihilation burst coincident with the death of the star in a core collapse supernova. The reason is that, along with the stellar interior, also its DM core heats up and contracts, so that the DM density increases rapidly during the final stages of stellar evolution. We argue that, counterintuitively, the annihilation burst is more intense if DM annihilation is a p -wave process than for s -wave annihilation because in the former case, more DM particles survive until the supernova. If among the DM annihilation products are particles like dark photons that can escape the exploding star and decay to standard model particles later, the annihilation burst results in a flash of gamma rays accompanying the supernova. For a galactic supernova, this "dark gamma-ray burst" may be observable in the Čerenkov Telescope Array.

  8. Relativistic motion in gamma-ray bursts

    International Nuclear Information System (INIS)

    Krolik, J.H.; Pier, E.A.

    1991-01-01

    Three fundamental problems affect models of gamma-ray bursts, i.e., the energy source, the ability of high-energy photons to escape the radiation region, and the comparative weakness of X-ray emission. It is indicated that relativistic bulk motion of the gamma-ray-emitting plasma generically provides a solution to all three of these problems. Results show that, if the plasma that produces gamma-ray bursts has a bulk relativistic velocity with Lorentz factor gamma of about 10, several of the most troubling problems having to do with gamma-ray bursts are solved. 42 refs

  9. Radio Observations of Gamma-ray Novae

    Science.gov (United States)

    Linford, Justin D.; Chomiuk, L.; Ribeiro, V.; project, E.-Nova

    2014-01-01

    Recent detection of gamma-ray emission from classical novae by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope surprised many in the astronomical community. We present results from radio observations, obtained using the Karl G. Jansky Very Large Array (VLA), of three gamma-ray novae: Mon2012, Sco2012, and Del2013. Radio observations allow for the calculation of ejecta masses, place limits on the distances, and provide information about the gamma-ray emission mechanism for these sources.

  10. A detailed study of the supernova remnant RCW 86 in TeV {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Heinz, Sebastian

    2012-03-29

    A detailed study of the supernova remnant RCW 86 is presented. RCW 86 encountered a shell-like structure in radio, X-rays and optical, whereas in the discovery paper of RCW 86 in the very high energy regime the structure could not be confirmed. In this thesis for the first time the shell was resolved in the very high energy gamma rays. The shell width was determined to be 0.125 {+-}0.014 , the radius to be 0.194 {+-} 0.016 and the center to be -62.433 {+-}0.014 in declination and 220.734 {+-}0.016 in rectascension. The spectral analysis was performed for the whole SNR and for the south-east part, which is more pronounced in X-rays separately. But the results were comparable within errors. Additionally a power-law with an exponential cut off described the spectra best with the parameters: an spectral index of 1.50{+-}0.28, a cut-off energy of (2.69{+-}0.99 TeV) and an integral flux above 1 TeV of (6.51{+-}2.69) . 10{sup -12} cm{sup -2}s{sup -1}. The study of the correlation of the X-ray and VHE {gamma}-ray data of RCW 86 was hampered by the poor angular resolution of the VHE data. Therefore detailed studies of the Richardson-Lucy deconvolution algorithm have been performed. The outcome is, that deconvolution techniques are applicable to strong VHE {gamma}-ray sources and that fine structure well below the angular resolution can be studied. The application to RX J1713-3946, the brightest SNR in the VHE regime, has shown, that the correlation coefficient of the X-ray data and the VHE data of is stable down to 0.01 and has a value of 0.85. On the other side the significance of the data set is not sufficient in the case of RCW 86 to apply the deconvolution technique.

  11. Gravitational Waves versus X and Gamma Ray Emission in a Short Gamma-Ray Burst

    OpenAIRE

    Oliveira, F. G.; Rueda, Jorge A.; Ruffini, Remo

    2012-01-01

    The recent progress in the understanding the physical nature of neutron star equilibrium configurations and the first observational evidence of a genuinely short gamma-ray burst, GRB 090227B, allows to give an estimate of the gravitational waves versus the X and Gamma-ray emission in a short gamma-ray burst.

  12. Advanced gamma ray balloon experiment ground checkout and data analysis

    Science.gov (United States)

    Blackstone, M.

    1976-01-01

    A software programming package to be used in the ground checkout and handling of data from the advanced gamma ray balloon experiment is described. The Operator's Manual permits someone unfamiliar with the inner workings of the software system (called LEO) to operate on the experimental data as it comes from the Pulse Code Modulation interface, converting it to a form for later analysis, and monitoring the program of an experiment. A Programmer's Manual is included.

  13. Operations manual for the megachannel gamma-ray coincidence system

    International Nuclear Information System (INIS)

    Ruhter, W.

    1977-01-01

    To aid in the study of nuclear structures, a megachannel pulse-height coincidence analysis system on a PDP-8 computer was constructed. The system digitizes the energies of coincident gamma-rays and stores the resultant information on a moving-head disk. The system uses a minicomputer to sort and store gamma-gamma coincident information on line. The megachannel system and how to use it are described

  14. Measurements of keV-neutron capture {gamma} rays of fission products. 3

    Energy Technology Data Exchange (ETDEWEB)

    Igashira, Masayuki [Tokyo Inst. of Tech. (Japan). Research Lab. for Nuclear Reactors

    1997-03-01

    {gamma} rays from the keV-neutron capture reactions by {sup 143,145}Nd and {sup 153}Eu have been measured in a neutron energy region of 10 to 80 keV, using a large anti-Compton NaI(Tl) {gamma}-ray spectrometer and the {sup 7}Li(p,n){sup 7}Be pulsed neutron source with a 3-MV Pelletron accelerator. The preliminary results for the capture cross sections and {gamma}-ray spectra of those nuclei are presented and discussed. (author)

  15. Programs for the automatic gamma-ray measurement with CANBERRA 8100/QUANTA system

    International Nuclear Information System (INIS)

    Yoshida, Hiroshi; Sakai, Eiji; Kubo, Katsumi.

    1982-07-01

    Some programs have been prepared for the automatic operation of the CANBERRA 8100/QUANTA System for the gamma-ray spectrum measurement. The main parts of these programs are: (1) to collect and record on magnetic disks the data of gamma-ray spectra automatically, while the recorded data are analyzed to estimate the nuclides which generate photopeaks of spectra and to calculate those concentrations; (2) to draw plotted diagrams of pulse height distributions of gamma-ray spectra data and other data by the additional digital plotter; and etc. (author)

  16. Are 0.1%-accurate gamma-ray assays possible for 235U solutions

    International Nuclear Information System (INIS)

    Parker, J.L.

    1983-01-01

    The factors influencing the accuracy of passive gamma-ray assay of uniform, homogeneous solution samples have been studied in some detail, particularly for the assay of 235 U in uranium solutions. Factors considered are the overall long-term electronic stability, the information losses caused by the rate-related electronic processes of pulse pileup and dead-time, and the self-attenuation of gamma rays within the samples. Both experimental and computational studies indicate that gamma-ray assay procedures for solution samples of moderate size (from approx. 10 to perhaps a few hundred milliliters) are now capable of accuracies approaching 0.1% in many practical cases

  17. CENTRAL ENGINE MEMORY OF GAMMA-RAY BURSTS AND SOFT GAMMA-RAY REPEATERS

    International Nuclear Information System (INIS)

    Zhang, Bin-Bin; Castro-Tirado, Alberto J.; Zhang, Bing

    2016-01-01

    Gamma-ray bursts (GRBs) are bursts of γ-rays generated from relativistic jets launched from catastrophic events such as massive star core collapse or binary compact star coalescence. Previous studies suggested that GRB emission is erratic, with no noticeable memory in the central engine. Here we report a discovery that similar light curve patterns exist within individual bursts for at least some GRBs. Applying the Dynamic Time Warping method, we show that similarity of light curve patterns between pulses of a single burst or between the light curves of a GRB and its X-ray flare can be identified. This suggests that the central engine of at least some GRBs carries “memory” of its activities. We also show that the same technique can identify memory-like emission episodes in the flaring emission in soft gamma-ray repeaters (SGRs), which are believed to be Galactic, highly magnetized neutron stars named magnetars. Such a phenomenon challenges the standard black hole central engine models for GRBs, and suggest a common physical mechanism behind GRBs and SGRs, which points toward a magnetar central engine of GRBs

  18. Handbook on Mobile Gamma-ray Spectrometry

    DEFF Research Database (Denmark)

    Aage, Helle Karina; Korsbech, Uffe C C

    2003-01-01

    Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing......Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing...

  19. Gamma-Ray Interactions for Reachback Analysts

    Energy Technology Data Exchange (ETDEWEB)

    Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Myers, Steven Charles [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-02

    This presentation is a part of the DHS LSS spectroscopy training course and presents an overview of the following concepts: identification and measurement of gamma rays; use of gamma counts and energies in research. Understanding the basic physics of how gamma rays interact with matter can clarify how certain features in a spectrum were produced.

  20. Gamma ray astronomy from satellites and balloons

    International Nuclear Information System (INIS)

    Schoenfelder, V.

    1986-01-01

    A survey is given of gamma ray astronomy topics presented at the Cosmic Ray Conference. The major conclusions at the Cosmic Ray Conference in the field of gamma ray astronomy are given. (1) MeV-emission of gamma-ray bursts is a common feature. Variations in duration and energy spectra from burst to burst may explain the discrepancy between the measured log N - log S dependence and the observed isotropy of bursts. (2) The gamma-ray line at 1.809 MeV from Al(26) is the first detected line from a radioactive nucleosynthesis product. In order to understand its origin it will be necessary to measure its longitude distribution in the Milky Way. (3) The indications of a gamma-ray excess found from the direction of Loop I is consistent with the picture that the bulk of cosmic rays below 100 GeV is produced in galactic supernova remnants. (4) The interpretation of the large scale distribution of gamma rays in the Milky Way is controversial. At present an extragalactic origin of the cosmic ray nuclei in the GeV-range cannot be excluded from the gamma ray data. (5) The detection of MeV-emission from Cen A is a promising step towards the interesting field of extragalactic gamma ray astronomy

  1. Prompt gamma-ray activation analysis (PGAA)

    Energy Technology Data Exchange (ETDEWEB)

    Kern, J [Fribourg Univ. (Switzerland). Inst. de Physique

    1996-11-01

    The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs.

  2. Prompt gamma-ray activation analysis (PGAA)

    International Nuclear Information System (INIS)

    Kern, J.

    1996-01-01

    The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs

  3. A high energy gamma ray astronomy experiment

    International Nuclear Information System (INIS)

    Hofstadter, R.

    1988-01-01

    The author describes work involving NASA's Gamma Ray Observatory (GRO). GRO exemplifies the near zero principle because it investigates new gamma ray phenomena by relying on the space program to take us into the region of zero interference above the earth's atmosphere. In its present form GRO has four experiments

  4. Intercomparison of gamma ray analysis software packages

    International Nuclear Information System (INIS)

    1998-04-01

    The IAEA undertook an intercomparison exercise to review available software for gamma ray spectra analysis. This document describes the methods used in the intercomparison exercise, characterizes the software packages reviewed and presents the results obtained. Only direct results are given without any recommendation for a particular software or method for gamma ray spectra analysis

  5. Observations of the highest energy gamma-rays from gamma-ray bursts

    International Nuclear Information System (INIS)

    Dingus, Brenda L.

    2001-01-01

    EGRET has extended the highest energy observations of gamma-ray bursts to GeV gamma rays. Such high energies imply the fireball that is radiating the gamma-rays has a bulk Lorentz factor of several hundred. However, EGRET only detected a few gamma-ray bursts. GLAST will likely detect several hundred bursts and may extend the maximum energy to a few 100 GeV. Meanwhile new ground based detectors with sensitivity to gamma-ray bursts are beginning operation, and one recently reported evidence for TeV emission from a burst

  6. Alpha/beta(gamma ray) discrimination and spillover quantification with a BaF2 scintillator

    International Nuclear Information System (INIS)

    DeVol, T.A.; Fjeld, R.A.

    1994-01-01

    A simple pulse shape discrimination technique was used to separate alpha and beta(gamma ray) interactions in a BaF 2 scintillator. The separation was not ideal, resulting in a 5.1% spillover of alpha interactions into the beta(gamma ray) channel and 11.9% spillover of beta(gamma ray) interactions into the alpha channel for a set pulse shape discriminator. The misclassification of events was reduced by post-processing the data using either a simple analytical technique or a more complex linear least squares technique. Both techniques typically reduced the difference between the expected and calculated interaction rates to <10% when the ratio of beta(gamma ray) to alpha count rate was less than 100 : 1. ((orig.))

  7. Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.

    2017-06-01

    Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.

  8. The analysis of the gamma-ray pulseheight spectra resulting from the NaI detector

    International Nuclear Information System (INIS)

    Huang Zhengde; Zhang Guishan; Chen Qun; Cao Zhong

    1990-01-01

    The analysis of the Gamma-ray pulse-height spectra resulting from NaI detector is described by using weighted least square iteration. The computer program has the function of searching for Gamma-ray peak automatically. It can be used in the analysis of continuous, discrete or their superposition spectra. Besides, there are some function of the spectrum smooth,the correction of the shift in gain and zero energy channel intercept. Some results of the computer program are presented

  9. Measurement of neutron and gamma-ray production double differential cross section at KEK

    International Nuclear Information System (INIS)

    Ishibashi, Kenji

    1995-01-01

    High energy nuclear radiations were measured for 0.8-3.0 GeV proton induced reactions at KEK. The measurement was carried out to overcome the problems arising from the use of secondary beam line of a quite low incident beam intensity. Digital pulse shape discrimination method was applicable to separation between high energy neutrons and gamma-rays. By the use of a number of scintillators, cross sections were obtained for production of neutrons and gamma-rays. (author)

  10. Gamma-ray lasing by free nuclei and by matter-antimatter beams

    International Nuclear Information System (INIS)

    Rivlin, L.A.

    1997-01-01

    I discuss the possibilities to induce the gamma-ray emission departing from attempts to use the Moessbauer effect. Three separate approaches are considered: (A) Stimulated radiative transitions in deeply cooled nuclear beams with hidden inversion; (B) external two-photon ignition of nuclear lasing accompanied by gamma-ray giant pulse emission; and (C) burst-like radiative annihilation of relativistic beams of electrons and positrons or parapositronium atoms ignited by an external beam of soft photons

  11. Future prospects for. gamma. -ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Fichtel, C [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center

    1981-06-30

    As ..gamma..-ray astronomy moves from the discovery to the exploratory phase, the promise of ..gamma..-ray astrophysics noted by theorists in the late 1940s and 1950s is beginning to be realized. In the future, satellites should carry instruments that will have over an order of magnitude greater sensitivity than those flown thus far, and, for at least some portions of the ..gamma..-ray energy range, these detectors will also have substantially improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance our knowledge of several astrophysical phenomena including the very energetic and nuclear processes associated with compact objects, astrophysical nucleosynthesis, solar particle acceleration, the chemical composition of the planets and other bodies of the Solar System, the structure of our Galaxy, the origin and dynamic pressure effects of the cosmic rays, high energy particles and energetic processes in other galaxies especially active ones, and the degree of matter-antimatter symmetry of the Universe. The ..gamma..-ray results of the forthcoming programs such as Gamma-I, the Gamma Ray Observatory, the ..gamma..-ray burst network, Solar Polar, and very high energy ..gamma..-ray telescopes on the ground will almost certainly provide justification for more sophisticated telescopes. These advanced instruments might be placed on the Space Platform currently under study by N.A.S.A.

  12. On Gamma-Ray Bursts

    CERN Document Server

    Ruffini, Remo; Bianco, Carlo Luciano; Caito, Letizia; Chardonnet, Pascal; Cherubini, Christian; Dainotti, Maria Giovanna; Fraschetti, Federico; Geralico, Andrea; Guida, Roberto; Patricelli, Barbara; Rotondo, Michael; Hernandez, Jorge Armando Rueda; Vereshchagin, Gregory; Xue, She-Sheng

    2008-01-01

    (Shortened) We show by example how the uncoding of Gamma-Ray Bursts (GRBs) offers unprecedented possibilities to foster new knowledge in fundamental physics and in astrophysics. After recalling some of the classic work on vacuum polarization in uniform electric fields by Klein, Sauter, Heisenberg, Euler and Schwinger, we summarize some of the efforts to observe these effects in heavy ions and high energy ion collisions. We then turn to the theory of vacuum polarization around a Kerr-Newman black hole, leading to the extraction of the blackholic energy, to the concept of dyadosphere and dyadotorus, and to the creation of an electron-positron-photon plasma. We then present a new theoretical approach encompassing the physics of neutron stars and heavy nuclei. It is shown that configurations of nuclear matter in bulk with global charge neutrality can exist on macroscopic scales and with electric fields close to the critical value near their surfaces. These configurations may represent an initial condition for the...

  13. The Extragalactic Background Light and the Gamma-ray Opacity of the Universe

    Science.gov (United States)

    Dwek, Eli; Krennrich, Frank

    2012-01-01

    The extragalactic background light (EBL) is one of the fundamental observational quantities in cosmology. All energy releases from resolved and unresolved extragalactic sources, and the light from any truly diffuse background, excluding the cosmic microwave background (CMB), contribute to its intensity and spectral energy distribution. It therefore plays a crucial role in cosmological tests for the formation and evolution of stellar objects and galaxies, and for setting limits on exotic energy releases in the universe. The EBL also plays an important role in the propagation of very high energy gamma-rays which are attenuated en route to Earth by pair producing gamma-gamma interactions with the EBL and CMB. The EBL affects the spectrum of the sources, predominantly blazars, in the approx 10 GeV to 10 TeV energy regime. Knowledge of the EBL intensity and spectrum will allow the determination of the intrinsic blazar spectrum in a crucial energy regime that can be used to test particle acceleration mechanisms and VHE gamma-ray production models. Conversely, knowledge of the intrinsic gamma-ray spectrum and the detection of blazars at increasingly higher redshifts will set strong limits on the EBL and its evolution. This paper reviews the latest developments in the determination of the EBL and its impact on the current understanding of the origin and production mechanisms of gamma-rays in blazars, and on energy releases in the universe. The review concludes with a summary and future directions in Cherenkov Telescope Array techniques and in infrared ground-based and space observatories that will greatly improve our knowledge of the EBL and the origin and production of very high energy gamma-rays.

  14. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  15. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  16. Neutron detection gamma ray sensitivity criteria

    International Nuclear Information System (INIS)

    Kouzes, Richard T.; Ely, James H.; Lintereur, Azaree T.; Mace, Emily K.; Stephens, Daniel L.; Woodring, Mitchell L.

    2011-01-01

    The shortage of 3 He has triggered the search for effective alternative neutron detection technologies for national security and safeguards applications. Any new detection technology must satisfy two basic criteria: (1) it must meet a neutron detection efficiency requirement, and (2) it must be insensitive to gamma-ray interference at a prescribed level, while still meeting the neutron detection requirement. It is the purpose of this paper to define measureable gamma ray sensitivity criteria for neutron detectors. Quantitative requirements are specified for: intrinsic gamma ray detection efficiency and gamma ray absolute rejection. The gamma absolute rejection ratio for neutrons (GARRn) is defined, and it is proposed that the requirement for neutron detection be 0.9 3 He based neutron detector is provided showing that this technology can meet the stated requirements. Results from tests of some alternative technologies are also reported.

  17. Gamma-Ray Pulsar Studies With GLAST

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, D.J.; /NASA, Goddard

    2011-11-23

    Some pulsars have their maximum observable energy output in the gamma-ray band, offering the possibility of using these high-energy photons as probes of the particle acceleration and interaction processes in pulsar magnetospheres. After an extended hiatus between satellite missions, the recently-launched AGILE mission and the upcoming Gamma-ray Large Area Space Telescope (GLAST) Large Area Telescope (LAT) will allow gamma-ray tests of the theoretical models developed based on past discoveries. With its greatly improved sensitivity, better angular resolution, and larger energy reach than older instruments, GLAST LAT should detect dozens to hundreds of new gamma-ray pulsars and measure luminosities, light curves, and phase-resolved spectra with unprecedented resolution. It will also have the potential to find radio-quiet pulsars like Geminga, using blind search techniques. Cooperation with radio and X-ray pulsar astronomers is an important aspect of the LAT team's planning for pulsar studies.

  18. Processing of gamma-ray spectrometric logs

    International Nuclear Information System (INIS)

    Umiastowski, K.; Dumesnil, P.

    1984-10-01

    CEA (Commissariat a l'Energie Atomique) has developped a gamma-ray spectrometric tool, containing an analog-to-digital converter. This new tool permits to perform very precise uranium logs (natural gamma-ray spectrometry), neutron activation logs and litho-density logs (gamma-gamma spectrometric logs). Specific processing methods were developped to treate the particular problems of down-hole gamma-ray spectrometry. Extraction of the characteristic gamma-ray peak, even if they are superposed on the background radiation of very high intensity, is possible. This processing methode enables also to obtain geological informations contained in the continuous background of the spectrum. Computer programs are written in high level language for SIRIUS (VICTOR) and APOLLO computers. Exemples of uranium and neutron activation logs treatment are presented [fr

  19. Gamma ray astronomy with COS-B

    International Nuclear Information System (INIS)

    Swanenburg, B.N.

    1981-01-01

    Observational results in the field of gamma-ray astronomy that have been obtained to date with the COS-B satellite are discussed and questions raised by these observations are summarized. Following a brief review of the instrumental characteristics of COS-B and the extent of COS-B gamma-ray coverage of the sky, particular attention is given to the questions raised by the discovery of many unidentified gamma-ray sources with no apparent optical, X-ray or radio counterparts and the detection of high-energy gamma radiation from the quasar 3C 273, which suggests the role of gamma-ray emission in the creation of other radiation

  20. Thermal neutron capture gamma-rays

    International Nuclear Information System (INIS)

    Tuli, J.K.

    1983-01-01

    The energy and intensity of gamma rays as seen in thermal neutron capture are presented. Only those (n,α), E = thermal, reactions for which the residual nucleus mass number is greater than or equal to 45 are included. These correspond to evaluations published in Nuclear Data Sheets. The publication source data are contained in the Evaluated Nuclear Structure Data File (ENSDF). The data presented here do not involve any additional evaluation. Appendix I lists all the residual nuclides for which the data are included here. Appendix II gives a cumulated index to A-chain evaluations including the year of publication. The capture gamma ray data are given in two tables - the Table 1 is the list of all gamma rays seen in (n,#betta#) reaction given in the order of increasing energy; the Table II lists the gamma rays according to the nuclide

  1. Gamma ray auto absorption correction evaluation methodology

    International Nuclear Information System (INIS)

    Gugiu, Daniela; Roth, Csaba; Ghinescu, Alecse

    2010-01-01

    Neutron activation analysis (NAA) is a well established nuclear technique, suited to investigate the microstructural or elemental composition and can be applied to studies of a large variety of samples. The work with large samples involves, beside the development of large irradiation devices with well know neutron field characteristics, the knowledge of perturbing phenomena and adequate evaluation of correction factors like: neutron self shielding, extended source correction, gamma ray auto absorption. The objective of the works presented in this paper is to validate an appropriate methodology for gamma ray auto absorption correction evaluation for large inhomogeneous samples. For this purpose a benchmark experiment has been defined - a simple gamma ray transmission experiment, easy to be reproduced. The gamma ray attenuation in pottery samples has been measured and computed using MCNP5 code. The results show a good agreement between the computed and measured values, proving that the proposed methodology is able to evaluate the correction factors. (authors)

  2. Observations of gamma-ray bursts

    International Nuclear Information System (INIS)

    Strong, I.B.; Klebesadel, R.W.; Evans, W.D.

    1975-01-01

    Observational data on gamma-ray bursts are reviewed. Information is grouped into temporal properties, energy fluxes and spectral properties, and directions and distributions of the sources in space. (BJG)

  3. Gamma-rays from decaying dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Bertone, G. [Paris-6 Univ., 75 (France). Inst. d' Astrophysique; Buchmueller, W.; Covi, L.; Ibarra, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2007-10-15

    We study the prospects for detecting gamma-rays from decaying Dark Matter (DM), focusing in particular on gravitino DM in R-parity breaking vacua. Given the substantially different angular distribution of the predicted gamma-ray signal with respect to the case of annihilating DM, and the relatively poor (of order 0.1 ) angular resolution of gamma-ray detectors, the best strategy for detection is in this case to look for an exotic contribution to the gamma-ray flux at high galactic latitudes, where the decaying DM contribution would resemble an astrophysical extragalactic component, similar to the one inferred by EGRET observations. Upcoming experiments such as GLAST and AMS-02 may identify this exotic contribution and discriminate it from astrophysical sources, or place significant constraints on the mass and lifetime of DM particles. (orig.)

  4. Gamma-ray tracking: Characterisation of the AGATA symmetric prototype detectors

    International Nuclear Information System (INIS)

    Boston, A.J.; Boston, H.C.; Cresswell, J.R.; Dimmock, M.R.; Nelson, L.; Nolan, P.J.; Rigby, S.; Lazarus, I.; Simpson, J.; Medina, P.; Santos, C.; Parisel, C.

    2007-01-01

    Each major technical advance in gamma-ray detection devices has resulted in significant new insights into the structure of atomic nuclei. The next major step in gamma-ray spectroscopy involves achieving the goal of a 4pi ball of Germanium detectors by using the technique of gamma-ray energy tracking in electrically segmented Germanium crystals. The resulting spectrometer will have an unparalleled level of detection power for nuclear electromagnetic radiation. Collaborations have been established in Europe (AGATA) [J. Simpson, Acta Phys. Pol. B 36 (2005) 1383. ] and the USA (GRETA/GRETINA) to build gamma-ray tracking spectrometers. This paper discusses the performance of the AGATA (Advanced Gamma Tracking Array) symmetric prototype detectors that have been tested at University of Liverpool. The use of a fully digital data acquisition system has allowed detector charge pulse shapes from a selection of well defined photon interaction positions to be analysed, yielding important information on the position sensitivity of the detector

  5. Gamma-ray tracking: Characterisation of the AGATA symmetric prototype detectors

    Energy Technology Data Exchange (ETDEWEB)

    Boston, A.J. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom)]. E-mail: ajboston@liv.ac.uk; Boston, H.C. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Cresswell, J.R. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Dimmock, M.R. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Nelson, L. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Nolan, P.J. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Rigby, S. [Oliver Lodge Laboratory, University of Liverpool, Oxford Street, Liverpool L69 7ZE (United Kingdom); Lazarus, I. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Simpson, J. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Medina, P. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France); Santos, C. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France); Parisel, C. [Institut de Recherches Subatomiques, Strasbourg BP28 67037 (France)

    2007-08-15

    Each major technical advance in gamma-ray detection devices has resulted in significant new insights into the structure of atomic nuclei. The next major step in gamma-ray spectroscopy involves achieving the goal of a 4pi ball of Germanium detectors by using the technique of gamma-ray energy tracking in electrically segmented Germanium crystals. The resulting spectrometer will have an unparalleled level of detection power for nuclear electromagnetic radiation. Collaborations have been established in Europe (AGATA) [J. Simpson, Acta Phys. Pol. B 36 (2005) 1383. ] and the USA (GRETA/GRETINA) to build gamma-ray tracking spectrometers. This paper discusses the performance of the AGATA (Advanced Gamma Tracking Array) symmetric prototype detectors that have been tested at University of Liverpool. The use of a fully digital data acquisition system has allowed detector charge pulse shapes from a selection of well defined photon interaction positions to be analysed, yielding important information on the position sensitivity of the detector.

  6. Possible galactic origin of. gamma. -ray bursts

    Energy Technology Data Exchange (ETDEWEB)

    Manchanda, R K; Ramsden, D [Southampton Univ. (UK). Dept. of Physics

    1977-03-31

    It is stated that extragalactic models for the origin of non-solar ..gamma..-ray bursts include supernova bursts in remote galaxies, and the collapse of the cores of active stars, whilst galactic models are based on flare stars, thermonuclear explosions in neutron stars and the sudden accretion of cometary gas on to neutron stars. The acceptability of any of these models may be tested by the observed size spectrum of the ..gamma..-ray bursts. The extragalactic models predict a power law spectrum with number index -1.5, whilst for the galactic models the number index will be -1. Experimental data on ..gamma..-ray bursts is, however, still meagre, and so far only 44 confirmed events have been recorded by satellite-borne instruments. The number spectrum of the observed ..gamma..-ray bursts indicates that the observed distribution for events with an energy < 10/sup -4/ erg/cm/sup 2/ is flat; this makes the choice of any model completely arbitrary. An analysis of the observed ..gamma..-ray events is here presented that suggests very interesting possibilities for their origin. There appears to be a preferred mean energy for ..gamma..-ray bursts; some 90% of the recorded events show a mean energy between 5 x 10/sup -5/ and 5 x 10/sup -4/ erg/cm/sup 2/, contrary to the predicted characteristics of the number spectrum of various models. A remarkable similarity is found between the distribution of ..gamma..-ray bursts and that of supernova remnants, suggesting a genetic relationship between the two and the galactic origin of the ..gamma..-ray bursts, and the burst source could be identified with completely run down neutron stars, formed during supernova explosions.

  7. Magic gamma rays, extra-atmospheric source

    International Nuclear Information System (INIS)

    Bolufer, P.

    2010-01-01

    Without the atmospheric layer, the cosmos radiation would kill every living, our planet would be like the moon. The cosmic gamma ray to collide with gases in land cover, as it is disintegrated. They are harmless, they form a cone of light that points to the cosmic source comes from. On April 25, 2009 was born on the island of Palma Magic II and Magic I the best observer of atmospheric gamma rays of low intensity. (Author)

  8. Gamma Ray Bursts-Afterglows and Counterparts

    Science.gov (United States)

    Fishman, Gerald J

    1998-01-01

    Several breakthrough discoveries were made last year of x-ray, optical and radio afterglows and counterparts to gamma-ray bursts, and a redshift has been associated with at least one of these. These discoveries were made possible by the fast, accurate gamma-ray burst locations of the BeppoSAX satellite. It is now generally believed that the burst sources are at cosmological distances and that they represent the most powerful explosions in the Universe. These observations also open new possibilities for the study of early star formation, the physics of extreme conditions and perhaps even cosmology. This session will concentrate on recent x-ray, optical and radio afterglow observations of gamma-ray bursts, associated redshift measurements, and counterpart observations. Several review and theory talks will also be presented, along with a summary of the astrophysical implications of the observations. There will be additional poster contributions on observations of gamma-ray burst source locations at wavelengths other than gamma rays. Posters are also solicited that describe new observational capabilities for rapid follow-up observations of gamma-ray bursts.

  9. The Einstein@Home Gamma-ray Pulsar Survey. II. Source Selection, Spectral Analysis, and Multiwavelength Follow-up

    Science.gov (United States)

    Wu, J.; Clark, C. J.; Pletsch, H. J.; Guillemot, L.; Johnson, T. J.; Torne, P.; Champion, D. J.; Deneva, J.; Ray, P. S.; Salvetti, D.; Kramer, M.; Aulbert, C.; Beer, C.; Bhattacharyya, B.; Bock, O.; Camilo, F.; Cognard, I.; Cuéllar, A.; Eggenstein, H. B.; Fehrmann, H.; Ferrara, E. C.; Kerr, M.; Machenschalk, B.; Ransom, S. M.; Sanpa-Arsa, S.; Wood, K.

    2018-02-01

    We report on the analysis of 13 gamma-ray pulsars discovered in the Einstein@Home blind search survey using Fermi Large Area Telescope (LAT) Pass 8 data. The 13 new gamma-ray pulsars were discovered by searching 118 unassociated LAT sources from the third LAT source catalog (3FGL), selected using the Gaussian Mixture Model machine-learning algorithm on the basis of their gamma-ray emission properties being suggestive of pulsar magnetospheric emission. The new gamma-ray pulsars have pulse profiles and spectral properties similar to those of previously detected young gamma-ray pulsars. Follow-up radio observations have revealed faint radio pulsations from two of the newly discovered pulsars and enabled us to derive upper limits on the radio emission from the others, demonstrating that they are likely radio-quiet gamma-ray pulsars. We also present results from modeling the gamma-ray pulse profiles and radio profiles, if available, using different geometric emission models of pulsars. The high discovery rate of this survey, despite the increasing difficulty of blind pulsar searches in gamma rays, suggests that new systematic surveys such as presented in this article should be continued when new LAT source catalogs become available.

  10. Detection of gamma rays using scintillation optical fibers

    International Nuclear Information System (INIS)

    Park, J. W.; Hong, S. B.

    2002-01-01

    Scintillating optical fibers have several advantages over other conventional materials used for radiation detection. We have used glass and plastic scintillating fibers to detect gamma rays emitted from 60 Co and 137 Cs, and beta rays from 90 Sr. The sensors are constructed of single strand or multi-strand fibers of 1 mm diameter. The glass scintillating fiber used contains cerium-activated lithium-silicate as scintillating material and the plastic scintillating fiber used is Bicron model BCF-12. In this paper, we report the pulse-height spectra obtained by both sensor types, and analyze them in the aspect of their usability for radiation detectors. Our investigation suggests that the glass fiber can be used to develop gamma ray detectors which will function in high and low gamma ray flux environments. Use of the sensor for the beta ray detection was not satisfactory. The plastic fiber sensor did not work satisfactorily for the weak gamma sources, but did produce somewhat promising results. The scintillating plastic fiber offers some feasibility as beta ray sensor material

  11. Gamma ray imager on the DIII-D tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Pace, D. C., E-mail: pacedc@fusion.gat.com; Taussig, D.; Eidietis, N. W.; Van Zeeland, M. A.; Watkins, M. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Cooper, C. M. [Oak Ridge Associated Universities, Oak Ridge, Tennessee 37830 (United States); Hollmann, E. M. [University of California-San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Riso, V. [State University of New York-Buffalo, 12 Capen Hall, Buffalo, New York 14260-1660 (United States)

    2016-04-15

    A gamma ray camera is built for the DIII-D tokamak [J. Luxon, Nucl. Fusion 42, 614 (2002)] that provides spatial localization and energy resolution of gamma flux by combining a lead pinhole camera with custom-built detectors and optimized viewing geometry. This diagnostic system is installed on the outer midplane of the tokamak such that its 123 collimated sightlines extend across the tokamak radius while also covering most of the vertical extent of the plasma volume. A set of 30 bismuth germanate detectors can be secured in any of the available sightlines, allowing for customizable coverage in experiments with runaway electrons in the energy range of 1–60 MeV. Commissioning of the gamma ray imager includes the quantification of electromagnetic noise sources in the tokamak machine hall and a measurement of the energy spectrum of background gamma radiation. First measurements of gamma rays coming from the plasma provide a suitable testbed for implementing pulse height analysis that provides the energy of detected gamma photons.

  12. A gamma-ray spectrometer system for fusion applications

    CERN Document Server

    Esposito, B; Kaschuck, Y A; Martin-Solis, J R; Portnov, D V

    2002-01-01

    A NaI scintillator spectrometer system for the measurement of gamma-ray spectra in tokamak discharges has been developed and installed on the Frascati Tokamak Upgrade. Two NaI scintillators are viewing the plasma at two different angles with respect to the equatorial plane. The main features of the spectrometer system (energy range: 0.3-23 MeV) and of the unfolding technique used to restore physical spectra from the pulse-height distributions are described: a method of solution with regularisation for matrix equations of large size, allowing to process count distributions with significant statistical noise, has been developed. A dedicated software, portable to any platform, has been written both for the acquisition and the analysis of the spectra. The typical gamma-ray spectra recorded in hydrogen and deuterium discharges, also with additional heating, are presented and discussed; two components have been observed: (a) thick-target Bremsstrahlung gamma-rays produced by runaway electrons hitting the Inconel po...

  13. Lightning leader models of terrestrial gamma-ray flashes

    Science.gov (United States)

    Dwyer, J. R.; Liu, N.; Ihaddadene, K. M. A.

    2017-12-01

    Terrestrial gamma-ray flashes (TGFs) are bright sub-millisecond bursts of gamma rays that originate from thunderstorms. Because lightning leaders near the ground have been observed to emit x-rays, presumably due to runaway electron production in the high-field regions near the leader tips, models of TGFs have been developed by several groups that assume a similar production mechanism of runaway electrons from lightning leaders propagating through thunderclouds. However, it remains unclear exactly how and where these runaway electrons are produced, since lightning propagation at thunderstorm altitudes remains poorly understood. In addition, it is not obvious how to connect the observed behavior of the x-ray production from lightning near the ground with the properties of TGFs. For example, it is not clear how to relate the time structure of the x-ray emission near the ground to that of TGFs, since x-rays from stepped leaders near the ground are usually produced in a series of sub-microsecond bursts, but TGFs are usually observed as much longer pulses without clear substructures, at sub-microsecond timescales or otherwise. In this presentation, spacecraft observations of TGFs, ground-based observations of x-rays from lightning and laboratory sparks, and Monte Carlo and PIC simulations of runaway electron and gamma ray production and propagation will be used to constrain the lightning leader models of TGFs.

  14. Are we observing Lorentz violation in gamma ray bursts?

    International Nuclear Information System (INIS)

    Pavlopoulos, Theodore G.

    2005-01-01

    From recent observations of gamma-ray bursts (GRBs), it appears that spectral time lags between higher-energy gamma rays photons and lower-energy photons vary with energy difference and time (distance) traveled. These lags appear to be smaller for the most luminous (close) bursts but larger for the fainter (farther away) bursts. From this observation, it has been suggested that it might be possible to determine the distance (L) these bursts have traveled from these time lags alone, without performing any red-shift measurements. These observed spreads (dispersion) of high-energy electromagnetic pulses of different energies with time contradict the special theory of relativity (STR). However, extended theories (ET) of the STR have been developed that contain a dispersive term, predicting the above observations. An example of such an ET is presented, allowing us to derive a relationship between time lags of gamma rays of different energies and distance L traveled from their origin. In addition, this theory predicts the origin of X-ray flashes

  15. The relativistic feedback discharge model of terrestrial gamma ray flashes

    Science.gov (United States)

    Dwyer, Joseph R.

    2012-02-01

    As thunderclouds charge, the large-scale fields may approach the relativistic feedback threshold, above which the production of relativistic runaway electron avalanches becomes self-sustaining through the generation of backward propagating runaway positrons and backscattered X-rays. Positive intracloud (IC) lightning may force the large-scale electric fields inside thunderclouds above the relativistic feedback threshold, causing the number of runaway electrons, and the resulting X-ray and gamma ray emission, to grow exponentially, producing very large fluxes of energetic radiation. As the flux of runaway electrons increases, ionization eventually causes the electric field to discharge, bringing the field below the relativistic feedback threshold again and reducing the flux of runaway electrons. These processes are investigated with a new model that includes the production, propagation, diffusion, and avalanche multiplication of runaway electrons; the production and propagation of X-rays and gamma rays; and the production, propagation, and annihilation of runaway positrons. In this model, referred to as the relativistic feedback discharge model, the large-scale electric fields are calculated self-consistently from the charge motion of the drifting low-energy electrons and ions, produced from the ionization of air by the runaway electrons, including two- and three-body attachment and recombination. Simulation results show that when relativistic feedback is considered, bright gamma ray flashes are a natural consequence of upward +IC lightning propagating in large-scale thundercloud fields. Furthermore, these flashes have the same time structures, including both single and multiple pulses, intensities, angular distributions, current moments, and energy spectra as terrestrial gamma ray flashes, and produce large current moments that should be observable in radio waves.

  16. The Gamma-Ray Imager GRI

    Science.gov (United States)

    Wunderer, Cornelia B.; GRI Collaboration

    2008-03-01

    Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are accelerated to extreme relativistic energies by mechanisms which are still poorly understood, and nuclear reactions are synthesizing the basic constituents of our world. Cosmic accelerators and cosmic explosions are major science themes that are addressed in the gamma-ray regime. ESA's INTEGRAL observatory currently provides the astronomical community with a unique tool to investigate the sky up to MeV energies and hundreds of sources, new classes of objects, extraordinary views of antimatter annihilation in our Galaxy, and fingerprints of recent nucleosynthesis processes have been discovered. NASA's GLAST mission will similarly take the next step in surveying the high-energy ( GeV) sky, and NuSTAR will pioneer focusing observations at hard X-ray energies (to 80 keV). There will be clearly a growing need to perform deeper, more focused investigations of gamma-ray sources in the 100-keV to MeV regime. Recent technological advances in the domain of gamma-ray focusing using Laue diffraction and multilayer-coated mirror techniques have paved the way towards a gamma-ray mission, providing major improvements compared to past missions regarding sensitivity and angular resolution. Such a future Gamma-Ray Imager will allow the study of particle acceleration processes and explosion physics in unprecedented detail, providing essential clues on the innermost nature of the most violent and most energetic processes in the Universe.

  17. A Unique Outside Neutron and Gamma Ray Instrumentation Development Test Facility at NASA's Goddard Space Flight Center

    Science.gov (United States)

    Bodnarik, J.; Evans, L.; Floyd, S.; Lim, L.; McClanahan, T.; Namkung, M.; Parsons, A.; Schweitzer, J.; Starr, R.; Trombka, J.

    2010-01-01

    An outside neutron and gamma ray instrumentation test facility has been constructed at NASA's Goddard Space Flight Center (GSFC) to evaluate conceptual designs of gamma ray and neutron systems that we intend to propose for future planetary lander and rover missions. We will describe this test facility and its current capabilities for operation of planetary in situ instrumentation, utilizing a l4 MeV pulsed neutron generator as the gamma ray excitation source with gamma ray and neutron detectors, in an open field with the ability to remotely monitor and operate experiments from a safe distance at an on-site building. The advantage of a permanent test facility with the ability to operate a neutron generator outside and the flexibility to modify testing configurations is essential for efficient testing of this type of technology. Until now, there have been no outdoor test facilities for realistically testing neutron and gamma ray instruments planned for solar system exploration

  18. Pocket PC-based portable gamma-ray spectrometer

    Directory of Open Access Journals (Sweden)

    Kamontip Ploykrachang

    2011-04-01

    Full Text Available A portable gamma-ray spectrometer based on a Pocket PC has been developed. A 12-bit pipeline analog-to-digitalconverter (ADC associated with an implemented pulse height histogram function on field programmable gate array (FPGAoperating at 15 MHz is employed for pulse height analysis from built-in pulse amplifier. The system, which interfaces withthe Pocket PC via an enhanced RS-232 serial port under the microcontroller facilitation, is utilized for spectrum acquisition,display and analysis. The pulse height analysis capability of the system was tested and it was found that the ADC integralnonlinearity of ±0.45% was obtained with the throughput rate at 160 kcps. The overall system performance was tested usinga PIN photodiode-CsI(Tl crystal coupled scintillation detector and gamma standard radioactive sources of Cs-137 andCo-60. Low cost and the compact system size as a result of the implemented logical function are also discussed.

  19. Localization of Gamma-Ray Bursts Using the Fermi Gamma-Ray Burst Monitor

    NARCIS (Netherlands)

    Connaughton, V.; Briggs, M.S.; Goldstein, A.; Meegan, C.A.; Paciesas, W.S.; Preece, R.D.; Wilson-Hodge, C.A.; Gibby, M.H.; Greiner, J.; Gruber, D.; Jenke, P.; Kippen, R.M.; Pelassa, V.; Xiong, S.; Yu, H-F.; Bhat, P.N.; Burgess, J.M.; Byrne, D.; Fitzpatrick, G.; Foley, S.; Giles, M.M.; Guiriec, S.; van der Horst, A.J.; von Kienlin, A.; McBreen, S.; McGlynn, S.; Tierney, D.; Zhang, B..B.

    2015-01-01

    The Fermi Gamma-ray Burst Monitor (GBM) has detected over 1400 gamma-ray bursts (GRBs) since it began science operations in 2008 July. We use a subset of over 300 GRBs localized by instruments such as Swift, the Fermi Large Area Telescope, INTEGRAL, and MAXI, or through triangulations from the

  20. Gamma-Ray Lenses for Astrophysics-and the Gamma-Ray Imager Mission GRI

    DEFF Research Database (Denmark)

    Wunderer, C. B.; Ballmoos, P. V.; Barriere, N.

    2009-01-01

    Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are acc...

  1. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  2. Optimum filter-based discrimination of neutrons and gamma rays

    International Nuclear Information System (INIS)

    Amiri, Moslem; Prenosil, Vaclav; Cvachovec, Frantisek

    2015-01-01

    An optimum filter-based method for discrimination of neutrons and gamma-rays in a mixed radiation field is presented. The existing filter-based implementations of discriminators require sample pulse responses in advance of the experiment run to build the filter coefficients, which makes them less practical. Our novel technique creates the coefficients during the experiment and improves their quality gradually. Applied to several sets of mixed neutron and photon signals obtained through different digitizers using stilbene scintillator, this approach is analyzed and its discrimination quality is measured. (authors)

  3. Selective Beta and Gamma-ray Discrimination by CdWO{sub 4} and PlasticScintillator

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Jun Woo; Kim, Hee Reyoung [Dept. of Nuclear Engineering, Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2017-04-15

    Radiation monitoring technique has been used for monitoring of decommissioning site of nuclear facility, radioactive waste disposal site, or in case of radioactivity accident. For rapid measurement of gamma-ray and beta-ray, many portable radiation detectors were developed but they are sensitive to specific radiation type. For example, portable detectors using NaI(Tl) or high purity germanium (HPGe) are suitable to detect gamma-ray. Otherwise, Geiger-müller (GM) tube or ionization chamber are suitable to detect all-types of radiation but it is hard to determine which particle is detected in the detector. In this reason, phoswich detectors for discrimination of beta-ray and gamma-ray were developed by using pulse shape discrimination. In this study, another approach to discriminate the beta-ray and gamma-ray is carried out. Two scintillators are used, cadmium tungstate (CdWO{sub 4}) and plastic scintillator. They have huge difference in their effective atomic number and mass density, thus they have huge difference in their gamma-ray sensitivity while the sensitivity of beta-ray is similar. The characterization of beta-ray and gamma-ray discrimination by using this characteristics is include. A technique of discrimination between beta-ray and gamma-ray was suggested. The method was verified by Monte Carlo simulation and experiment. This work showed feasibility on in field measurement of radiation with discrimination of beta-ray and gamma-ray.

  4. Fuzzy correlations of gamma-ray bursts

    International Nuclear Information System (INIS)

    Hartmann, D.H.; Linder, E.V.; Blumenthal, G.R.

    1991-01-01

    The origin of gamma-ray bursts is not known, both in the sense of the nature of the source emitting the radiation and literally, the position of the burst on the sky. Lacking unambiguously identified counterparts in any wavelength band studied to date, statistical approaches are required to determine the burster distance scale. Angular correlation analysis is one of the most powerful tools in this regard. However, poor detector resolution gives large localization errors, effectively beam smearing the positions. The resulting fuzzy angular correlation function is investigated and the generic isotropization that smearing induces on any intrinsic clustering is discussed. In particular, the extent to which gamma-ray burst observations by the BATSE detector aboard the Gamma-Ray Observatory might recover an intrinsic source correlation is investigated. 16 refs

  5. Prompt Gamma Ray Spectroscopy for process monitoring

    International Nuclear Information System (INIS)

    Zoller, W.H.; Holmes, J.L.

    1991-01-01

    Prompt Gamma Ray Spectroscopy (PGRS) is a very powerful analytical technique able to measure many metallic, contamination problem elements. The technique involves measurement of gamma rays that are emitted by nuclei upon capturing a neutron. This method is sensitive not only to the target element but also to the particular isotope of that element. PGRS is capable of measuring dissolved metal ions in a flowing system. In the field, isotopic neutron sources are used to produce the desired neutron flux ( 252 Cf can produce neutron flux of the order of 10 8 neutrons/cm 2 --sec.). Due to high penetrating power of gamma radiation, high efficiency gamma ray detectors can be placed in an appropriate geometry to maximize sensitivity, providing real-time monitoring with low detection level capabilities

  6. Librarian driven analysis of gamma ray spectra

    International Nuclear Information System (INIS)

    Kondrashov, V.; Petersone, I.

    2002-01-01

    For a set of a priori given radionuclides extracted from a general nuclide data library, the authors use median estimates of the gamma-peak areas and estimates of their errors to produce a list of possible radionuclides matching gamma ray line(s). The identification of a given radionuclide is obtained by searching for a match with the energy information of a database. This procedure is performed in an interactive graphic mode by markers that superimpose, on the spectral data, the energy information and yields provided by a general gamma ray data library. This library of experimental data includes approximately 17,000 gamma ray energy lines related to 756 known gamma emitter radionuclides listed by the ICRP. (author)

  7. Technology Needs for Gamma Ray Astronomy

    Science.gov (United States)

    Gehrels, Neil

    2011-01-01

    Gamma ray astronomy is currently in an exciting period of multiple missions and a wealth of data. Results from INTEGRAL, Fermi, AGILE, Suzaku and Swift are making large contributions to our knowledge of high energy processes in the universe. The advances are due to new detector and imaging technologies. The steps to date have been from scintillators to solid state detectors for sensors and from light buckets to coded aperture masks and pair telescopes for imagers. A key direction for the future is toward focusing telescopes pushing into the hard X-ray regime and Compton telescopes and pair telescopes with fine spatial resolution for medium and high energy gamma rays. These technologies will provide finer imaging of gamma-ray sources. Importantly, they will also enable large steps forward in sensitivity by reducing background.

  8. Very high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Weekes, T.C.

    1988-01-01

    Current interest in gamma-ray astronomy at energies above 100 GeV comes from the identification of Cygnus X-3 and other X-ray binaries as sources. In addition there are reports of emission from radio pulsars and a variety of other objects. The statistical significance of many of the observations is not high and many reported effects await confirmation, but there are a sufficient number of independent reports that very high energy gamma-ray astronomy must now be considered to have an observational basis. The observations are summarized with particular emphasis on those reported since 1980. The techniques used - the detection of small air showers using the secondary photons and particles at ground level - are unusual and are described. Future prospects for the field are discussed in relation to new ground-based experiments, satellite gamma-ray studies and proposed neutrino astronomy experiments. (orig.) With 296 refs

  9. Evaluation of gamma-ray intensities

    International Nuclear Information System (INIS)

    Yoshizawa, Yasukazu; Inoue, Hikaru; Hoshi, Masaharu; Shizuma, Kiyoshi; Iwata, Yosei.

    1980-04-01

    Relative intensities and intensities per decay of gamma rays were evaluated for 16 nuclides, 22 Na, 24 Na, 46 Sc, 54 Mn, 60 Co, 85 Sr, 88 Y, 95 Nb, sup(108m)Ag, 134 Cs, 133 Ba, 139 Ce, sup(180m)Hf, 198 Au, 203 Hg and 207 Bi. For most of these nuclides disintegration rates can be determined by means of β-γ or X-γ coincidence method. Since decay schemes of these nuclides are established, intensities per decay of strong gamma rays were accurately evaluated by using weak beta-ray branching ratios, relative gamma-ray intensities and internal conversion coefficients. Half-lives of the nuclides were also evaluated. Use of the nuclides, therefore, are recommended for precision intensity calibration of the detectors. (author)

  10. Positronium Annihilation Gamma Ray Laser

    Science.gov (United States)

    2009-07-01

    90 deg F using a 75-ohm resistor and the program maintained the temperature at 90 deg F with an inaccuracy of ±1.0 deg. The thermocouple was...pulse train, and propagating the multiple beams from the laser table and enclosure into the positron beam vacuum chamber using piezo - controlled

  11. Gamma-ray standards for detector calibration

    International Nuclear Information System (INIS)

    Lorenz, A.

    1985-10-01

    The proceeedings are reported of a Consultants' Meeting on Gamma-ray Standards for Detector Calibration, held at the CEN, Grenoble in France, from 30-31 May 1985. The meeting provided a forum to assess the requirements for a suitable file to be used internationally for the calibration of X- and gamma-ray detectors. A provisional list of nuclides was drawn up, and an initial assessment of the status of the required data was agreed to be performed by the participants before the end of 1985. (author)

  12. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1991-01-01

    The Whipple Observatory High Resolution Camera will be used in a vigorous program of observations to search for new sources of very-high-energy gamma rays. In addition, a search for antimatter using the moon-earth system as an ion spectrometer will be begun. The first phase of GRANITE, the new 37-element 11-m camera, will be concluded with first light scheduled for September, 1991. The two cameras will operate in support of the Gamma Ray Observatory mission in the winter of 1991/2

  13. Gamma ray spectroscopy monitoring method and apparatus

    Science.gov (United States)

    Stagg, William R; Policke, Timothy A

    2017-05-16

    The present invention relates generally to the field of gamma ray spectroscopy monitoring and a system for accomplishing same to monitor one or more aspects of various isotope production processes. In one embodiment, the present invention relates to a monitoring system, and method of utilizing same, for monitoring one or more aspects of an isotope production process where the monitoring system comprises: (A) at least one sample cell; (B) at least one measuring port; (C) at least one adjustable collimator device; (D) at least one shutter; and (E) at least one high resolution gamma ray spectrometer.

  14. Nuclear Forensics using Gamma-ray Spectroscopy

    Directory of Open Access Journals (Sweden)

    Norman E. B.

    2016-01-01

    Full Text Available Much of George Dracoulis’s research career was devoted to utilising gamma-ray spectroscopy in fundamental studies in nuclear physics. This same technology is useful in a wide range of applications in the area of nuclear forensics. Over the last several years, our research group has made use of both high- and low-resolution gamma-ray spectrometers to: identify the first sample of plutonium large enough to be weighed; determine the yield of the Trinity nuclear explosion; measure fission fragment yields as a function of target nucleus and neutron energy; and observe fallout in the U. S. from the Fukushima nuclear reactor accident.

  15. Gamma-ray surveys in uranium exploration

    International Nuclear Information System (INIS)

    1979-01-01

    This report is intended to provide newcomers to uranium exploration with an up-to-date statement of the principal factors to be considered in planning and using gamma-ray surveys. Since the report incorporates the results of recent research, and since its preparation was influenced by the cumulative experience of its contributors, it should also be useful to those who already have some knowledge of radioactivity surveys and methods. The intention is that the information and explanations given in the report will make it possible for gamma-ray surveys to be used in the most efficient way for a given exploration task

  16. Comparisons between digital gamma-ray spectrometer (DSPec) and standard nuclear instrumentation methods (NIM) systems

    International Nuclear Information System (INIS)

    Vo, D.T.; Russo, P.A.; Sampson, T.E.

    1998-03-01

    Safeguards isotopic measurements require the best spectrometer systems with excellent resolution, stability and throughput. Up until about a year ago, gamma ray spectroscopy has always been done using the analog amplifier, which processes the pulses from the preamplifier to remove the noise, reject the pile up signals, and shape the signals into some desirable form before sending them to the analog to digital converter (ADC) to be digitized. In late 1996, EG and G Ortec introduced a digital gamma ray spectrometer (DSPec) which uses digital technology to analyze the preamplifiers' pulses from all types of germanium and silicon detectors. Considering its performance, digital based spectroscopy may become the way of future gamma ray spectroscopy

  17. A comparative study for the correction of random gamma ray summing effect in HPGe - detector based gamma ray spectrometry

    International Nuclear Information System (INIS)

    Rajput, M.U.

    2007-01-01

    Random coincidence summing of gamma rays is a potential source of errors in gamma ray spectrometry. The effect has a little significance at low counting rates but becomes increasingly important at high counting rates. Careful corrections are required to avoid the introduction of errors in quantitative based measurements. Several correction methods have been proposed. The most common is the pulser method that requires a precision Pulse Generator in the electronic circuitry to provide reference peak. In this work, a comparative study has been carried out both by using pulser method and utilizing radioactive source based method. This study makes the use of 137 Cs radionuclide as a fixed source and the 241 Am as a varied source. The dead time of the system has been varied and the acquisition of the spectra at each position yielded the resulted peak areas with pulsed pile up losses. The linear regression of the data has been carried out. The study has resulted in establishing a consistent factor that can be used as the characteristic of the detector and thereby removes the need of the calibrated or precise Pulse Generator. (author)

  18. ICIT contribution to JET gamma-ray diagnostics enhancement

    International Nuclear Information System (INIS)

    Soare, S.; Curuia, M.; Zoita, V.

    2010-01-01

    Full text: Gamma-ray emission of tokamak plasmas is the result of the interaction of fast ions (fusion reaction products, including alpha particles, NBI ions, ICRH-accelerated ions) with main plasma impurities (e.g., carbon, beryllium). Gamma-ray diagnostics involve both gamma-ray imaging (cameras) and gamma-ray spectrometry (spectrometers). For the JET tokamak, gamma-ray diagnostics have been used to provide information on the characteristics of the fast ion population in plasmas. Two gamma-ray diagnostics enhancements project have been launched by JET and the MEdC/EURATOM Association has agreed to lead both of them with ICIT as projects leader. (authors)

  19. Found: A Galaxy's Missing Gamma Rays

    Science.gov (United States)

    Kohler, Susanna

    2016-04-01

    Recent reanalysis of data from the Fermi Gamma-ray Space Telescope has resulted in the first detection of high-energy gamma rays emitted from a nearby galaxy. This discovery reveals more about how supernovae interact with their environments.Colliding Supernova RemnantAfter a stellar explosion, the supernovas ejecta expand, eventually encountering the ambient interstellar medium. According to models, this generates a strong shock, and a fraction of the kinetic energy of the ejecta is transferred into cosmic rays high-energy radiation composed primarily of protons and atomic nuclei. Much is still unknown about this process, however. One open question is: what fraction of the supernovas explosion power goes into accelerating these cosmic rays?In theory, one way to answer this is by looking for gamma rays. In a starburst galaxy, the collision of the supernova-accelerated cosmic rays with the dense interstellar medium is predicted to produce high-energy gamma rays. That radiation should then escape the galaxy and be visible to us.Pass 8 to the RescueObservational tests of this model, however, have beenstumped by Arp 220. This nearby ultraluminous infrared galaxy is the product of a galaxy merger ~700 million years ago that fueled a frenzy of starbirth. Due to its dusty interior and extreme levels of star formation, Arp 220 has long been predicted to emit the gamma rays produced by supernova-accelerated cosmic rays. But though weve looked, gamma-ray emission has never been detected from this galaxy until now.In a recent study, a team of scientists led by Fang-Kun Peng (Nanjing University) reprocessed 7.5 years of Fermi observations using the new Pass 8 analysis software. The resulting increase in resolution revealed the first detection of GeV emission from Arp 220!Acceleration EfficiencyGamma-ray luminosity vs. total infrared luminosity for LAT-detected star-forming galaxies and Seyferts. Arp 220s luminosities are consistent with the scaling relation. [Peng et al. 2016

  20. VELOCIRAPTOR: An X-band photoinjector and linear accelerator for the production of Mono-Energetic {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, S.G., E-mail: anderson131@llnl.gov [Lawrence Livermore National Laboratory, 7000 East Ave., Livermore, CA 94551 (United States); Albert, F.; Bayramian, A.J.; Beer, G.; Bonanno, R.E.; Cross, R.R.; Deis, G.; Ebbers, C.A.; Gibson, D.J.; Hartemann, F.V.; Houck, T.L.; Marsh, R.A.; McNabb, D.P.; Messerly, M.J.; Scarpetti, R.D.; Shverdin, M.Y.; Siders, C.W.; Wu, S.S.; Barty, C.P.J. [Lawrence Livermore National Laboratory, 7000 East Ave., Livermore, CA 94551 (United States); Adolphsen, C.E. [SLAC National Accelerator Laboratory, 2575 Sand Hill Rd., Menlo Park, CA 94025 (United States); and others

    2011-11-21

    The rf photoinjector and linear accelerator in the Mono-Energetic Gamma-ray (MEGa-ray) facility at LLNL is presented. This machine uses 11.4 GHz rf technology to accelerate a high-brightness electron beam up to 250 MeV to produce MeV {gamma}-rays through Compton scattering with a Joule-class laser pulse. Compton scattering-based generation of high flux, narrow bandwidth {gamma}-rays places stringent requirements on the performance of the accelerator. The component parts of the accelerator are presented and their requirements described. Simulations of expected electron beam parameters and the resulting light source properties are presented.

  1. Gamma ray observations of the solar system

    International Nuclear Information System (INIS)

    1981-01-01

    Two general categories are discussed concerning the evolution of the solar system: the dualistic view, the planetesimal approach and the monistic view, the nebular hypothesis. The major points of each view are given and the models that are developed from these views are described. Possible applications of gamma ray astronomical observations to the question of the dynamic evolution of the solar system are discussed

  2. Gamma ray observations of the solar system

    Energy Technology Data Exchange (ETDEWEB)

    1981-01-01

    Two general categories are discussed concerning the evolution of the solar system: the dualistic view, the planetesimal approach and the monistic view, the nebular hypothesis. The major points of each view are given and the models that are developed from these views are described. Possible applications of gamma ray astronomical observations to the question of the dynamic evolution of the solar system are discussed.

  3. Gamma ray observations of the solar system

    Science.gov (United States)

    1981-01-01

    Two general categories are discussed concerning the evolution of the solar system: the dualistic view, the planetesimal approach; and the monistic view, the nebular hypothesis. The major points of each view are given and the models that are developed from these views are described. Possible applications of gamma ray astronomical observations to the question of the dynamic evolution of the solar system are discussed.

  4. Black Hole Accretion in Gamma Ray Bursts

    Directory of Open Access Journals (Sweden)

    Agnieszka Janiuk

    2017-02-01

    Full Text Available We study the structure and evolution of the hyperaccreting disks and outflows in the gamma ray bursts central engines. The torus around a stellar mass black hole is composed of free nucleons, Helium, electron-positron pairs, and is cooled by neutrino emission. Accretion of matter powers the relativistic jets, responsible for the gamma ray prompt emission. The significant number density of neutrons in the disk and outflowing material will cause subsequent formation of heavier nuclei. We study the process of nucleosynthesis and its possible observational consequences. We also apply our scenario to the recent observation of the gravitational wave signal, detected on 14 September 2015 by the two Advanced LIGO detectors, and related to an inspiral and merger of a binary black hole system. A gamma ray burst that could possibly be related with the GW150914 event was observed by the Fermi satellite. It had a duration of about 1 s and appeared about 0.4 s after the gravitational-wave signal. We propose that a collapsing massive star and a black hole in a close binary could lead to the event. The gamma ray burst was powered by a weak neutrino flux produced in the star remnant’s matter. Low spin and kick velocity of the merged black hole are reproduced in our simulations. Coincident gravitational-wave emission originates from the merger of the collapsed core and the companion black hole.

  5. Swift: A gamma ray burst MIDEX

    International Nuclear Information System (INIS)

    Barthelmy, Scott

    2001-01-01

    Swift is a first of its kind multiwavelength transient observatory for gamma-ray burst astronomy. It has the optimum capabilities for the next breakthroughs in determining the origin of gamma-ray bursts and their afterglows as well as using bursts to probe the early Universe. Swift will also perform the first sensitive hard X-ray survey of the sky. The mission is being developed by an international collaboration and consists of three instruments, the Burst Alert Telescope (BAT), the X-ray Telescope (XRT), and the Ultraviolet and Optical Telescope (UVOT). The BAT, a wide-field gamma-ray detector, will detect ∼1 gamma-ray burst per day with a sensitivity 5 times that of BATSE. The sensitive narrow-field XRT and UVOT will be autonomously slewed to the burst location in 20 to 70 seconds to determine 0.3-5.0 arcsec positions and perform optical, UV, and X-ray spectrophotometry. On-board measurements of redshift will also be done for hundreds of bursts. Swift will incorporate superb, low-cost instruments using existing flight-spare hardware and designs. Strong education/public outreach and follow-up programs will help to engage the public and astronomical community. Swift has been selected by NASA for development and launch in late 2003

  6. Gamma-ray bursts at high redshift

    NARCIS (Netherlands)

    Wijers, R.A.M.J.

    1999-01-01

    Gamma-ray bursts are much brighter than supernovae, and could therefore possibly probe the Universe to high redshift. The presently established GRB redshifts range from 0.83 to 5, and quite possibly even beyond that. Since most proposed mechanisms for GRB link them closely to deaths of massive

  7. Coakial gamma ray detector and method therefor

    International Nuclear Information System (INIS)

    Harchol, M.

    1977-01-01

    A coaxial gamma ray detector is fabricated using intrinsic Ge semiconductor material in a geometry whereby full depletion of electrical carriers is prevented within a small region proximate the point of electrical contact thereby allowing greater biasing potentials across the detector and, consequently, providing reduced electronic noise and increased energy resolution

  8. Effects of Shielding on Gamma Rays

    Energy Technology Data Exchange (ETDEWEB)

    Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-13

    The interaction of gamma rays with matter results in an effect we call attenuation (i.e. ‘shielding’). Attenuation can dramatically alter the appearance of a spectrum. Attenuating materials may actually create features in a spectrum via x-ray fluorescence

  9. Developments in mercuric iodide gamma ray imaging

    Energy Technology Data Exchange (ETDEWEB)

    Patt, B E; Beyerle, A G; Dolin, R C; Ortale, C [EG and G Energy Measurements, Inc., Goleta, CA (USA). Santa Barbara Operations

    1989-11-01

    A mercuric iodide (HgI{sub 2}) gamma ray imaging array and camera system previously described have been characterized for spatial and energy resolution. Based on these data a new camera is being developed to more fully exploit the potential of the array. Characterization results and design criteria for the new camera will be presented. (orig.).

  10. Current segmented gamma-ray scanner technology

    International Nuclear Information System (INIS)

    Bjork, C.W.

    1987-01-01

    A new generation of segmented gamma-ray scanners has been developed at Los Alamos for scrap and waste measurements at the Savannah River Plant and the Los Alamos Plutonium Facility. The new designs are highly automated and exhibit special features such as good segmentation and thorough shielding to improve performance

  11. Gamma-Ray Telescope and Uncertainty Principle

    Science.gov (United States)

    Shivalingaswamy, T.; Kagali, B. A.

    2012-01-01

    Heisenberg's Uncertainty Principle is one of the important basic principles of quantum mechanics. In most of the books on quantum mechanics, this uncertainty principle is generally illustrated with the help of a gamma ray microscope, wherein neither the image formation criterion nor the lens properties are taken into account. Thus a better…

  12. Gamma-ray astronomy: A historical perspective

    International Nuclear Information System (INIS)

    Lingenfelter, R.E.

    1988-01-01

    This is a brief review of the course theoretical gamma-ray astronomy has taken over the past thirty years. An examination is given of what the theoretical expectations were; to what extent they were realized; how well they anticipated new directions of research; and alternatively, how often were new directions unexpected

  13. Gamma ray bursts of black hole universe

    Science.gov (United States)

    Zhang, T. X.

    2015-07-01

    Slightly modifying the standard big bang theory, Zhang recently developed a new cosmological model called black hole universe, which has only a single postulate but is consistent with Mach's principle, governed by Einstein's general theory of relativity, and able to explain existing observations of the universe. In the previous studies, we have explained the origin, structure, evolution, expansion, cosmic microwave background radiation, quasar, and acceleration of black hole universe, which grew from a star-like black hole with several solar masses through a supermassive black hole with billions of solar masses to the present state with hundred billion-trillions of solar masses by accreting ambient matter and merging with other black holes. This study investigates gamma ray bursts of black hole universe and provides an alternative explanation for the energy and spectrum measurements of gamma ray bursts according to the black hole universe model. The results indicate that gamma ray bursts can be understood as emissions of dynamic star-like black holes. A black hole, when it accretes its star or merges with another black hole, becomes dynamic. A dynamic black hole has a broken event horizon and thus cannot hold the inside hot (or high-frequency) blackbody radiation, which flows or leaks out and produces a GRB. A star when it collapses into its core black hole produces a long GRB and releases the gravitational potential energy of the star as gamma rays. A black hole that merges with another black hole produces a short GRB and releases a part of their blackbody radiation as gamma rays. The amount of energy obtained from the emissions of dynamic star-like black holes are consistent with the measurements of energy from GRBs. The GRB energy spectra derived from this new emission mechanism are also consistent with the measurements.

  14. Matrix of response functions for xenon gamma-ray detector

    International Nuclear Information System (INIS)

    Shustov, A.E.; Vlasik, K.F.; Grachev, V.M.; Dmitrenko, V.V.; Novikov, A.S.; P'ya, S.N.; Ulin, S.E.; Uteshev, Z.M.; Chernysheva, I.V.

    2014-01-01

    An approach of creation of response matrix using simulation GEANT4 gamma-ray Monte-Carlo method has been described for gamma-ray spectrometer based on high pressure xenon impulse ionization chamber with a shielding grid [ru

  15. Cosmic gamma-ray background radiation. Current understandings and problems

    International Nuclear Information System (INIS)

    Inoue, Yoshiyuki

    2015-01-01

    The cosmic gamma-ray background radiation is one of the most fundamental observables in the gamma-ray band. Although the origin of the cosmic gamma-ray background radiation has been a mystery for a long time, the Fermi gamma-ray space telescope has recently measured it at 0.1-820 GeV and revealed that the cosmic GeV gamma-ray background is composed of blazars, radio galaxies, and star-forming galaxies. However, Fermi still leaves the following questions. Those are dark matter contribution, origins of the cosmic MeV gamma-ray background, and the connection to the IceCube TeV-PeV neutrino events. In this proceeding, I will review the current understandings of the cosmic gamma-ray background and discuss future prospects of cosmic gamma-ray background radiation studies. (author)

  16. CONSTRAINTS ON THE EMISSION GEOMETRIES AND SPIN EVOLUTION OF GAMMA-RAY MILLISECOND PULSARS

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, T. J. [National Research Council Research Associate, National Academy of Sciences, Washington, DC 20001 (United States); Venter, C. [Centre for Space Research, North-West University, Potchefstroom Campus, Private Bag X6001, 2520 Potchefstroom (South Africa); Harding, A. K.; Çelik, Ö.; Ferrara, E. C. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Guillemot, L. [Laboratoire de Physique et Chimie de l' Environnement, LPCE UMR 6115 CNRS, F-45071 Orléans Cedex 02 (France); Smith, D. A.; Hou, X. [Centre d' Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Kramer, M. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, 53121 Bonn (Germany); Den Hartog, P. R. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Lande, J. [Twitter Inc., 1355 Market Street 900, San Francisco, CA 94103 (United States); Ray, P. S., E-mail: tyrel.j.johnson@gmail.com, E-mail: Christo.Venter@nwu.ac.za, E-mail: ahardingx@yahoo.com [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States)

    2014-07-01

    Millisecond pulsars (MSPs) are a growing class of gamma-ray emitters. Pulsed gamma-ray signals have been detected from more than 40 MSPs with the Fermi Large Area Telescope (LAT). The wider radio beams and more compact magnetospheres of MSPs enable studies of emission geometries over a broader range of phase space than non-recycled radio-loud gamma-ray pulsars. We have modeled the gamma-ray light curves of 40 LAT-detected MSPs using geometric emission models assuming a vacuum retarded-dipole magnetic field. We modeled the radio profiles using a single-altitude hollow-cone beam, with a core component when indicated by polarimetry; however, for MSPs with gamma-ray and radio light curve peaks occurring at nearly the same rotational phase, we assume that the radio emission is co-located with the gamma rays and caustic in nature. The best-fit parameters and confidence intervals are determined using a maximum likelihood technique. We divide the light curves into three model classes, with gamma-ray peaks trailing (Class I), aligned (Class II), or leading (Class III) the radio peaks. Outer gap and slot gap (two-pole caustic) models best fit roughly equal numbers of Class I and II, while Class III are exclusively fit with pair-starved polar cap models. Distinguishing between the model classes based on typical derived parameters is difficult. We explore the evolution of the magnetic inclination angle with period and spin-down power, finding possible correlations. While the presence of significant off-peak emission can often be used as a discriminator between outer gap and slot gap models, a hybrid model may be needed.

  17. CONSTRAINTS ON THE EMISSION GEOMETRIES AND SPIN EVOLUTION OF GAMMA-RAY MILLISECOND PULSARS

    International Nuclear Information System (INIS)

    Johnson, T. J.; Venter, C.; Harding, A. K.; Çelik, Ö.; Ferrara, E. C.; Guillemot, L.; Smith, D. A.; Hou, X.; Kramer, M.; Den Hartog, P. R.; Lande, J.; Ray, P. S.

    2014-01-01

    Millisecond pulsars (MSPs) are a growing class of gamma-ray emitters. Pulsed gamma-ray signals have been detected from more than 40 MSPs with the Fermi Large Area Telescope (LAT). The wider radio beams and more compact magnetospheres of MSPs enable studies of emission geometries over a broader range of phase space than non-recycled radio-loud gamma-ray pulsars. We have modeled the gamma-ray light curves of 40 LAT-detected MSPs using geometric emission models assuming a vacuum retarded-dipole magnetic field. We modeled the radio profiles using a single-altitude hollow-cone beam, with a core component when indicated by polarimetry; however, for MSPs with gamma-ray and radio light curve peaks occurring at nearly the same rotational phase, we assume that the radio emission is co-located with the gamma rays and caustic in nature. The best-fit parameters and confidence intervals are determined using a maximum likelihood technique. We divide the light curves into three model classes, with gamma-ray peaks trailing (Class I), aligned (Class II), or leading (Class III) the radio peaks. Outer gap and slot gap (two-pole caustic) models best fit roughly equal numbers of Class I and II, while Class III are exclusively fit with pair-starved polar cap models. Distinguishing between the model classes based on typical derived parameters is difficult. We explore the evolution of the magnetic inclination angle with period and spin-down power, finding possible correlations. While the presence of significant off-peak emission can often be used as a discriminator between outer gap and slot gap models, a hybrid model may be needed

  18. DISCOVERY OF GAMMA-RAY PULSATIONS FROM THE TRANSITIONAL REDBACK PSR J1227-4853

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, T. J. [College of Science, George Mason University, Fairfax, VA 22030 (United States); Ray, P. S.; Cheung, C. C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States); Roy, J.; Bhattacharyya, B.; Stappers, B. W. [Jodrell Bank Centre for Astrophysics, School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Harding, A. K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Pletsch, H. J.; Fort, S. [Albert-Einstein-Institut, Max-Planck-Institut für Gravitationsphysik, D-30167 Hannover (Germany); Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Deneva, J. [National Research Council Research Associate, National Academy of Sciences, Washington, DC 20001 (United States); Kerr, M., E-mail: tyrel.j.johnson@gmail.com, E-mail: Paul.Ray@nrl.navy.mil, E-mail: jayanta.roy@manchester.ac.uk [CSIRO Astronomy and Space Science, Australia Telescope National Facility, Epping NSW 1710 (Australia)

    2015-06-10

    The 1.69 ms spin period of PSR J1227−4853 was recently discovered in radio observations of the low-mass X-ray binary XSS J12270−4859 following the announcement of a possible transition to a rotation-powered millisecond pulsar state, inferred from decreases in optical, X-ray, and gamma-ray flux from the source. We report the detection of significant (5σ) gamma-ray pulsations after the transition, at the known spin period, using ∼1 year of data from the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. The gamma-ray light curve of PSR J1227−4853 can be fit by one broad peak, which occurs at nearly the same phase as the main peak in the 1.4 GHz radio profile. The partial alignment of light-curve peaks in different wavebands suggests that at least some of the radio emission may originate at high altitude in the pulsar magnetosphere, in extended regions co-located with the gamma-ray emission site. We folded the LAT data at the orbital period, both pre- and post-transition, but find no evidence for significant modulation of the gamma-ray flux. Analysis of the gamma-ray flux over the mission suggests an approximate transition time of 2012 November 30. Continued study of the pulsed emission and monitoring of PSR J1227−4853, and other known redback systems, for subsequent flux changes will increase our knowledge of the pulsar emission mechanism and transitioning systems.

  19. Applications of Monte Carlo simulations of gamma-ray spectra

    International Nuclear Information System (INIS)

    Clark, D.D.

    1995-01-01

    A short, convenient computer program based on the Monte Carlo method that was developed to generate simulated gamma-ray spectra has been found to have useful applications in research and teaching. In research, we use it to predict spectra in neutron activation analysis (NAA), particularly in prompt gamma-ray NAA (PGNAA). In teaching, it is used to illustrate the dependence of detector response functions on the nature of gamma-ray interactions, the incident gamma-ray energy, and detector geometry

  20. Interstellar medium structure and content and gamma ray astronomy

    International Nuclear Information System (INIS)

    Lebrun, F.

    1982-05-01

    A general description of gamma-ray astronomy is presented with special emphasis on the study of diffuse gamma-ray emission. This is followed by a collection of reflections and observations on the structure and the gas and dust content of the local interstellar medium. Results of gamma-ray observations on the local interstellar medium are given. The last part is devoted to the whole of the galactic gamma-ray emission and its interpretation [fr

  1. Quantum-Gravity Based Photon Dispersion in Gamma-Ray Bursts: The Detection Problem

    International Nuclear Information System (INIS)

    Norris, Jay P.; Scargle, Jeffrey D.

    2007-01-01

    Gamma-ray bursts at cosmological distances offer a time-varying signal that can be used to search for energy-dependent photon dispersion effects. We show that short bursts with narrow pulse structures at high energies will offer the least ambiguous tests for energy-dependent dispersion effects. We discuss quantitative methods to search for such effects in time-tagged photon data. Utilizing observed gamma-ray burst profiles extrapolated to GeV energies, as may expected to be observed by GLAST, we also demonstrate the extent to which these methods can be used as an empirical exploration of quantum gravity formalisms

  2. Numerical study on determining formation porosity using a boron capture gamma ray technique and MCNP.

    Science.gov (United States)

    Liu, Juntao; Zhang, Feng; Wang, Xinguang; Han, Fei; Yuan, Zhelong

    2014-12-01

    Formation porosity can be determined using the boron capture gamma ray counting ratio with a near to far detector in a pulsed neutron-gamma element logging tool. The thermal neutron distribution, boron capture gamma spectroscopy and porosity response for formations with different water salinity and wellbore diameter characteristics were simulated using the Monte Carlo method. We found that a boron lining improves the signal-to-noise ratio and that the boron capture gamma ray counting ratio has a higher sensitivity for determining porosity than total capture gamma. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Digital gamma-ray spectroscopy based on FPGA technology

    CERN Document Server

    Bolic, M

    2002-01-01

    A digital pulse processing system convenient for high rate gamma-ray spectroscopy with NaI(Tl) detectors has been designed. The new programmable logic device has been used for implementation of dedicated high-speed pulse processor, as the central part of the system. The processor is capable to operate at the speed of fast ADC, preserving maximum throughput of the system. Special care has been taken to reduce the distortion of energy spectrum caused by pile-up at high-count rates. The developed system is highly flexible, and the parameters of its operation can be changed in software. The performance of the system was tested for high counting rate of 400000 s sup - sup 1.

  4. Gamma-ray burst observations: the present situation

    International Nuclear Information System (INIS)

    Vedrenne, G.

    1984-01-01

    Recent results in gamma ray burst investigations concerning the spectral variability on a short time scale, precise locations, and the discovery of optical flashes in gamma ray burst positions on archival plates are presented. The implications of optical and X-ray observations of gamma ray burst error boxes are also discussed. 72 references

  5. Egret observations of the extragalactic gamma-ray emission

    DEFF Research Database (Denmark)

    Sreekumar, P.; Bertsch, D.L.; Dingus, B.L.

    1998-01-01

    The all-sky survey in high-energy gamma rays (E > 30 MeV) carried out by EGRET aboard the Compton Gamma Ray Observatory provides a unique opportunity to examine in detail the diffuse gamma-ray emission. The observed diffuse emission has a Galactic component arising from cosmic-ray interactions wi...

  6. Natural background gamma-ray spectrum. List of gamma-rays ordered in energy from natural radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Ichimiya, Tsutomu [Japan Radioisotope Association, Tokyo (Japan); Narita, Tsutomu; Kitao, Kensuke

    1998-03-01

    A quick index to {gamma}-rays and X-rays from natural radionuclides is presented. In the list, {gamma}-rays are arranged in order of increasing energy. The list also contains {gamma}-rays from radioactive nuclides produced in a germanium detector and its surrounding materials by interaction with cosmic neutrons, as well as direct {gamma}-rays from interaction with the neutrons. Artificial radioactive nuclides emitting {gamma}-rays with same or near energy value as that of the natural {gamma}-rays and X-rays are also listed. In appendix, {gamma}-ray spectra from a rock, uranium ore, thorium, monazite and uraninite and also background spectra obtained with germanium detectors placed in iron or lead shield have been given. The list is designed for use in {gamma}-ray spectroscopy under the conditions of highly natural background, such as in-situ environmental radiation monitoring or low-level activity measurements, with a germanium detector. (author)

  7. DISCOVERY OF VERY HIGH ENERGY GAMMA RAYS FROM PKS 1424+240 AND MULTIWAVELENGTH CONSTRAINTS ON ITS REDSHIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.

    2010-01-01

    We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  8. THE SECOND FERMI LARGE AREA TELESCOPE CATALOG OF GAMMA-RAY PULSARS

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A. A. [Center for Earth Observing and Space Research, College of Science, George Mason University, Fairfax, VA 22030 (United States); Ajello, M. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Allafort, A.; Bloom, E. D.; Bottacini, E. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Baldini, L. [Università di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Baring, M. G. [Rice University, Department of Physics and Astronomy, MS-108, P.O. Box 1892, Houston, TX 77251 (United States); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Belfiore, A. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Bellazzini, R.; Bregeon, J. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bhattacharyya, B. [National Centre for Radio Astrophysics, Tata Institute of Fundamental Research, Pune 411 007 (India); Bissaldi, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, and Università di Trieste, I-34127 Trieste (Italy); Bonamente, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Perugia, I-06123 Perugia (Italy); Brandt, T. J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brigida, M., E-mail: hartog@stanford.edu [Dipartimento di Fisica ' ' M. Merlin' ' dell' Università e del Politecnico di Bari, I-70126 Bari (Italy); and others

    2013-10-01

    This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.

  9. Monte Carlo simulation of the scattered component of neutron capture prompt gamma-ray analyzer responses

    International Nuclear Information System (INIS)

    Jin, Y.; Verghese, K.; Gardner, R.P.

    1986-01-01

    This paper describes a major part of our efforts to simulate the entire spectral response of the neutron capture prompt gamma-ray analyzer for bulk media (or conveyor belt) samples by the Monte Carlo method. This would allow one to use such a model to augment or, in most cases, essentially replace experiments in the calibration and optimum design of these analyzers. In previous work, we simulated the unscattered gamma-ray intensities, but would like to simulate the entire spectral response as we did with the energy-dispersive x-ray fluorescence analyzers. To accomplish this, one must account for the scattered gamma rays as well as the unscattered and one must have available the detector response function to translate the incident gamma-ray spectrum calculated by the Monte Carlo simulation into the detected pulse-height spectrum. We recently completed our work on the germanium detector response function, and the present paper describes our efforts to simulate the entire spectral response by using it with Monte Carlo predicted unscattered and scattered gamma rays

  10. The second FERMI large area telescope catalog of gamma-ray pulsars

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A. A.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; Belfiore, A.; Bellazzini, R.; Bhattacharyya, B.; Bissaldi, E.; Bloom, E. D.; Bonamente, E.; Bottacini, E.; Brandt, T. J.; Bregeon, J.; Brigida, M.; Bruel, P.; Buehler, R.; Burgay, M.; Burnett, T. H.; Busetto, G.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Camilo, F.; Caraveo, P. A.; Casandjian, J. M.; Cecchi, C.; Çelik, Ö.; Charles, E.; Chaty, S.; Chaves, R. C. G.; Chekhtman, A.; Chen, A. W.; Chiang, J.; Chiaro, G.; Ciprini, S.; Claus, R.; Cognard, I.; Cohen-Tanugi, J.; Cominsky, L. R.; Conrad, J.; Cutini, S.; D' Ammando, F.; de Angelis, A.; DeCesar, M. E.; De Luca, A.; den Hartog, P. R.; de Palma, F.; Dermer, C. D.; Desvignes, G.; Digel, S. W.; Di Venere, L.; Drell, P. S.; Drlica-Wagner, A.; Dubois, R.; Dumora, D.; Espinoza, C. M.; Falletti, L.; Favuzzi, C.; Ferrara, E. C.; Focke, W. B.; Franckowiak, A.; Freire, P. C. C.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Germani, S.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gotthelf, E. V.; Grenier, I. A.; Grondin, M. -H.; Grove, J. E.; Guillemot, L.; Guiriec, S.; Hadasch, D.; Hanabata, Y.; Harding, A. K.; Hayashida, M.; Hays, E.; Hessels, J.; Hewitt, J.; Hill, A. B.; Horan, D.; Hou, X.; Hughes, R. E.; Jackson, M. S.; Janssen, G. H.; Jogler, T.; Jóhannesson, G.; Johnson, R. P.; Johnson, A. S.; Johnson, T. J.; Johnson, W. N.; Johnston, S.; Kamae, T.; Kataoka, J.; Keith, M.; Kerr, M.; Knödlseder, J.; Kramer, M.; Kuss, M.; Lande, J.; Larsson, S.; Latronico, L.; Lemoine-Goumard, M.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Lyne, A. G.; Manchester, R. N.; Marelli, M.; Massaro, F.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; McLaughlin, M. A.; Mehault, J.; Michelson, P. F.; Mignani, R. P.; Mitthumsiri, W.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Morselli, A.; Moskalenko, I. V.; Murgia, S.; Nakamori, T.; Nemmen, R.; Nuss, E.; Ohno, M.; Ohsugi, T.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Panetta, J. H.; Parent, D.; Perkins, J. S.; Pesce-Rollins, M.; Pierbattista, M.; Piron, F.; Pivato, G.; Pletsch, H. J.; Porter, T. A.; Possenti, A.; Rainò, S.; Rando, R.; Ransom, S. M.; Ray, P. S.; Razzano, M.; Rea, N.; Reimer, A.; Reimer, O.; Renault, N.; Reposeur, T.; Ritz, S.; Romani, R. W.; Roth, M.; Rousseau, R.; Roy, J.; Ruan, J.; Sartori, A.; Saz Parkinson, P. M.; Scargle, J. D.; Schulz, A.; Sgrò, C.; Shannon, R.; Siskind, E. J.; Smith, D. A.; Spandre, G.; Spinelli, P.; Stappers, B. W.; Strong, A. W.; Suson, D. J.; Takahashi, H.; Thayer, J. G.; Thayer, J. B.; Theureau, G.; Thompson, D. J.; Thorsett, S. E.; Tibaldo, L.; Tibolla, O.; Tinivella, M.; Torres, D. F.; Tosti, G.; Troja, E.; Uchiyama, Y.; Usher, T. L.; Vandenbroucke, J.; Vasileiou, V.; Venter, C.; Vianello, G.; Vitale, V.; Wang, N.; Weltevrede, P.; Winer, B. L.; Wolff, M. T.; Wood, D. L.; Wood, K. S.; Wood, M.; Yang, Z.

    2013-09-19

    This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.

  11. The second fermi large area telescope catalog of gamma-ray pulsars

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A. A.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; Belfiore, A.; Bellazzini, R.; Bhattacharyya, B.; Bissaldi, E.; Bloom, E. D.; Bonamente, E.; Bottacini, E.; Brandt, T. J.; Bregeon, J.; Brigida, M.; Bruel, P.; Buehler, R.; Burgay, M.; Burnett, T. H.; Busetto, G.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Camilo, F.; Caraveo, P. A.; Casandjian, J. M.; Cecchi, C.; Çelik, Ö.; Charles, E.; Chaty, S.; Chaves, R. C. G.; Chekhtman, A.; Chen, A. W.; Chiang, J.; Chiaro, G.; Ciprini, S.; Claus, R.; Cognard, I.; Cohen-Tanugi, J.; Cominsky, L. R.; Conrad, J.; Cutini, S.; D' Ammando, F.; de Angelis, A.; DeCesar, M. E.; De Luca, A.; den Hartog, P. R.; de Palma, F.; Dermer, C. D.; Desvignes, G.; Digel, S. W.; Di Venere, L.; Drell, P. S.; Drlica-Wagner, A.; Dubois, R.; Dumora, D.; Espinoza, C. M.; Falletti, L.; Favuzzi, C.; Ferrara, E. C.; Focke, W. B.; Franckowiak, A.; Freire, P. C. C.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Germani, S.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gotthelf, E. V.; Grenier, I. A.; Grondin, M. -H.; Grove, J. E.; Guillemot, L.; Guiriec, S.; Hadasch, D.; Hanabata, Y.; Harding, A. K.; Hayashida, M.; Hays, E.; Hessels, J.; Hewitt, J.; Hill, A. B.; Horan, D.; Hou, X.; Hughes, R. E.; Jackson, M. S.; Janssen, G. H.; Jogler, T.; Jóhannesson, G.; Johnson, R. P.; Johnson, A. S.; Johnson, T. J.; Johnson, W. N.; Johnston, S.; Kamae, T.; Kataoka, J.; Keith, M.; Kerr, M.; Knödlseder, J.; Kramer, M.; Kuss, M.; Lande, J.; Larsson, S.; Latronico, L.; Lemoine-Goumard, M.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Lyne, A. G.; Manchester, R. N.; Marelli, M.; Massaro, F.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; McLaughlin, M. A.; Mehault, J.; Michelson, P. F.; Mignani, R. P.; Mitthumsiri, W.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Morselli, A.; Moskalenko, I. V.; Murgia, S.; Nakamori, T.; Nemmen, R.; Nuss, E.; Ohno, M.; Ohsugi, T.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Panetta, J. H.; Parent, D.; Perkins, J. S.; Pesce-Rollins, M.; Pierbattista, M.; Piron, F.; Pivato, G.; Pletsch, H. J.; Porter, T. A.; Possenti, A.; Rainò, S.; Rando, R.; Ransom, S. M.; Ray, P. S.; Razzano, M.; Rea, N.; Reimer, A.; Reimer, O.; Renault, N.; Reposeur, T.; Ritz, S.; Romani, R. W.; Roth, M.; Rousseau, R.; Roy, J.; Ruan, J.; Sartori, A.; Saz Parkinson, P. M.; Scargle, J. D.; Schulz, A.; Sgrò, C.; Shannon, R.; Siskind, E. J.; Smith, D. A.; Spandre, G.; Spinelli, P.; Stappers, B. W.; Strong, A. W.; Suson, D. J.; Takahashi, H.; Thayer, J. G.; Thayer, J. B.; Theureau, G.; Thompson, D. J.; Thorsett, S. E.; Tibaldo, L.; Tibolla, O.; Tinivella, M.; Torres, D. F.; Tosti, G.; Troja, E.; Uchiyama, Y.; Usher, T. L.; Vandenbroucke, J.; Vasileiou, V.; Venter, C.; Vianello, G.; Vitale, V.; Wang, N.; Weltevrede, P.; Winer, B. L.; Wolff, M. T.; Wood, D. L.; Wood, K. S.; Wood, M.; Yang, Z.

    2013-09-19

    This catalog summarizes 117 high-confidence ≥0.1 GeV gamma-ray pulsar detections using three years of data acquired by the Large Area Telescope (LAT) on the Fermi satellite. Half are neutron stars discovered using LAT data through periodicity searches in gamma-ray and radio data around LAT unassociated source positions. The 117 pulsars are evenly divided into three groups: millisecond pulsars, young radio-loud pulsars, and young radio-quiet pulsars. We characterize the pulse profiles and energy spectra and derive luminosities when distance information exists. Spectral analysis of the off-peak phase intervals indicates probable pulsar wind nebula emission for four pulsars, and off-peak magnetospheric emission for several young and millisecond pulsars. We compare the gamma-ray properties with those in the radio, optical, and X-ray bands. We provide flux limits for pulsars with no observed gamma-ray emission, highlighting a small number of gamma-faint, radio-loud pulsars. The large, varied gamma-ray pulsar sample constrains emission models. Fermi's selection biases complement those of radio surveys, enhancing comparisons with predicted population distributions.

  12. Neutron and gamma-ray dose-rates from the Little Boy replica

    International Nuclear Information System (INIS)

    Plassmann, E.A.; Pederson, R.A.

    1984-01-01

    We report dose-rate information obtained at many locations in the near vicinity of, and at distances out to 0.64 km from, the Little Boy replica while it was operated as a critical assembly. The measurements were made with modified conventional dosimetry instruments that used an Anderson-Braun detector for neutrons and a Geiger-Mueller tube for gamma rays with suitable electronic modules to count particle-induced pulses. Thermoluminescent dosimetry methods provide corroborative data. Our analysis gives estimates of both neutron and gamma-ray relaxation lengths in air for comparison with earlier calculations. We also show the neutron-to-gamma-ray dose ratio as a function of distance from the replica. Current experiments and further data analysis will refine these results. 7 references, 8 figures

  13. A Population of Gamma-Ray Millisecond Pulsars Seen with the Fermi Large Area Telescope

    International Nuclear Information System (INIS)

    Dumora, D.; Grondin, M.H.; Guillemot, L.; Lemoine-Goumard, M.; Lovellette, M.N.; Parent, D.; Smith, D.A.; Abdo, A.A.; Chekhtman, A.; Dermer, C.D.; Grove, J.E.; Johnson, W.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wood, K.S.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Charles, E.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Edmonds, Y.; Focke, W.B.; Funk, S.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Panetta, J.H.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tajima, H.; Tanaka, T.; Thayer, J.B.; Thayer, J.G.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Van Etten, A.; Waite, A.P.; Wang, P.; Watters, K.; Atwood, W.B.; Dormody, M.; Johnson, R.P.; Porter, T.A.; Sadrozinski, H.F.W.; Schalk, T.L.; Thorsett, S.E.; Ziegler, M.; Axelsson, M.; Carlson, P.; Conrad, J.; Meurer, C.; Ryde, F.; Ylinen, T.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Spandre, G.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Starck, J.L.

    2009-01-01

    Pulsars are born with sub-second spin periods and slow by electromagnetic braking for several tens of millions of years, when detectable radiation ceases. A second life can occur for neutron stars in binary systems. They can acquire mass and angular momentum from their companions, to be spun up to millisecond periods and begin radiating again. We searched Fermi Large Area Telescope data for pulsations from all known millisecond pulsars (MSPs) outside of globular clusters, using rotation parameters from radio telescopes. Strong gamma-ray pulsations were detected for eight MSPs. The gamma-ray pulse profiles and spectral properties resemble those of young gamma-ray pulsars. The basic emission mechanism seems to be the same for MSPs and young pulsars, with the emission originating in regions far from the neutron star surface. (authors)

  14. Discovery of a point-like very-high-energy gamma-ray source in Monoceros

    International Nuclear Information System (INIS)

    Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.

    2007-01-01

    Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)

  15. A Search for bursts of TeV gamma rays with Milagro

    Science.gov (United States)

    Smith, A. J.; MILAGRO Collaboration

    2001-08-01

    The Very High Energy (VHE, E > 100 GeV) component of Gamma-Ray Bursts (GRBs) remains unmeasured, despite the fact that models predict that the spectrum of GRBs extends beyond 1 TeV. Satellite detectors capable of observing GRBs lack the sensitivity to detect γ-rays with energies greater than ≈ 30 GeV due to their small effective area. Air ˇCerenkov telescopes, capable of detecting TeV point sources with excellent sensitivity have limited sensitivity to GRBs due to their small fields of view and limited duty cycles. The detection of TeV emission from GRBs is further complicated by the attenuation of VHE photons by interaction with the intergalactic infrared radiation. This process limits the horizon for TeV observations of GRBs to z pond (4800 m2 ) instrumented with an array of photo-multiplier tubes. Milagro operates 24 hours a day and continuously observes the entire overhead sky (≈2 sr). Because of its wide field of view and high duty cycle Milagro is uniquely capable of searching for TeV emission from GRBs. An efficient algorithm has been developed to search the Milagro data for GRBs with durations from 250 microseconds to 40s. The search, while designed to search for the TeV component of GRBs, may also be sensitive to the evaporation of primordial black holes, or some other yet undiscovered phenomenon. The results of this search are presented.

  16. Using Gamma Rays to Improve Nutritional Value of Legumes

    International Nuclear Information System (INIS)

    Sajet, A.S.

    2009-01-01

    World is suffering from food shortages and rising prices of animal food, in particular. Therefore, attention turned to fill the shortfall by increasing the production and consumption of pulses. Beans are the most important types of legumes consumed in the countries of the Middle East. But there are some factors that reduce the expansion in the consumption of beans and some factors discourage feeding the trypsin inhibitor,phytic acid, causes of gases and allergens in some people, which negatively affect the bioavailability to absorb the vital minerals and proteins in addition to the length of time needed for cooking beans. There have been attempts to use gamma rays to improve strength and Leakage and cooking recipes for legumes, and reached results in other studies to reduce the efficiency of trypsin inhibitor in beans treated at a dose of 10 kGy as well as achieving the highest percentage reduction in phytic acid content of the same seed above. Also it was found that gamma rays affect negatively on the causes of gases in the beans, radiation works to break down some of the Oligosaccharides and turn it into simple sugars, as well as to break down some of the compounds which are responsible of disease in beans.

  17. Relativistic effects in gamma-ray bursts

    International Nuclear Information System (INIS)

    Eriksen, Erik; Groen, Oeyvind

    1999-01-01

    According to recent models of the sources of gamma-ray bursts the extremely energetic emission is caused by shells expanding with ultrarelativistic velocity. With the recent identification of optical sources at the positions of some gamma-ray bursts these ''fireball'' models have acquired an actuality that invites to use them as a motivating application when teaching special relativity. We demonstrate several relativistic effects associated with these models which are very pronounced due to the great velocity of the shell. For example a burst lasting for a month in the rest frame of an element of the shell lasts for a few seconds only, in the rest frame of our detector. It is shown how the observed properties of a burst are modified by aberration and the Doppler effect. The apparent luminosity as a function of time is calculated. Modifications due to the motion of the star away from the observer are calculated. (Author)

  18. Fissile interrogation using gamma rays from oxygen

    Science.gov (United States)

    Smith, Donald; Micklich, Bradley J.; Fessler, Andreas

    2004-04-20

    The subject apparatus provides a means to identify the presence of fissionable material or other nuclear material contained within an item to be tested. The system employs a portable accelerator to accelerate and direct protons to a fluorine-compound target. The interaction of the protons with the fluorine-compound target produces gamma rays which are directed at the item to be tested. If the item to be tested contains either a fissionable material or other nuclear material the interaction of the gamma rays with the material contained within the test item with result in the production of neutrons. A system of neutron detectors is positioned to intercept any neutrons generated by the test item. The results from the neutron detectors are analyzed to determine the presence of a fissionable material or other nuclear material.

  19. Environmental Effects of Gamma Ray Bursts

    International Nuclear Information System (INIS)

    Martin, Osmel; Zarauza, Dario; Cardenas, Rolando

    2007-01-01

    Gamma rays bursts, coming from very massive stars, are the most powerful explosions in our Universe. Some authors have linked them to some of the climatic changes and consequent biological mass extinctions of the Phanerozoic eon. However, the consequences of their direct impact on primitive Earth, is today a hot topic of debate. On the other hand, it is usually assumed that they were more common in earlier stages of our galaxy. So it is important to evaluate its potential effects on terrestrial paleoenvironments. We outline some simple models to estimate their influence mainly on the primordial atmospheric chemistry of Earth and on the climate in general. To do that, we consider different scenarios where the atmospheric composition diverges substantially from the atmosphere today, and compute the evolution of principal chemical species under the intense radiational stress of a gamma ray burst. Furthermore, the possible impact on the isotopic composition, geochemistry and the biosphere are mentioned in general way

  20. TeV gamma-ray astronomy

    International Nuclear Information System (INIS)

    Cui Wei

    2009-01-01

    The field of ground-based gamma-ray astronomy has enjoyed rapid growth in recent years. As an increasing number of sources are detected at TeV energies, the field has matured and become a viable branch of modern astronomy. Lying at the uppermost end of the electromagnetic rainbow, TeV photons are always preciously few in number but carry essential information about the particle acceleration and radiative processes involved in extreme astronomical settings. Together with observations at longer wavelengths, TeV gamma-ray observations have drastically improved our view of the universe. In this review, we briefly describe recent progress in the field. We will conclude by providing a personal perspective on the future of the field, in particular, on the significant roles that China could play in advancing this young but exciting field. (invited reviews)

  1. Real time gamma-ray signature identifier

    Science.gov (United States)

    Rowland, Mark [Alamo, CA; Gosnell, Tom B [Moraga, CA; Ham, Cheryl [Livermore, CA; Perkins, Dwight [Livermore, CA; Wong, James [Dublin, CA

    2012-05-15

    A real time gamma-ray signature/source identification method and system using principal components analysis (PCA) for transforming and substantially reducing one or more comprehensive spectral libraries of nuclear materials types and configurations into a corresponding concise representation/signature(s) representing and indexing each individual predetermined spectrum in principal component (PC) space, wherein an unknown gamma-ray signature may be compared against the representative signature to find a match or at least characterize the unknown signature from among all the entries in the library with a single regression or simple projection into the PC space, so as to substantially reduce processing time and computing resources and enable real-time characterization and/or identification.

  2. Attenuation of the gamma rays in tissues

    International Nuclear Information System (INIS)

    Arcos P, A.; Rodriguez N, S.; Pinedo S, A.; Amador V, P.; Chacon R, A.; Vega C, H.R.

    2005-01-01

    The mass and lineal attenuation coefficient and of hepatic tissue, muscular, osseous and of brain before gamma rays of 10 -3 to 10 5 MeV were calculated. For the case of the osseous tissue the calculation was made for the cartilage, the cortical tissue and the bone marrow. During the calculations the elementary composition of the tissues of human origin was used. The calculations include by separate the Photoelectric effect, the Compton scattering and the Pair production, as well as the total. For to establish a comparison with the attenuation capacities, the coefficients of the water, the aluminum and the lead also were calculated. The study was complemented measuring the attenuation coefficient of hepatic tissue of bovine before gamma rays of 0.662 MeV of a source of 137 Cs. The measurement was made through of an experiment of photons transmission through samples frozen of hepatic tissue and with a Geiger-Mueller detector. (Author)

  3. The Future of Gamma Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    Over the past decade, gamma ray astrophysics has entered the astrophysical mainstream. Extremely successful space-borne (GeV) and ground-based (TeV) detectors, combined with a multitude of partner telescopes, have revealed a fascinating “astroscape" of active galactic nuclei, pulsars, gamma ray bursts, supernova remnants, binary stars, star-forming galaxies, novae much more, exhibiting major pathways along which large energy releases can flow. From  a basic physics perspective, exquisitely sensitive measurements have constrained the nature of dark matter, the cosmological origin of magnetic field and the properties of black holes. These advances have motivated the development of new facilities, including HAWC, DAMPE, CTA and SVOM, which will further our understanding of the high energy universe. Topics that will receive special attention include merging neutron star binaries, clusters of galaxies, galactic cosmic rays and putative, TeV dark matter.

  4. Advances in gamma-ray burst astronomy

    International Nuclear Information System (INIS)

    Cline, T.L.; Desai, U.D.

    1976-01-01

    Work at Goddard is presently being carried out in three major areas of gamma-ray burst research: (1) A pair of simultaneously operating 0.8-m 2 burst detectors were successfully balloon-borne at locations 800 miles apart on 9 May, 1975, each to atmospheric depths of 3 to 4 g cm -2 , for a 20-h period of coincident data coverage. This experiment investigates the size spectrum of bursts in the 10 -7 to 10 -6 erg cm -2 size region where dozens of events per day are expected on a -1.5 index integral power-law extrapolation. Considerable separation in latitude was used to avoid possible atmospheric and auroral secondary effects. Its results are not yet available. (2) A deep-space burst detector, the first spacecraft instrument built specifically for gamma-ray burst studies, was recently successfully integrated into the Helios-B space probe. Its use at distances of up to 2 AU will make possible the first high-resolution directional study of gamma-ray burst source locations. Similar modifications to several other space vehicles are also being prepared. (3) The gamma-ray instrument on the IMP-7 satellite is presently the most sensitive burst detector still operating in orbit. Its results have shown that all measured event-average energy spectra are consistent with being alike. Using this characteristic spectrum to select IMP-7 candidate events of smaller size than those detected using other spacecraft in coincidence, a size spectrum is constructed which fits the -1.5 index power law down to 2.5 x 10 -5 erg cm -2 per event, at an occurrence rate of about once per month. (Auth.)

  5. Nature of gamma-ray burst sources

    International Nuclear Information System (INIS)

    Ventura, J.

    1983-01-01

    Observational evidence suggests that gamma ray bursts have a local galactic origin involving neutron stars. In this light we make a critical review of physics of the thermonuclear runaway model placing emphasis on self-consistency. We further show that some of the proposed models can be observationally excluded in the light of existing data from the Einstein Observatory. The possibility of gamma bursts arising in low mass binaries is finally discussed in the light of evolutionary scenarios leading to low luminosity systems

  6. Evaluation of gamma-ray intensities

    International Nuclear Information System (INIS)

    Yoshizawa, Yasukazu; Inoue, Hikaru; Hoshi, Masaharu; Shizuma, Kiyoshi; Iwata, Yosei.

    1978-03-01

    Results of literature survey and evaluation of relative intensities and intensities per decay of gamma rays are presented. Evaluations were made for 22 Na, 24 Na, 46 Sc, 48 Sc, 48 V, 54 Mn, 57 Co, 60 Co, 85 Sr, 88 Y, 95 Nb, 95 Zr, sup(108m)Ag, 134 Cs, 137 Cs, 144 Ce, 144 Pr, 203 Hg, and 207 Bi. For eight of the nuclides, the half-lives were also evaluated. (auth.)

  7. Gamma-ray standards for detector calibration

    International Nuclear Information System (INIS)

    Christmas, P.; Nichols, A.L.; Lorenz, A.

    1987-09-01

    The first official meeting of the IAEA Coordinated Research Programme on the Measurement and Evaluation of X- and Gamma-ray Standards for Detector Calibration was held in Rome from 11 to 13 June 1987. Work undertaken by the CRP members was reviewed in detail: specific problems in the evaluations were identified and actions placed on the participants to resolve these issues. (author). 3 tabs

  8. Gamma-ray bursts - a critical review

    International Nuclear Information System (INIS)

    Tudose, Valeriu; Biermann, Peter

    2003-01-01

    We present a short general introduction into the field of gamma-ray bursts (GRBs) research, summarizing the past and the present status. We give an general view of the GRBs observations to date, both in the prompt emission phase as well as in the afterglow phase, and a brief primer into the theory, mainly in the frame-work of the fireball model. (authors)

  9. Balloon observation of gamma-ray burst

    International Nuclear Information System (INIS)

    Nishimura, Jun; Fujii, Masami; Yamagami, Takamasa; Oda, Minoru; Ogawara, Yoshiaki

    1978-01-01

    Cosmic gamma-ray burst is an interesting high energy astrophysical phenomenon, but the burst mechanism has not been well understood. Since 1975, long duration balloon flight has been conducted to search for gamma-ray bursts and to determine the source locations. A rotating cross-modulation collimator was employed to determine the locations of sources, and four NaI(Tl) scintillation counters were employed to detect hard X-ray with energy from 20 to 200 keV. The balloon light was performed at altitude of 8.3 mb from September 28, 1977, and the observation time of 79 hours was achieved. In this experiment, the monitor counter was not mounted. The count increase was observed at 16 h 22 m 31 s JST on October 1, 1977. The event disappeared after 1 sec. The total flux is estimated to be 1.6 x 10 -6 erg/cm 2 sec at the top of the atmosphere. When this event was observed, the solar-terrestrial environment was also quiet. Thus, this event was attributed to a small gamma-ray burst. Unfortunately, the duration of the burst was so short that the position of the burst source was not able to be determined. (Yoshimori, M.)

  10. Prompt Gamma Ray Analysis of Soil Samples

    Energy Technology Data Exchange (ETDEWEB)

    Naqvi, A.A.; Khiari, F.Z.; Haseeb, S.M.A.; Hussein, Tanvir; Khateeb-ur-Rehman [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia); Isab, A.H. [Department of Chemistry, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia)

    2015-07-01

    Neutron moderation effects were measured in bulk soil samples through prompt gamma ray measurements from water and benzene contaminated soil samples using 14 MeV neutron inelastic scattering. The prompt gamma rays were measured using a cylindrical 76 mm x 76 mm (diameter x height) LaBr{sub 3}:Ce detector. Since neutron moderation effects strongly depend upon hydrogen concentration of the sample, for comparison purposes, moderation effects were studied from samples containing different hydrogen concentrations. The soil samples with different hydrogen concentration were prepared by mixing soil with water as well as benzene in different weight proportions. Then, the effects of increasing water and benzene concentrations on the yields of hydrogen, carbon and silicon prompt gamma rays were measured. Moderation effects are more pronounced in soil samples mixed with water as compared to those from soil samples mixed with benzene. This is due to the fact that benzene contaminated soil samples have about 30% less hydrogen concentration by weight than the water contaminated soil samples. Results of the study will be presented. (authors)

  11. AGILE: A gamma-ray mission

    International Nuclear Information System (INIS)

    Tavani, M.; Caraveo, P.; Mereghetti, S.; Perotti, F.; Vercellone, S.; Barbiellini, G.; Budini, G.; Longo, F.; Prest, M.; Vallazza, E.; Cocco, V.; Morselli, A.; Picozza, P.; Pittori, C.; Costa, E.; Feroci, M.; Lapshov, I.; Morelli, E.; Rubini, A.; Soffitta, P.

    2000-01-01

    AGILE is an innovative, cost-effective gamma-ray mission selected by the Italian Space Agency for a Program of Small Scientific Missions. The AGILE gamma-ray imaging detector (GRID, made of a Silicon tracker and CsI Mini-Calorimeter) is designed to detect and image photons in the 30 MeV-50 GeV energy band with good sensitivity and very large field of view (FOV ∼3 sr). The X-ray detector, Super-AGILE, sensitive in the 10-40 keV band and integrated on top of the GRID gamma-ray tracker will provide imaging (1-3 arcmin) and moderate spectroscopy. For selected sky areas, AGILE might achieve a flux sensitivity (above 100 MeV) better than 5x10 -8 ph cm 2 s -1 at the completion of its scientific program. AGILE will operate as an Observatory open to the international community and is planned to be operational during the year 2002 for a nominal 2-year mission. It will be an ideal 'bridge' between EGRET and GLAST, and the only mission entirely dedicated to high-energy astrophysics above 30 MeV during that period

  12. Gamma ray irradiation characteristics of SM fibers

    International Nuclear Information System (INIS)

    Ito, Ryuichi; Okano, Hiroaki; Hashiba, Keichi; Nakai, Hisanori

    1987-01-01

    1.3 μm range single mode (SM) optical fibers have been used for wide application of mainly long distance communication. At present, in order to realize the larger capacity and longer distance between relay points, the development of 1.5 μm range SM fibers of low dispersion and small loss has been actively promoted. As for the radiation withstanding property of SM fibers, report is scarce. The authors reported on the gamma ray irradiation characteristics of 1.3 μm range SM fibers, but since 1.5 μm range SM fibers are designed with the different structure from that of 1.3 μm fibers, it is necessary to evaluate from new viewpoint. In this report, mainly on the structure having triangular distribution, the effect that the manufacturing condition and the structural defects of glass exert on the gamma ray irradiation characteristics is described. The specimens were mainly dispersion shift type fibers (DSF), and for comparison, single window, double window and 1.3 μm SM fibers were examined. Co-60 gamma ray was irradiated, and the optical loss and electron spin resonance were measured. By low temperature and low speed drawing, the good result in the optical loss was obtained. The presence of oxygen at the time of sintering materials had no effect. The dependence of the ESR on the drawing condition was not very remarkable. (Kako, I.)

  13. Radio Flares from Gamma-ray Bursts

    Science.gov (United States)

    Kopač, D.; Mundell, C. G.; Kobayashi, S.; Virgili, F. J.; Harrison, R.; Japelj, J.; Guidorzi, C.; Melandri, A.; Gomboc, A.

    2015-06-01

    We present predictions of centimeter and millimeter radio emission from reverse shocks (RSs) in the early afterglows of gamma-ray bursts (GRBs) with the goal of determining their detectability with current and future radio facilities. Using a range of GRB properties, such as peak optical brightness and time, isotropic equivalent gamma-ray energy, and redshift, we simulate radio light curves in a framework generalized for any circumburst medium structure and including a parameterization of the shell thickness regime that is more realistic than the simple assumption of thick- or thin-shell approximations. Building on earlier work by Mundell et al. and Melandri et al. in which the typical frequency of the RS was suggested to lie at radio rather than optical wavelengths at early times, we show that the brightest and most distinct RS radio signatures are detectable up to 0.1-1 day after the burst, emphasizing the need for rapid radio follow-up. Detection is easier for bursts with later optical peaks, high isotropic energies, lower circumburst medium densities, and at observing frequencies that are less prone to synchrotron self-absorption effects—typically above a few GHz. Given recent detections of polarized prompt gamma-ray and optical RS emission, we suggest that detection of polarized radio/millimeter emission will unambiguously confirm the presence of low-frequency RSs at early time.

  14. RADIO FLARES FROM GAMMA-RAY BURSTS

    International Nuclear Information System (INIS)

    Kopač, D.; Mundell, C. G.; Kobayashi, S.; Virgili, F. J.; Harrison, R.; Japelj, J.; Gomboc, A.; Guidorzi, C.; Melandri, A.

    2015-01-01

    We present predictions of centimeter and millimeter radio emission from reverse shocks (RSs) in the early afterglows of gamma-ray bursts (GRBs) with the goal of determining their detectability with current and future radio facilities. Using a range of GRB properties, such as peak optical brightness and time, isotropic equivalent gamma-ray energy, and redshift, we simulate radio light curves in a framework generalized for any circumburst medium structure and including a parameterization of the shell thickness regime that is more realistic than the simple assumption of thick- or thin-shell approximations. Building on earlier work by Mundell et al. and Melandri et al. in which the typical frequency of the RS was suggested to lie at radio rather than optical wavelengths at early times, we show that the brightest and most distinct RS radio signatures are detectable up to 0.1–1 day after the burst, emphasizing the need for rapid radio follow-up. Detection is easier for bursts with later optical peaks, high isotropic energies, lower circumburst medium densities, and at observing frequencies that are less prone to synchrotron self-absorption effects—typically above a few GHz. Given recent detections of polarized prompt gamma-ray and optical RS emission, we suggest that detection of polarized radio/millimeter emission will unambiguously confirm the presence of low-frequency RSs at early time

  15. Gamma rays from the interstellar medium

    International Nuclear Information System (INIS)

    Bloemen, J.B.G.M.

    1985-01-01

    This thesis describes new gamma-ray views on cosmic rays and the interstellar medium. The author describes the COS-B data base and the pre-launch and in-flight calibration data used for all analyses. Diffuse galactic gamma radiation (> 50 MeV) may be either a result of cosmic-ray-matter interactions, or of the cosmic-ray electrons with the interstellar radiation field (mainly at optical and infrared wavelengths), through the inverse-Compton process. A detailed comparison between the gamma-ray observations of the large complex of interstellar clouds in Orion and Monoceros and the CO and HI surveys of this region is given. It gives insight into the cloud penetration of cosmic rays and in the relation between CO detections and molecular hydrogen column densities. Next, the radial distribution of gamma rays in the Galaxy is studied, as well as the galactic centre (more precisely, the central 400 pc), which contains a large concentration of CO molecules. The H 2 /CO abundance and the cosmic-ray density in the galactic centre are discussed and compared to the findings for the galactic disk. In various analyses in this thesis a likelihood-ratio method is applied for parameter estimation and hypothesis testing. A general description of this method is added as an appendix. (Auth.)

  16. Gamma-ray Output Spectra from 239 Pu Fission

    International Nuclear Information System (INIS)

    Ullmann, John

    2015-01-01

    Gamma-ray multiplicities, individual gamma-ray energy spectra, and total gamma energy spectra following neutron-induced fission of 239 Pu were measured using the DANCE detector at Los Alamos. Corrections for detector response were made using a forward-modeling technique based on propagating sets of gamma rays generated from a paramaterized model through a GEANT model of the DANCE array and adjusting the parameters for best fit to the measured spectra. The results for the gamma-ray spectrum and multiplicity are in general agreement with previous results, but the measured total gamma-ray energy is about 10% higher. A dependence of the gamma-ray spectrum on the gamma-ray multplicity was also observed. Global model calculations of the multiplicity and gamma energy distributions are in good agreement with the data, but predict a slightly softer total-energy distribution

  17. Catalog of gamma-rays unplaced in radioactive decay schemes

    International Nuclear Information System (INIS)

    Narita, Tsutomu; Kitao, Kensuke.

    1991-03-01

    A catalog is made for gamma-rays emitted in decay of radioactive nuclides but not placed in their decay schemes. It consists of two tables. In Table 1, the number of these unplaced gamma-ray components by a nuclide is given together with the fraction of total intensity of these gamma-rays to that of all observed gamma-rays. In Table 2, the unplaced gamma-rays are arranged in order of increasing energy. Each line of this table contains the gamma-ray energy, intensity, nuclide identification, and energies and intensities of the most prominent gamma-rays from the decay of the radionuclides. This catalog is a compilation from Evaluated Nuclear Structure Data File (ENSDF) maintained by National Nuclear Data Center at Brookhaven National Laboratory, of at February 1990. (author)

  18. Lunar occultations for gamma-ray source measurements

    Science.gov (United States)

    Koch, David G.; Hughes, E. B.; Nolan, Patrick L.

    1990-01-01

    The unambiguous association of discrete gamma-ray sources with objects radiating at other wavelengths, the separation of discrete sources from the extended emission within the Galaxy, the mapping of gamma-ray emission from nearby galaxies and the measurement of structure within a discrete source cannot presently be accomplished at gamma-ray energies. In the past, the detection processes used in high-energy gamma-ray astronomy have not allowed for good angular resolution. This problem can be overcome by placing gamma-ray detectors on the moon and using the horizon as an occulting edge to achieve arcsec resolution. For purposes of discussion, this concept is examined for gamma rays above 100 MeV for which pair production dominates the detection process and locally-generated nuclear gamma rays do not contribute to the background.

  19. Physical constraints on models of gamma-ray bursters

    International Nuclear Information System (INIS)

    Epstein, R.I.

    1985-01-01

    This report deals with the constraints that can be placed on models of gamma-ray burst sources based on only the well-established observational facts and physical principles. The premise is developed that the very hard x-ray and gamma-ray continua spectra are well-established aspects of gamma-ray bursts. Recent theoretical work on gamma-ray bursts are summarized with emphasis on the geometrical properties of the models. Constraints on the source models which are implied by the x-ray and gamma-ray spectra are described. The allowed ranges for the luminosity and characteristic dimension for gamma-ray burst sources are shown. Some of the deductions and inferences about the nature of the gamma-ray burst sources are summarized. 67 refs., 3 figs

  20. A link between prompt optical and prompt gamma-ray emission in gamma-ray bursts.

    Science.gov (United States)

    Vestrand, W T; Wozniak, P R; Wren, J A; Fenimore, E E; Sakamoto, T; White, R R; Casperson, D; Davis, H; Evans, S; Galassi, M; McGowan, K E; Schier, J A; Asa, J W; Barthelmy, S D; Cummings, J R; Gehrels, N; Hullinger, D; Krimm, H A; Markwardt, C B; McLean, K; Palmer, D; Parsons, A; Tueller, J

    2005-05-12

    The prompt optical emission that arrives with the gamma-rays from a cosmic gamma-ray burst (GRB) is a signature of the engine powering the burst, the properties of the ultra-relativistic ejecta of the explosion, and the ejecta's interactions with the surroundings. Until now, only GRB 990123 had been detected at optical wavelengths during the burst phase. Its prompt optical emission was variable and uncorrelated with the prompt gamma-ray emission, suggesting that the optical emission was generated by a reverse shock arising from the ejecta's collision with surrounding material. Here we report prompt optical emission from GRB 041219a. It is variable and correlated with the prompt gamma-rays, indicating a common origin for the optical light and the gamma-rays. Within the context of the standard fireball model of GRBs, we attribute this new optical component to internal shocks driven into the burst ejecta by variations of the inner engine. The correlated optical emission is a direct probe of the jet isolated from the medium. The timing of the uncorrelated optical emission is strongly dependent on the nature of the medium.

  1. Local gamma ray events as tests of the antimatter theory of gamma ray bursts

    International Nuclear Information System (INIS)

    Sofia, S.; Wilson, R.E.

    1976-01-01

    Nearby examples of the antimatter 'chunks' postulated by Sofia and Van Horn to explain the cosmic gamma ray bursts may produce detectable gamma ray events when struck by solar system meteoroids. These events would have a much shorter time scale and higher energy spectrum than the bursts already observed. In order to have a reasonably high event rate, the local meteoroid population must extend to a distance from the Sun of the order of 0.1 pc, but the required distance could become much lower if the instrumental threshold is improved. The expected gamma ray flux for interaction of the antimatter bodies with the solar wind is also examined, and found to be far below present instrumental capabilities. (Auth.)

  2. Gamma-ray relative energy response of Ce: YAG crystal

    International Nuclear Information System (INIS)

    Zhang Jianhua; Zhang Chuanfei; Hu Mengchun; Peng Taiping; Wang Zhentong; Tang Dengpan; Zhao Guangjun

    2010-01-01

    Gamma-ray relative energy response of Ce: YAG crystal, which is important for pulsed γ-ray measurement, was studied in this work.The Ce: YAG crystal, which was developed at Shanghai Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, was aligned point by point with γ-rays scattered from an industrial 60 Co line source. The γ-ray relative energy response was calculated using the mass attenuation coefficient. The results show that the numerical calculation method of γ-ray relative energy response is reliable, and the experimental method with multi-energy point γ-ray by Compton scattering is also feasible, that can be used for checking up correctness of the numerical calculation results. (authors)

  3. Neutron and gamma-ray transport experiments in liquid air

    International Nuclear Information System (INIS)

    Farley, W.E.

    1976-01-01

    Accurate estimates of neutron and gamma radiations from a nuclear explosion and their subsequent transport through the atmosphere are vital to nuclear-weapon employment studies: i.e., for determining safety radii for aircraft crews, casualty and collateral-damage risk radii for tactical weapons, and the kill range from a high-yield defensive burst for a maneuvering reentry vehicle. Radiation transport codes, such as the Laboratory's TARTNP, are used to calculate neutron and gamma fluences. Experiments have been performed to check and update these codes. Recently, a 1.3-m-radius liquid-air (21 percent oxygen) sphere, with a pulsed source of 14-MeV neutrons at its center, was used to measure the fluence and spectra of emerging neutrons and secondary gamma rays. Comparison of measured radiation dose with TARTNP showed agreement within 10 percent

  4. Terrestrial gamma-ray flash production by lightning

    Science.gov (United States)

    Carlson, Brant E.

    Terrestrial gamma-ray flashes (TGFs) are brief flashes of gamma-rays originating in the Earth's atmosphere and observed by satellites. First observed in 1994 by the Burst And Transient Source Experiment on board the Compton Gamma-Ray Observatory, TGFs consist of one or more ˜1 ms pulses of gamma-rays with a total fluence of ˜1/cm2, typically observed when the satellite is near active thunderstorms. TGFs have subsequently been observed by other satellites to have a very hard spectrum (harder than dN/d E ∝ 1/ E ) that extends from below 25 keV to above 20 MeV. When good lightning data exists, TGFs are closely associated with measurable lightning discharge. Such discharges are typically observed to occur within 300 km of the sub-satellite point and within several milliseconds of the TGF observation. The production of these intense energetic bursts of photons is the puzzle addressed herein. The presence of high-energy photons implies a source of bremsstrahlung, while bremsstrahlung implies a source of energetic electrons. As TGFs are associated with lightning, fields produced by lightning are naturally suggested to accelerate these electrons. Initial ideas about TGF production involved electric fields high above thunderstorms as suggested by upper atmospheric lightning research and the extreme energies required for lower-altitude sources. These fields, produced either quasi-statically by charges in the cloud and ionosphere or dynamically by radiation from lightning strokes, can indeed drive TGF production, but the requirements on the source lightning are too extreme and therefore not common enough to account for all existing observations. In this work, studies of satellite data, the physics of energetic electron and photon production, and consideration of lightning physics motivate a new mechanism for TGF production by lightning current pulses. This mechanism is then developed and used to make testable predictions. TGF data from satellite observations are compared

  5. Multi-messenger Light Curves from Gamma-Ray Bursts in the Internal Shock Model

    Energy Technology Data Exchange (ETDEWEB)

    Bustamante, Mauricio [Center for Cosmology and AstroParticle Physics (CCAPP), The Ohio State University, Columbus, OH 43210 (United States); Heinze, Jonas; Winter, Walter [Deutsches Elektronen-Synchrotron (DESY), Platanenallee 6, D-15738 Zeuthen (Germany); Murase, Kohta, E-mail: bustamanteramirez.1@osu.edu, E-mail: walter.winter@desy.de, E-mail: jonas.heinze@desy.de, E-mail: murase@psu.edu [Center for Particle and Gravitational Astrophysics, The Pennsylvania State University, University Park, PA16802 (United States)

    2017-03-01

    Gamma-ray bursts (GRBs) are promising as sources of neutrinos and cosmic rays. In the internal shock scenario, blobs of plasma emitted from a central engine collide within a relativistic jet and form shocks, leading to particle acceleration and emission. Motivated by present experimental constraints and sensitivities, we improve the predictions of particle emission by investigating time-dependent effects from multiple shocks. We produce synthetic light curves with different variability timescales that stem from properties of the central engine. For individual GRBs, qualitative conclusions about model parameters, neutrino production efficiency, and delays in high-energy gamma-rays can be deduced from inspection of the gamma-ray light curves. GRBs with fast time variability without additional prominent pulse structure tend to be efficient neutrino emitters, whereas GRBs with fast variability modulated by a broad pulse structure can be inefficient neutrino emitters and produce delayed high-energy gamma-ray signals. Our results can be applied to quantitative tests of the GRB origin of ultra-high-energy cosmic rays, and have the potential to impact current and future multi-messenger searches.

  6. Multi-messenger light curves from gamma-ray bursts in the internal shock model

    Energy Technology Data Exchange (ETDEWEB)

    Bustamante, Mauricio [Ohio State Univ., Columbus, OH (United States). Center for Cosmology and AstroParticle Physics (CCAPP); Ohio State Univ., Columbus, OH (United States). Dept. of Physics; Murase, Kohta [Pennsylvania State Univ., University Park, PA (United States). Center for Particle and Gravitational Astrophysics; Pennsylvania State Univ., University Park, PA (United States). Dept. of Astronomy and Astrophysics; Winter, Walter [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2016-06-15

    Gamma-ray bursts (GRBs) are promising as sources of neutrinos and cosmic rays. In the internal shock scenario, blobs of plasma emitted from a central engine collide within a relativistic jet and form shocks, leading to particle acceleration and emission. Motivated by present experimental constraints and sensitivities, we improve the predictions of particle emission by investigating time-dependent effects from multiple shocks. We produce synthetic light curves with different variability timescales that stem from properties of the central engine. For individual GRBs, qualitative conclusions about model parameters, neutrino production efficiency, and delays in high-energy gamma rays can be deduced from inspection of the gamma-ray light curves. GRBs with fast time variability without additional prominent pulse structure tend to be efficient neutrino emitters, whereas GRBs with fast variability modulated by a broad pulse structure tend to be inefficient neutrino emitters and produce delayed high-energy gamma-ray signals. Our results can be applied to quantitative tests of the GRB origin of ultra-high-energy cosmic rays, and have the potential to impact current and future multi-messenger searches.

  7. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta

    2017-01-01

    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  8. Detection of SNM by delayed gamma rays from induced fission

    International Nuclear Information System (INIS)

    Rennhofer, H.; Crochemore, J.-M.; Roesgen, E.; Pedersen, B.

    2011-01-01

    The Pulsed Neutron Interrogation Test Assembly (PUNITA) is an experimental device for research in NDA methods and field applicable instrumentation for nuclear safeguards and security applications. PUNITA incorporates a standard 14-MeV (D-T) pulsed neutron generator inside a large graphite mantle. The generator target is surrounded by a thick tungsten filter with the purpose to increase the neutron output and to tailor the neutron energy spectrum. In this configuration a sample may be exposed to a relatively high average thermal neutron flux of about (2.2±0.1)x10 3 s -1 cm -2 at only 10% of the maximum target neutron emission. The sample cavity is large enough to allow variation of the experimental setup including the fissile sample, neutron and gamma detectors, and shielding materials. The response from SNM samples of different fissile material content was investigated with various field-applicable scintillation gamma detectors such as the 3x2 in. LaBr 3 detector. Shielding in the form of tungsten and cadmium was applied to the detector to improve the signal to background ratio. Gamma and neutron shields surrounding the samples were also tested for the purpose of simulating clandestine conduct. The energy spectra of delayed gamma rays were recorded in the range 100 keV-9 MeV. In addition time spectra of delayed gamma rays in the range 3.3-8 MeV were recorded in the time period of 10 ms-120 s after the 14-MeV neutron burst. The goal of the experiment was to optimize the sample/detector configuration including the energy range and time period for SNM detection. The results show, for example, that a 170 g sample of depleted uranium can be detected with the given setup in less than 3 min of investigation. Samples of higher enrichment or higher mass are detected in much shorter time.

  9. GAMMA RAYS FROM STAR FORMATION IN CLUSTERS OF GALAXIES

    International Nuclear Information System (INIS)

    Storm, Emma M.; Jeltema, Tesla E.; Profumo, Stefano

    2012-01-01

    Star formation in galaxies is observed to be associated with gamma-ray emission, presumably from non-thermal processes connected to the acceleration of cosmic-ray nuclei and electrons. The detection of gamma rays from starburst galaxies by the Fermi Large Area Telescope (LAT) has allowed the determination of a functional relationship between star formation rate and gamma-ray luminosity. Since star formation is known to scale with total infrared (8-1000 μm) and radio (1.4 GHz) luminosity, the observed infrared and radio emission from a star-forming galaxy can be used to quantitatively infer the galaxy's gamma-ray luminosity. Similarly, star-forming galaxies within galaxy clusters allow us to derive lower limits on the gamma-ray emission from clusters, which have not yet been conclusively detected in gamma rays. In this study, we apply the functional relationships between gamma-ray luminosity and radio and IR luminosities of galaxies derived by the Fermi Collaboration to a sample of the best candidate galaxy clusters for detection in gamma rays in order to place lower limits on the gamma-ray emission associated with star formation in galaxy clusters. We find that several clusters have predicted gamma-ray emission from star formation that are within an order of magnitude of the upper limits derived in Ackermann et al. based on non-detection by Fermi-LAT. Given the current gamma-ray limits, star formation likely plays a significant role in the gamma-ray emission in some clusters, especially those with cool cores. We predict that both Fermi-LAT over the course of its lifetime and the future Cerenkov Telescope Array will be able to detect gamma-ray emission from star-forming galaxies in clusters.

  10. Common Gamma-ray Glows above Thunderclouds

    Science.gov (United States)

    Kelley, Nicole; Smith, David; Dwyer, Joseph; Hazelton, Bryna; Grefenstette, Brian; Lowell, Alex; Splitt, Michael; Lazarus, Steven; Rassoul, Hamid

    2013-04-01

    Gamma-ray glows are continuous, long duration gamma- and x-ray emission seen coming from thunderclouds. The Airborne for Energetic Lightning Emissions (ADELE) observed 12 gamma-ray glows during its summer 2009 flight campaign over the areas of Colorado and Florida in the United States. For these glows we shall present their spectra, relationship to lightning activity and how their duration and size changes as a function of distance. Gamma-ray glows follow the relativistic runaway electron avalanche (RREA) spectrum and have been previously measured from the ground and inside the cloud. ADELE measured most glows as it flew above the screening layer of the cloud. During the brightest glow on August 21, 2009, we can show that we are flying directly into a downward facing relativistic runaway avalanche, indicative of flying between the upper positive and negative screening layer of the cloud. In order to explain the brightness of this glow, RREA with an electric field approaching the limit for relativistic feedback must be occurring. Using all 12 glows, we show that lightning activity diminishes during the onset of the glow. Using this along with the fact that glows occur as the field approaches the level necessary for feedback, we attempt to distinguish between two possibilities: that glows are evidence that RREA with feedback, rather than lightning, is sometimes the primary channel for discharging the cloud, or else that the overall discharging is still controlled by lightning, with glows simply appearing during times when a subsidence of lightning allows the field to rise above the threshold for RREA.

  11. Variable code gamma ray imaging system

    International Nuclear Information System (INIS)

    Macovski, A.; Rosenfeld, D.

    1979-01-01

    A gamma-ray source distribution in the body is imaged onto a detector using an array of apertures. The transmission of each aperture is modulated using a code such that the individual views of the source through each aperture can be decoded and separated. The codes are chosen to maximize the signal to noise ratio for each source distribution. These codes determine the photon collection efficiency of the aperture array. Planar arrays are used for volumetric reconstructions and circular arrays for cross-sectional reconstructions. 14 claims

  12. Detection circuit for gamma-ray burst

    International Nuclear Information System (INIS)

    Murakami, Hiroyuki; Yamagami, Takamasa; Mori, Kunishiro; Uchiyama, Sadayuki.

    1982-01-01

    A new gamma-ray burst detection system is described. The system was developed as an environmental monitor of an accelerator, and can be used as the burst detection system. The system detects the arrival time of burst. The difference between the arrival times detected at different places will give information on the burst source. The frequency of detecting false burst was estimated, and the detection limit under the estimated frequency of false burst was also calculated. Decision whether the signal is false or true burst was made by the statistical treatment. (Kato, T.)

  13. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1986-01-01

    The Whipple Observatory's atmospheric Cerenkov camera has detected TeV radiation from four galactic sources: the Crab Nebula, Cygnus X-3, Hercules X-1, and 4U0115+63. Recent simulations encourage the view that unwanted cosmic-ray background showers may be suppressed by a large factor. Emphasis in the coming year will be on determining optimum selection criteria for enhancing gamma-ray signals and in developing a prototype camera with finer angular resolution as a first step towards implementation of the HERCULES concept

  14. Gamma ray induced decomposition of lanthanide nitrates

    International Nuclear Information System (INIS)

    Joshi, N.G.; Garg, A.N.

    1992-01-01

    Gamma ray induced decomposition of the lanthanide nitrates, Ln(NO 3 ) 3 .xH 2 O where Ln=La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Tm and Yb has been studied at different absorbed doses up to 600 kGy. G(NO 2 - ) values depend on the absorbed dose and the nature of the outer cation. It has been observed that those lanthanides which exhibit variable valency (Ce and Eu) show lower G-values. An attempt has been made to correlate thermal and radiolytic decomposition processes. (author). 20 refs., 3 figs., 1 tab

  15. Very high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Weekes, T.C.

    1989-01-01

    It is apparent that very high gamma-ray astronomy, at the very end of the electromagnetic spectrum, is just at the threshold of becoming an important channel of astronomical information. The author discusses how, to fully develop, it requires telescopes with improved minimum flux sensitivity; development of techniques that characterize the nature of the primary; more overlapping observations to remove any question of the reality of the detected phenomenon; more consistency in the application of statistics among experimenters and more openness about methods used; development of models that will predict the phenomenon to be expected rather than explain what has been observed; and more accurate calibrations to determine absolute fluxes and energies

  16. Gamma-Ray Spectrum Analysis Software GDA

    International Nuclear Information System (INIS)

    Wanabongse, P.

    1998-01-01

    The developmental work on computer software for gamma-ray spectrum analysis has been completed as a software package version 1.02 named GDA, which is an acronym for Gamma-spectrum Deconvolution and Analysis. The software package consists of three 3.5-inch diskettes for setup and a user's manual. GDA software can be installed for using on a personal computer with Windows 95 or Windows NT 4.0 operating system. A computer maybe the type of 80486 CPU with 8 megabytes of memory

  17. Gamma ray bursts from extragalactic sources

    Science.gov (United States)

    Hoyle, Fred; Burbidge, Geoffrey

    1992-01-01

    The properties of gamma ray bursts of classical type are found to be explicable in terms of high speed collisions between stars. A model is proposed in which the frequency of such collisions can be calculated. The model is then applied to the nuclei of galaxies in general on the basis that galaxies, or at least some fraction of them, originate in the expulsion of stars from creation centers. Evidence that low level activity of this kind is also taking place at the center of our own Galaxy is discussed. The implications for galactic evolution are discussed and a negative view of black holes is taken.

  18. Gamma ray thermometrical facility for nuclear reactor

    International Nuclear Information System (INIS)

    Smith, R.D.; Regazzoni, Pierre.

    1981-01-01

    This invention concerns a gamma ray thermometer for nuclear reactors, fitted with a thermal bridge for use as a centring device. In accordance with the invention, an elastic device fills all the annular space between the gamma thermometer and the orifice through which the thermometer is introduced. This elastic device has the two-fold role of providing a thermal bridge at the gamma thermometer location suitable as a heat well, and of acting as a device for centring the thermometer in the orifice into which it has been introduced [fr

  19. Principles and techniques of gamma ray tracers

    International Nuclear Information System (INIS)

    Claxton, K.T.

    1978-01-01

    Radioactive tracer techniques provide a very sensitive means of studying physical and chemical processes in a whole variety of different media. Some of the techniques and principles of radioactive tracers and their application to practical engineering systems are discussed. Information which has been found useful in the design of high temperature liquid sodium facilities employing radio-tracers, is presented. The report deals solely with the use of gamma-emitting species as the tracer. These find particular application for in-situ studies on engineering systems where the highly penetrating properties of gamma rays are needed for detection through strongly absorbent media such as stainless steel pepe walls. (author)

  20. Gamma ray constraints on decaying dark matter

    DEFF Research Database (Denmark)

    Cirelli, M.; Moulin, E.; Panci, P.

    2012-01-01

    We derive new bounds on decaying dark matter from the gamma ray measurements of (i) the isotropic residual (extragalactic) background by Fermi and (ii) the Fornax galaxy cluster by H.E.S.S. We find that those from (i) are among the most stringent constraints currently available, for a large range...... of dark matter masses and a variety of decay modes, excluding half-lives up to similar to 10(26) to few 10(27) seconds. In particular, they rule out the interpretation in terms of decaying dark matter of the e(+/-) spectral features in PAMELA, Fermi and H.E.S.S., unless very conservative choices...

  1. Gamma ray spectroscopy with Arduino UNO

    Science.gov (United States)

    Lavelle, C. M.

    2018-05-01

    We review a simple gamma ray spectrometer constructed on a solderless breadboard. The spectrometer's detector consists of a CsI(Tl) scintillator and silicon photomultiplier (SiPM) and its readout is facilitated by an Arduino UNO. The system is low cost and utilizes a minimum of components while still achieving satisfactory charge linearity and noise levels. This instrument can be used in instructional laboratories to introduce both radiation detection and analog signal processing concepts. We also expect it will be of interest to those seeking to introduce gamma spectroscopy to the expanding ecosystem of Arduino hardware.

  2. Comptonization of gamma rays by cold electrons

    International Nuclear Information System (INIS)

    Xu, Yueming; Ross, R.R.; Mccray, R.

    1991-01-01

    An analytic method is developed for calculating the emergent spectrum of gamma-rays and X-rays scattered in a homogeneous medium with low-temperature electrons. The Klein-Nishina corrections of the scattering cross section and absorption processes are taken in account. The wavelength relaxation and the spatial diffusion problems are solved separately, and the emergent spectrum is calculated by convolving the evolution function of the spectrum in an infinite medium with the photon luminosity resulting from the spatial diffusion in a finite sphere. The analytic results are compared with that of Monte Carlo calculations and it is concluded that the analytic result is quite accurate. 9 refs

  3. Recent developments in airborne gamma ray surveying

    International Nuclear Information System (INIS)

    Grasty, Robert L.

    1999-01-01

    Standardized procedures have been developed for converting airborne gamma ray measurements to ground concentrations of potassium, uranium and thorium. These procedures make use of an airborne calibration range whose ground concentrations should be measured with a calibrated portable spectrometer rather than by taking geochemical samples. Airborne sensitivities and height attenuation coefficients are normally determined from flights over the calibration range but may not be applicable in mountainous areas. Mathematical techniques have been now developed to reduce statistical noise in the airborne measurements by utilizing up to 256 channels of spectral information. (author)

  4. Probing the very-high-energy gamma-ray spectral curvature in the blazar PG 1553+113 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L

    2015-01-01

    PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.

  5. Contribution to gamma ray transport calculation in heterogeneous media

    International Nuclear Information System (INIS)

    Bourdet, L.

    1985-04-01

    This thesis presents the development of gamma transport calculation codes in three dimension heterogeneous geometries. These codes allow us to define the protection against gamma-rays or verify their efficiency. The laws that govern the interactions of gamma-rays with matters are briefly revised. A library with the all necessary constants for these codes is created. TRIPOLI-2, a code that treats in exact way the neutron transport in matters using Monte-Carlo method, has been adapted to deal with the transport of gamma-rays in matters as well. TRINISHI, a code which considers only one collision, has been realized to treat heterogeneous geometries containing voids. Elaborating a formula that calculates the albedo for gamma-ray reflection (the code ALBANE) allows us to solve the problem of gamma-ray reflection on plane surfaces. NARCISSE-2 deals with gamma-rays that suffer only one reflection on the inner walls of any closed volume (rooms, halls...) [fr

  6. Review of GRANAT observations of gamma-ray bursts

    DEFF Research Database (Denmark)

    Terekhov, O.; Denissenko, D.; Sunyaev, R.

    1995-01-01

    The GRANAT observatory was launched into a high apogee orbit on 1 December, 1989. Three instruments onboard GRANAT - PHEBUS, WATCH and SIGMA are able to detect gamma-ray bursts in a very broad energy range from 6 keV up to 100 MeV. Over 250 gamma-ray bursts were detected. We discuss the results...... of the observations of the time histories and spectral evolution of the detected events provided by the different instruments in different energy ranges. Short Gamma-Ray Bursts ( 2 s) events. Evidence of the existence...... of four differently behaving componenents in gamma-ray burst spectra is discussed. Statistical properties of the gamma-ray burst sources based on the 5 years of observations with (∼ 10−6 erg/cm2) sensitivity as well as the results of high sensitivity (∼ 10−8 erg/cm2) search for Gamma-Ray Bursts within...

  7. Highlights of GeV Gamma-Ray Astronomy

    Science.gov (United States)

    Thompson, David J.

    2010-01-01

    Because high-energy gamma rays are primarily produced by high-energy particle interactions, the gamma-ray survey of the sky by the Fermi Gamma-ray Space Telescope offers a view of sites of cosmic ray production and interactions. Gamma-ray bursts, pulsars, pulsar wind nebulae, binary sources, and Active Galactic Nuclei are all phenomena that reveal particle acceleration through their gamma-ray emission. Diffuse Galactic gamma radiation, Solar System gamma-ray sources, and energetic radiation from supernova remnants are likely tracers of high-energy particle interactions with matter and photon fields. This paper will present a broad overview of the constantly changing sky seen with the Large Area Telescope (LAT) on the Fermi spacecraft.

  8. Microwave-gamma ray water in crude monitor

    International Nuclear Information System (INIS)

    Paap, H.J.

    1984-01-01

    A microwave-gamma ray water-in-crude monitoring system measures the percent quantity of fresh water or salt water in crude oil flowing in a pipe line. The system includes a measuring cell arranged with the pipe line so that the crude oil flows through the measuring cell. A microwave transmitter subsystem and a gamma ray source are arranged with the measuring cell so that microwave energy and gamma rays are transmitted through the measuring cell. A microwave receiving subsystem and a gamma ray detector provide signals corresponding to received microwave energy and to the received gamma rays, respectively. Apparatus connected to the microwave receiver and to the gamma ray detector provides an indication of the percentage of water in the crude oil

  9. The Animated Gamma-ray Sky Revealed by the Fermi Gamma-ray Space Telescope

    International Nuclear Information System (INIS)

    Grenier, Isabelle

    2009-01-01

    The Fermi Gamma-ray Space Telescope has been observing the sky in gamma-rays since August 2008. In addition to breakthrough capabilities in energy coverage (20 MeV-300 GeV) and angular resolution, the wide field of view of the Large Area Telescope enables observations of 20% of the sky at any instant, and of the whole sky every three hours. It has revealed a very animated sky with bright gamma-ray bursts flashing and vanishing in minutes, powerful active galactic nuclei flaring over hours and days, many pulsars twinkling in the Milky Way, and X-ray binaries shimmering along their orbit. Most of these variable sources had not been seen by the Fermi predecessor, EGRET, and the wealth of new data already brings important clues to the origin of the high-energy emission and particles powered by the compact objects. The telescope also brings crisp images of the bright gamma-ray emission produced by cosmic-ray interactions in the interstellar medium, thus allowing to measure the cosmic nuclei and electron spectra across the Galaxy, to weigh interstellar clouds, in particular in the dark-gas phase. The telescope sensitivity at high energy will soon provide useful constraints on dark-matter annihilations in a variety of environments. I will review the current results and future prospects of the Fermi mission.

  10. Collimatorless imaging of gamma rays with help of gamma-ray tracking

    CERN Document Server

    Marel, J V D

    2001-01-01

    In many gamma-ray detector systems that are built for imaging purposes Compton scattered photons are suppressed as much as possible. However, the information from photons that scattered inside a detector system can be used to reconstruct the tracks of the photons with help of gamma-ray tracking. Estimates of the incident directions of the photons can be made and an image can be created. Examples of potential applications for this technique are the use as a gamma-camera in medical imaging (e.g. SPECT) or as a detector for PET. Due to the omission of collimators, much higher detection efficiencies can be achieved, reducing the doses required for an image. A gamma-ray tracking method, called backtracking, has been developed for nuclear spectroscopy. The method tracks gamma-rays originating from a point source in the center of a spherical detector system consisting of position-sensitive germanium detectors. This method can also be used as a tracking technique for imaging of an unknown source distribution. With he...

  11. SYSTEMATIC STUDY OF GAMMA-RAY-BRIGHT BLAZARS WITH OPTICAL POLARIZATION AND GAMMA-RAY VARIABILITY

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Ryosuke; Fukazawa, Yasushi; Kanda, Yuka; Shiki, Kensei; Kawabata, Miho; Nakaoka, Tatsuya; Takaki, Katsutoshi; Takata, Koji; Ui, Takahiro [Department of Physical Science, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Nalewajko, Krzysztof; Madejski, Greg M. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Stanford University, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Uemura, Makoto; Tanaka, Yasuyuki T.; Kawabata, Koji S.; Akitaya, Hiroshi; Ohsugi, Takashi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Schinzel, Frank K. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Moritani, Yuki [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo Institutes for Advanced Study, The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Sasada, Mahito [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Yamanaka, Masayuki, E-mail: itoh@hep01.hepl.hiroshima-u.ac.jp, E-mail: itoh@hp.phys.titech.ac.jp [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); and others

    2016-12-10

    Blazars are highly variable active galactic nuclei that emit radiation at all wavelengths from radio to gamma rays. Polarized radiation from blazars is one key piece of evidence for synchrotron radiation at low energies, and it also varies dramatically. The polarization of blazars is of interest for understanding the origin, confinement, and propagation of jets. However, even though numerous measurements have been performed, the mechanisms behind jet creation, composition, and variability are still debated. We performed simultaneous gamma-ray and optical photopolarimetry observations of 45 blazars between 2008 July and 2014 December to investigate the mechanisms of variability and search for a basic relation between the several subclasses of blazars. We identify a correlation between the maximum degree of optical linear polarization and the gamma-ray luminosity or the ratio of gamma-ray to optical fluxes. Since the maximum polarization degree depends on the condition of the magnetic field (chaotic or ordered), this result implies a systematic difference in the intrinsic alignment of magnetic fields in parsec-scale relativistic jets between different types of blazars (flat-spectrum radio quasars vs. BL Lacs) and consequently between different types of radio galaxies (FR I versus FR II).

  12. Delayed Fission Gamma-ray Characteristics of Th-232 U-233 U-235 U-238 and Pu-239

    Energy Technology Data Exchange (ETDEWEB)

    Lane, Taylor [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Parma, Edward J. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2015-08-01

    Delayed fission gamma-rays play an important role in determining the time dependent ioniz- ing dose for experiments in the central irradiation cavity of the Annular Core Research Reactor (ACRR). Delayed gamma-rays are produced from both fission product decay and from acti- vation of materials in the core, such as cladding and support structures. Knowing both the delayed gamma-ray emission rate and the time-dependent gamma-ray energy spectrum is nec- essary in order to properly determine the dose contributions from delayed fission gamma-rays. This information is especially important when attempting to deconvolute the time-dependent neutron, prompt gamma-ray, and delayed gamma-ray contribution to the response of a diamond photo-conducting diode (PCD) or fission chamber in time frames of milliseconds to seconds following a reactor pulse. This work focused on investigating delayed gamma-ray character- istics produced from fission products from thermal, fast, and high energy fission of Th-232, U-233, U-235, U-238, and Pu-239. This work uses a modified version of CINDER2008, a transmutation code developed at Los Alamos National Laboratory, to model time and energy dependent photon characteristics due to fission. This modified code adds the capability to track photon-induced transmutations, photo-fission, and the subsequent radiation caused by fission products due to photo-fission. The data is compared against previous work done with SNL- modified CINDER2008 [ 1 ] and experimental data [ 2 , 3 ] and other published literature, includ- ing ENDF/B-VII.1 [ 4 ]. The ability to produce a high-fidelity (7,428 group) energy-dependent photon fluence at various times post-fission can improve the delayed photon characterization for radiation effects tests at research reactors, as well as other applications.

  13. Near stellar sources of gamma-ray bursts

    OpenAIRE

    Luchkov, B. I.; Markin, P. D.

    2012-01-01

    Correlation analysis of gamma-ray burst coordinates and nearby stars, registered on 2008-2011, revealed 5 coincidences with angular accuracy better than 0.1 degree. The random probability is $7\\times 10^{-7}$, so evidencing that coincident stars are indeed gamma-ray burst sources. The proposed method should be continued in order to provide their share in common balance of cosmic gamma-ray bursts.

  14. Fermi GBM Observations of Terrestrial Gamma-Ray Flashes

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Briggs, M. S.; Connaughton, V.; Fishman, G. J.; Bhat, P. N.; Paciesas, W. S.; Preece, R.; Kippen, R. M.; vonKienlin, A.; Dwyer, J. R.; hide

    2010-01-01

    This slide presentation explores the relationship between Terrestrial Gamma-Ray Flashes (TGF) and lightning. Using data from the World-Wide Lightning Location Network (WWLLN), and the gamma ray observations from Fermi's Gamma-ray Burst Monitor (GBM), the study reviews any causal relationship between TGFs and lightning. The conclusion of the study is that the TGF and lightning are simultaneous with out a causal relationship.

  15. Sensitivity of Gamma-Ray Detectors to Polarization

    OpenAIRE

    Yadigaroglu, I. -A.

    1996-01-01

    Previous studies have shown that the largest gamma-ray detector to date, EGRET, does not have useful polarization sensitivity. We have explored here some improved approaches to analyzing gamma-ray pair production events, leading to important gains in sensitivity to polarization. The performance of the next generation gamma-ray instrument GLAST is investigated using a detailed Monte Carlo simulation of the complete detector.

  16. Gamma-ray transients and related astrophysical phenomena

    International Nuclear Information System (INIS)

    Lingenfelter, R.E.; Hudson, H.S.; Worrall, D.M.

    1982-01-01

    The workshop covered the study of the explosive phenomena responsible for the various gamma ray transients. X-ray burster observations and theories were also reviewed with emphasis on their relationship to gamma ray bursts. Recent observational data, particularly from the SMM, HEAO, and VENERA satellites made the workshop especially timely. Major headings include: gamma-ray transients, x-ray bursts, solar transients, and instrumental concepts. Individual items from the workshop were prepared separately for the data base

  17. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1990-02-01

    Our scientific goal is to discover and study by means of gamma-ray astronomy those regions of the universe where particles are accelerated to extreme energies. The atmospheric Cherenkov technique provides a unique and potentially sensitive window in the region of 10 11 to approximately 10 14 eV for this purpose. The Whipple Observatory Collaboration is currently engaged in the development of a Cherenkov camera which has the ultimate capability of distinguishing gamma-ray showers from the numerous cosmic-ray background showers by imaging the Cherenkov light from each shower. We have recently demonstrated the potential of the imaging technique with our 18 sigma detection of TeV photons from the Crab Nebula using a camera of 10 elements, pixel spacing 0.25 degrees. This detection represents a factor of 10 improvement in sensitivity compared to a non-imaging detector. The next step in the development of the detector is to obtain a second large reflector, similar to the present 10 meter instrument, for stereoscopic viewing of showers. This project, named GRANITE, is now approved by DOE. With GRANITE it should be possible to probe more deeply in space by a factor of 7, and to fully investigate the possibility of new physics which has been suggested by reports of anomalous radiation from Hercules X-1. 18 refs

  18. Gamma rays from pulsar outer gaps

    International Nuclear Information System (INIS)

    Chiang, J.; Romani, R.W.; Cheng Ho

    1993-01-01

    We describe a gamma ray pulsar code which computes the high energy photon emissivities from vacuum gaps in the outer magnetosphere, after the model outlined by Cheng, Ho and Ruderman (1986) and Ho (1989). Pair-production due to photon-photon interactions and radiation processes including curvature, synchrotron and inverse Compton processes are computed with an iterative scheme which converges to self-consistent photon and particle distributions for a sampling of locations in the outer magnetosphere. We follow the photons from these distributions as they propagate through the pulsar magnetosphere toward a distant observer. We include the effects of relativistic aberration, time-of-flight delays and reabsorption by photon-photon pair-production to determine an intensity map of the high energy pulsar emission on the sky. Using data from radio and optical observations to constrain the geometry of the magnetosphere as well as the possible observer viewing angles, we derive light curves and phase dependent spectra which can be directly compared to data from the Compton Observatory. Observations for Crab, Vela and the recently identified gamma ray pulsars Geminga, PSR1706-44 aNd PSR 1509-58 will provide important tests of our model calculations, help us to improve our picture of the relevant physics at work in pulsar magnetospheres and allow us to comment on the implications for future pulsar discoveries

  19. Spectra of {gamma} rays feeding superdeformed bands

    Energy Technology Data Exchange (ETDEWEB)

    Lauritsen, T.; Khoo, T.L.; Henry, R.G. [and others

    1995-08-01

    The spectrum of {gamma}rays coincident with SD transitions contains the transitions which populate the SD band. This spectrum can provide information on the feeding mechanism and on the properties (moment of inertia, collectivity) of excited SD states. We used a model we developed to explain the feeding of SD bands, to calculate the spectrum of feeding {gamma}rays. The Monte Carlo simulations take into account the trigger conditions present in our Eurogam experiment. Both experimental and theoretical spectra contain a statistical component and a broad E2 peak (from transitions occurring between excited states in the SD well). There is good resemblance between the measured and calculated spectra although the calculated multiplicity of an E2 bump is low by {approximately}30%. Work is continuing to improve the quality of the fits, which will result in a better understanding of excited SD states. In addition, a model for the last steps, which cool the {gamma} cascade into the SD yrast line, needs to be developed. A strong M1/E2 low-energy component, which we believe is responsible for this cooling, was observed.

  20. Europe's space camera unmasks a cosmic gamma-ray machine

    Science.gov (United States)

    1996-11-01

    , just one step short of a black hole. A neutron star is created by the force of a supernova explosion in a large star, which crushes the star's core to an unimaginable density. A mass greater than the Sun's is squeezed into a ball no wider than a city. The gravity and magnetic fields are billions of times stronger than the Earth's. The neutron star revolves rapidly, which causes it to wink like a cosmic lighthouse as it swivels its magnetic poles towards and away from the Earth. Pulsar 1055-52 spins at five revolutions per second. At its formation in a supernova explosion, a neutron star is endowed with two main forms of energy. One is heat, at temperatures of millions of degrees, which the neutron star radiates mainly as X-rays, with only a small proportion emerging as visible light. The other power supply for the neutron star comes from its high rate of spin and a gradual slowing of the rotation. By a variety of processes involving the magnetic field and accelerated particles in the neutron star's vicinity, the spin energy of the neutron star is converted into radiation at many different wavelengths, from radio waves to gamma-rays. The exceptional gamma-ray intensity of Pulsar 1055-52 was first appreciated in observations by NASA's Compton Gamma Ray Observatory. The team in Milan recently used the Hubble Space Telescope to find the distance of the peculiar neutron star Geminga, which is not detectable by radio pulses but is a strong source of gamma-rays (see ESA Information Note 04-96, 28 March 1996). Pulsar 1055-52 is even more powerful in that respect. About 50 per cent of its radiant energy is gamma-rays, compared with 15 per cent from Geminga and 0.1 per cent from the famous Crab Pulsar, the first neutron star seen by visible light. Making the gamma-rays requires the acceleration of electrons through billions of volts. The magnetic environment of Pulsar 1055-52 fashions a natural gamma-ray machine of amazing power. The orientation of the neutron star's magnetic

  1. European team gauges a gamma-ray star

    Science.gov (United States)

    1996-03-01

    satellite COS-B had defined the position of the gamma-ray source to within half a degree -- well enough to prompt renewed efforts to identify it. Radio searches still drew a blank, but in the early 1980s Bignami and others found X-rays coming from Geminga in observations with NASA's Einstein satellite. They narrowed down Geminga's position to within a twentieth of a degree. There was no obvious counterpart to Geminga in visible light. Between 1983 and 1987 the Milanese team hunted for it with large telescopes in Hawaii and Chile. Eventually they selected a very faint object, peculiar in colour, as the visible Geminga. In 1992 a further sighting from Chile established Geminga's rate of movement across the sky. Meanwhile, the German/US/UK satellite Rosat revealed that Geminga pulsates in X-rays four times a second -- every 237 milliseconds to be precise. The same pulsation was found in gamma-rays by NASA's Gamma-Ray Observatory. Bignami and his colleagues then returned to the gamma-ray data from ESA's COS-B. They found the pulsation hidden there too and were able to compute the slowdown in Geminga's pulse-rate. From the slowdown they estimated the age of Geminga at 340,000 years. The distance measurement completes the gradual transformation of the enigmatic gamma-ray source into a well-characterized object. The Italian team calculates that Geminga is travelling at a speed of at least 120 kilometres per second. The neutron star's radiation in gamma-rays and X-rays is equivalent in energy to ten times the visible light of the Sun. More importantly, the way in which the neutron star distributes its energy output at different wavelengths is now known. "Neutron stars are radio sources for only a small fraction of their lives," says Giovanni Bignami. "So while we know 700 pulsars, there are probably millions of radio-silent neutron stars like Geminga. Thousands of them may be among X-ray sources already known but so far unidentified. I look forward to searching for new Gemingas

  2. Observation of gamma-ray bursts with GINGA

    International Nuclear Information System (INIS)

    Murakami, Toshio; Fujii, Masami; Nishimura, Jun

    1989-01-01

    Gamma-ray Burst Detector System (GBD) on board the scientific satellite 'GINGA' which was launched on Feb. 5, 1987, was realized as an international cooperation between ISAS and LANL. It has recorded more than 40 Gamma-Ray Burst candidates during 20 months observation. Although many observational evidences were accumulated in past 20 years after the discovery of gamma-ray burst by LANL scientists, there are not enough evidence to determine the origin and the production mechanism of the gamma-ray burst. GBD consists of a proportional counter and a NaI scintillation counter so that it became possible to observe energy spectrum of the gamma-ray burst with high energy resolution over wide range of energy (1.5-380 keV) together with high time resolution. As the result of observation, the following facts are obtained: (1) A large fraction of observed gamma-ray bursts has a long X-ray tail after the harder part of gamma-ray emission has terminated. (2) Clear spectral absorption features with harmonic in energy was observed in some of the energy spectrum of gamma-ray bursts. These evidences support the hypothesis that the strongly magnetized neutron star is the origin of gamma-ray burst. (author)

  3. GRAP, Gamma-Ray Level-Scheme Assignment

    International Nuclear Information System (INIS)

    Franklyn, C.B.

    2002-01-01

    1 - Description of program or function: An interactive program for allocating gamma-rays to an energy level scheme. Procedure allows for searching for new candidate levels of the form: 1) L1 + G(A) + G(B) = L2; 2) G(A) + G(B) = G(C); 3) G(A) + G(B) = C (C is a user defined number); 4) L1 + G(A) + G(B) + G(C) = L2. Procedure indicates intensity balance of feed and decay of each energy level. Provides for optimization of a level energy (and associated error). Overall procedure allows for pre-defining of certain gamma-rays as belonging to particular regions of the level scheme, for example, high energy transition levels, or due to beta- decay. 2 - Method of solution: Search for cases in which the energy difference between two energy levels is equal to a gamma-ray energy within user-defined limits. 3 - Restrictions on the complexity of the problem: Maximum number of gamma-rays: 999; Maximum gamma ray energy: 32000 units; Minimum gamma ray energy: 10 units; Maximum gamma-ray intensity: 32000 units; Minimum gamma-ray intensity: 0.001 units; Maximum number of levels: 255; Maximum level energy: 32000 units; Minimum level energy: 10 units; Maximum error on energy, intensity: 32 units; Minimum error on energy, intensity: 0.001 units; Maximum number of combinations: 6400 (ca); Maximum number of gamma-ray types : 127

  4. High-energy gamma-ray emission in compact binaries

    International Nuclear Information System (INIS)

    Cerutti, Benoit

    2010-01-01

    Four gamma-ray sources have been associated with binary systems in our Galaxy: the micro-quasar Cygnus X-3 and the gamma-ray binaries LS I +61 degrees 303, LS 5039 and PSR B1259-63. These systems are composed of a massive companion star and a compact object of unknown nature, except in PSR B1259-63 where there is a young pulsar. I propose a comprehensive theoretical model for the high-energy gamma-ray emission and variability in gamma-ray emitting binaries. In this model, the high-energy radiation is produced by inverse Compton scattering of stellar photons on ultra-relativistic electron-positron pairs injected by a young pulsar in gamma-ray binaries and in a relativistic jet in micro-quasars. Considering anisotropic inverse Compton scattering, pair production and pair cascade emission, the TeV gamma-ray emission is well explained in LS 5039. Nevertheless, this model cannot account for the gamma-ray emission in LS I +61 degrees 303 and PSR B1259-63. Other processes should dominate in these complex systems. In Cygnus X-3, the gamma-ray radiation is convincingly reproduced by Doppler-boosted Compton emission of pairs in a relativistic jet. Gamma-ray binaries and micro-quasars provide a novel environment for the study of pulsar winds and relativistic jets at very small spatial scales. (author)

  5. Gamma-ray spectroscopy on irradiated fuel rods

    International Nuclear Information System (INIS)

    Terremoto, Luis Antonio Albiac

    2009-01-01

    The recording of gamma-ray spectra along an irradiated fuel rod allows the fission products to be qualitatively and quantitatively examined. Among all nondestructive examinations performed on irradiated fuel rods by gamma-ray spectroscopy, the most comprehensive one is the average burnup measurement, which is quantitative. Moreover, burnup measurements by means of gamma-ray spectroscopy are less time-consuming and waste-generating than burnup measurements by radiochemical, destructive methods. This work presents the theoretical foundations and experimental techniques necessary to measure, using nondestructive gamma-ray spectroscopy, the average burnup of irradiated fuel rods in a laboratory equipped with hot cells. (author)

  6. X-ray echoes from gamma-ray bursts

    International Nuclear Information System (INIS)

    Dermer, C.D.; Hurley, K.C.; Hartmann, D.H.

    1991-01-01

    The identification of an echo of reflected radiation in time histories of gamma-ray burst spectra can provide important information about the existence of binary companions or accretion disks in gamma-ray burst systems. Because of the nature of Compton scattering, the spectrum of the echo will be attenuated at gamma-ray energies compared with the spectrum of the primary burst emission. The expected temporal and spectral signatures of the echo and a search for such echoes are described, and implications for gamma-ray burst models are discussed. 35 refs

  7. Fermi Large Area Telescope Bright Gamma-ray Source List

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /KIPAC, Menlo Park /SLAC; Ajello, M.; /KIPAC, Menlo Park /SLAC; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Band, D.L.; /NASA, Goddard /NASA, Goddard; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Bechtol, K.; /KIPAC, Menlo Park /SLAC; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /KIPAC, Menlo Park /SLAC; Bignami, G.F.; /Pavia U.; Bloom, Elliott D.; /KIPAC, Menlo Park /SLAC; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /KIPAC, Menlo Park /SLAC; Bregeon, J.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /IASF, Milan /IASF, Milan /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /KIPAC, Menlo Park /SLAC /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /KIPAC, Menlo Park /SLAC /ASDC, Frascati /NASA, Goddard /Maryland U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /UC, Santa Cruz /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /Montpellier U. /Bari U. /INFN, Bari /Ecole Polytechnique /NASA, Goddard; /more authors..

    2009-05-15

    Following its launch in 2008 June, the Fermi Gamma-ray Space Telescope (Fermi) began a sky survey in August. The Large Area Telescope (LAT) on Fermi in three months produced a deeper and better resolved map of the {gamma}-ray sky than any previous space mission. We present here initial results for energies above 100 MeV for the 205 most significant (statistical significance greater than {approx}10{sigma}) {gamma}-ray sources in these data. These are the best characterized and best localized point-like (i.e., spatially unresolved) {gamma}-ray sources in the early mission data.

  8. The opacity of the universe for high and very high energy {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Manuel

    2013-08-15

    The flux of high energy (HE, energy 100 MeVVHE, E>or similar 100 GeV) {gamma}-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to {gamma}-rays above a certain energy. Nevertheless, the number of detected {gamma}-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE {gamma}-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE {gamma}-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 {mu}m and 100 {mu}m. At optical wavelengths, an EBL intensity above 24 nW m{sup -2}sr{sup -1} is ruled out, and between 8 {mu}m and 31 {mu}m it is limited to be below 5 nW m{sup -2}sr{sup -1}. In the infrared, the constraints are within a factor {proportional_to} 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes {tau

  9. Method and apparatus for neutron induced gamma ray logging for lithology identificaion

    International Nuclear Information System (INIS)

    Oliver, D.W.; Culver, R.B.

    1979-01-01

    A pulsed neutron generator in a well logging instrument is pulsed at a clock frequency of 20 KHz. Inelastic scatter gamma rays are detected during a first time interval coinciding with the neutron source being on and capture gamma rays are measured during a second interval subsequent to the end of each neutron burst. Only a single detected pulse, assuming detection occurs, is transmitted during each of the two detection intervals. Sync pulses are generated in the well logging instrument scaled down to a frequency of 200 Hz for transmission to the earth's surface. At the earth's surface, the scaled-down sync pulses are applied to a phase-locked loop system for regenerating the sync pulses to the same frequency as that of the clock frequency used to pulse the neutron source and to open the detection gates in the borehole instrument. The regenerated sync pulses are used in the surface instrumentation to route the pulses occurring in the inelastic interval into one section of a multichannel analyzer memory and the pulses occurring in the capture interval into another section of the multichannel analyzer. The use of memory address decoders, subtractors and ratio circuits enables both a carbon/oxygen ratio and a silicon/calcium ratio to be struck, substantially independent of the chlorine content of the borehole and formation

  10. Analyzing power of AGATA triple clusters for gamma-ray linear polarization

    Energy Technology Data Exchange (ETDEWEB)

    Bizzeti, P.G.; Sona, P.; Melon, B.; Bizzeti-Sona, A.M.; Perego, A. [Universita di Firenze, Dipartimento di Fisica, Firenze (Italy); INFN, Firenze (Italy); Michelagnoli, C.; Lunardi, S.; Mengoni, D.; Recchia, F. [INFN, Padova (Italy); Universita di Padova, Dipartimento di Fisica, Padova (Italy); Bazzacco, D.; Farnea, E.; Menegazzo, R.; Ur, C.A. [INFN, Padova (Italy); De Angelis, G.; Gottardo, A.; Napoli, D.R.; Sahin, E.; Valiente-Dobon, J.J. [Laboratori Nazionali di Legnaro, INFN, Padova (Italy); Gadea, A. [University of Valencia, IFIC, CSIC, Valencia (Spain); Nannini, A. [INFN, Firenze (Italy)

    2015-04-01

    We have investigated the ability of AGATA triple clusters to measure the linear polarization of gamma rays, exploiting the azimuthal-angle dependence of the Compton scattering differential cross section. To this aim, partially polarized gamma rays have been produced by Coulomb excitation of the first excited state of {sup 104}Pd and {sup 108}Pd, which decay to the ground state by emission of gamma rays of 555.8 keV and 433.9 keV, respectively. Pulse-shape analysis and gamma-ray tracking techniques have been used to determine the position and time sequence of the interaction points inside the germanium crystals. Anisotropies in the detection efficiency have been taken into account using 661.6 keV gammas from a {sup 137}Cs radioactive source. We obtain an average analyzing power of 0.451(34) at 433.9 keV and 0.484(24) at 555.8 keV. (orig.)

  11. Fermi Detection of a Luminous gamma-ray Pulsar in a Globular Cluster

    Science.gov (United States)

    Freire, P. C. C.; Abdo, A. A.; Ajello, M.; Allafort, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bechtol, K.; Bellazzini, R.; Blandford, R. D.; hide

    2011-01-01

    We report the Fermi Large Area Telescope detection of gamma -ray (>100 mega-electron volts) pulsations from pulsar J1823--3021A in the globular cluster NGC 6624 with high significance (approx 7 sigma). Its gamma-ray luminosity L (sub 3) = (8:4 +/- 1:6) X 10(exp 34) ergs per second, is the highest observed for any millisecond pulsar (MSP) to date, and it accounts for most of the cluster emission. The non-detection of the cluster in the off-pulse phase implies that its contains < 32 gamma-ray MSPs, not approx 100 as previously estimated. The gamma -ray luminosity indicates that the unusually large rate of change of its period is caused by its intrinsic spin-down. This implies that J1823--3021A has the largest magnetic field and is the youngest MSP ever detected, and that such anomalous objects might be forming at rates comparable to those of the more normal MSPs.

  12. Very high energy gamma ray astrophysics: Progress report, May 1, 1987-February 1, 1988

    International Nuclear Information System (INIS)

    Lamb, R.G.; Lewis, D.A.

    1988-02-01

    The Whipple observatory Gamma Ray Collaboration has continued to make steady progress in its development of a highly sensitive stereoscopic imaging gamma-ray telescope (known as the HERCULES project). The milestones in this year's development include: the demonstration of the success of the imaging concept with a single camera by the detection of a very weak flux of gamma rays from the Crab Nebula at a high level of statistical significance (7 sigma), the confirmation of our detection of an anomalous pulsed flux from Hercules X-1 in the summer of 1986 by two other groups; this result has serious implications for the mechanism for gamma-ray emission in this binary source. The construction and installation of the new high resolution camera on the 10 m reflector; the realistic simulation of the sensitivity of this camera as well as that of the full HERCULES system was also undertaken. These, and other highlights of this year's program at the Iowa State University and the Smithsonian Astrophysical Observatory, are discussed in this paper. 6 figs

  13. Response function of NaI(Tl) detectors and multiple backscattering of gamma rays in aluminium

    International Nuclear Information System (INIS)

    Sabharwal, Arvind D.; Singh, Manpreet; Singh, Bhajan; Sandhu, B.S.

    2008-01-01

    The response function, converting the observed pulse-height distribution of a NaI(Tl) detector to a true photon spectrum, is obtained experimentally with the help of an inverse matrix approach. The energy of gamma-ray photons continuously decreases as the number of scatterings increases in a sample having finite dimensions when one deals with the depth of the sample. The present experiments are undertaken to study the effect of target thickness on intensity distribution of gamma photons multiply backscattered from an aluminium target. A NaI(Tl) gamma-ray detector detects the photons backscattered from the aluminium target. The subtraction of analytically estimated singly scattered distribution from the observed intensity distribution (originating from interactions of primary gamma-ray photons with the target) results in multiply backscattered events. We observe that for each incident gamma photon energy, the number of multiply backscattered photons increases with increase in target thickness and then saturates at a particular target thickness called the saturation thickness (depth). Saturation thickness for multiply backscattering of gamma photons is found to decrease with increase in energy of incident gamma-ray photons

  14. Attenuation of neutrons and gamma-rays in homogeneous and multilayered shields

    International Nuclear Information System (INIS)

    Abdo, A.E.; Megahid, R.M.

    1997-01-01

    Measurements were carried-out to compare the attenuation properties of homogeneous shields and shields of two layers and three layers for fast neutrons and total gamma-rays. These were performed by measuring the fast neutron and total gamma-ray spectra behind homogeneous shields of magnetite-limonite, ilmenite-ilmenite and magnetite-magnetite concretes. The two layers assembly consists of iron and one of the above mentioned concretes, while the three layers shield consists of water, iron and one of the previously mentioned concretes. All measurements were carried-out using a neutron-gamma spectrometer with stilbene scintillator coupled to a fast photo multi player tube. Separation between pulses of recoil protons and recoil electrons was achieved by a pulse shape discrimination technique. 3 tabs., 10 figs., 13 refs

  15. Calculation of neutron and gamma ray energy spectra for fusion reactor shield design: comparison with experiment

    International Nuclear Information System (INIS)

    Santoro, R.T.; Alsmiller, R.G. Jr.; Barnes, J.M.; Chapman, G.T.

    1980-08-01

    Integral experiments that measure the transport of approx. 14 MeV D-T neutrons through laminated slabs of proposed fusion reactor shield materials have been carried out. Measured and calculated neutron and gamma ray energy spectra are compared as a function of the thickness and composition of stainless steel type 304, borated polyethylene, and Hevimet (a tungsten alloy), and as a function of detector position behind these materials. The measured data were obtained using a NE-213 liquid scintillator using pulse-shape discrimination methods to resolve neutron and gamma ray pulse height data and spectral unfolding methods to convert these data to energy spectra. The calculated data were obtained using two-dimensional discrete ordinates radiation transport methods in a complex calculational network that takes into account the energy-angle dependence of the D-T neutrons and the nonphysical anomalies of the S/sub n/ method

  16. Observation of solar gamma-ray by Hinotori

    International Nuclear Information System (INIS)

    Yoshimori, Masato; Okudaira, Kiyoaki; Hirashima, Yo; Kondo, Ichiro.

    1982-01-01

    The solar gamma-ray emitted by solar flare was observed. The gamma-ray is the electromagnetic radiation with the energy more than 300 keV. The line gamma-ray intensity and the time profile were observed. The gamma-ray detector CsI (Tl) was loaded on Hinotori, and the observed gamma-ray was analyzed by a multi-channel analyzer. The observed line gamma-ray was the radiation from Fe-56 and Ne-20. The line gamma-ray from C-12 and O-16 was also seen. These gamma-ray is the direct evidence of the nuclear reaction on the sun. The observed spectrum suggested the existence of the lines from Mg-24 and Si-28. The intensity of the 2.22 MeV gamma-line was small. This fact showed that the origin of this line was different from other nuclear gamma-ray. Two kinds of hard X-ray bursts were detected. The one was impulsive burst, and the other was gradual burst. There was no time difference between the hard X-ray and the gamma-ray of the impulsive burst. The impulsive burst may be explained by the beam model. The delay of time profile in the high energy gamma-ray of the gradual burst was observed. This means that the time when accelerated electrons cause bremsstrahlung depends on the electron energy. The long trapping of electrons at the top of magnetic loop is suggested. (Kato, T.)

  17. GROSS- GAMMA RAY OBSERVATORY ATTITUDE DYNAMICS SIMULATOR

    Science.gov (United States)

    Garrick, J.

    1994-01-01

    The Gamma Ray Observatory (GRO) spacecraft will constitute a major advance in gamma ray astronomy by offering the first opportunity for comprehensive observations in the range of 0.1 to 30,000 megaelectronvolts (MeV). The Gamma Ray Observatory Attitude Dynamics Simulator, GROSS, is designed to simulate this mission. The GRO Dynamics Simulator consists of three separate programs: the Standalone Profile Program; the Simulator Program, which contains the Simulation Control Input/Output (SCIO) Subsystem, the Truth Model (TM) Subsystem, and the Onboard Computer (OBC) Subsystem; and the Postprocessor Program. The Standalone Profile Program models the environment of the spacecraft and generates a profile data set for use by the simulator. This data set contains items such as individual external torques; GRO spacecraft, Tracking and Data Relay Satellite (TDRS), and solar and lunar ephemerides; and star data. The Standalone Profile Program is run before a simulation. The SCIO subsystem is the executive driver for the simulator. It accepts user input, initializes parameters, controls simulation, and generates output data files and simulation status display. The TM subsystem models the spacecraft dynamics, sensors, and actuators. It accepts ephemerides, star data, and environmental torques from the Standalone Profile Program. With these and actuator commands from the OBC subsystem, the TM subsystem propagates the current state of the spacecraft and generates sensor data for use by the OBC and SCIO subsystems. The OBC subsystem uses sensor data from the TM subsystem, a Kalman filter (for attitude determination), and control laws to compute actuator commands to the TM subsystem. The OBC subsystem also provides output data to the SCIO subsystem for output to the analysts. The Postprocessor Program is run after simulation is completed. It generates printer and CRT plots and tabular reports of the simulated data at the direction of the user. GROSS is written in FORTRAN 77 and

  18. Designing a new type of neutron detector for neutron and gamma-ray discrimination via GEANT4

    International Nuclear Information System (INIS)

    Shan, Qing; Chu, Shengnan; Ling, Yongsheng; Cai, Pingkun; Jia, Wenbao

    2016-01-01

    Design of a new type of neutron detector, consisting of a fast neutron converter, plastic scintillator, and Cherenkov detector, to discriminate 14-MeV fast neutrons and gamma rays in a pulsed n–γ mixed field and monitor their neutron fluxes is reported in this study. Both neutrons and gamma rays can produce fluorescence in the scintillator when they are incident on the detector. However, only the secondary charged particles of the gamma rays can produce Cherenkov light in the Cherenkov detector. The neutron and gamma-ray fluxes can be calculated by measuring the fluorescence and Cherenkov light. The GEANT4 Monte Carlo simulation toolkit is used to simulate the whole process occurring in the detector, whose optimum parameters are known. Analysis of the simulation results leads to a calculation method of neutron flux. This method is verified by calculating the neutron fluxes using pulsed n–γ mixed fields with different n/γ ratios, and the results show that the relative errors of all calculations are <5%. - Highlights: • A neutron detector is developed to discriminate 14-MeV fast neutrons and gamma rays. • The GEANT4 is used to optimize the parameters of the detector. • A calculation method of neutron flux is established through the simulation. • Several n/γ mixture fields are simulated to validate of the calculation method.

  19. Operating experience with gamma ray irradiators

    International Nuclear Information System (INIS)

    Fraser, F.M.; Ouwerkerk, T.

    1980-01-01

    The experience of Atomic Energy of Canada, Limited (AECL) with radioisotopes dates back to the mid-1940s when radium was marketed for medical purposes. Cobalt-60 came on the scene in 1949 and within a few years a thriving business in cancer teletherapy machines and research irradiators was developed. AECL's first full-scale cobalt-60 gamma ray sterilizer for medical products was installed in 1964. AECL now has over 50 plants and 30 million curies in service around the world. Sixteen years of design experience in cobalt-60 sources, radiation shielding, safety interlock systems, and source pass mechanisms have made gamma irradiators safe, reliable, and easy to operate. This proven technology is being applied in promising new fields such as sludge treatment and food preservation. Cesium-137 is expected to be extensively utilized as the gamma radiation source for these applications

  20. Gravitational wave: gamma-ray burst connections.

    Science.gov (United States)

    Hough, Jim

    2007-05-15

    After 35 years of experimental research, we are rapidly approaching the point at which gravitational waves (GWs) from astrophysical sources may be directly detected by the long-baseline detectors LIGO (USA), GEO 600 (Germany/UK), VIRGO (Italy/France) and TAMA 300 (Japan), which are now in or coming into operation.A promising source of GWs is the coalescence of compact binary systems, events which are now believed to be the origin of short gamma-ray bursts (GRBs). In this paper, a brief review of the state of the art in detector development and exploitation will be given, with particular relevance to a search for signals associated with GRBs, and plans for the future will be discussed.

  1. Gamma-ray burst theory after Swift.

    Science.gov (United States)

    Piran, Tsvi; Fan, Yi-Zhong

    2007-05-15

    Afterglow observations in the pre-Swift era confirmed to a large extend the relativistic blast wave model for gamma-ray bursts (GRBs). Together with the observations of properties of host galaxies and the association with (type Ic) SNe, this has led to the generally accepted collapsar origin of long GRBs. However, most of the afterglow data was collected hours after the burst. The X-ray telescope and the UV/optical telescope onboard Swift are able to slew to the direction of a burst in real time and record the early broadband afterglow light curves. These observations, and in particular the X-ray observations, resulted in many surprises. While we have anticipated a smooth transition from the prompt emission to the afterglow, many observed that early light curves are drastically different. We review here how these observations are changing our understanding of GRBs.

  2. New possibilities in prompt gamma ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Borderie, B; Barrandon, J N [Centre National de la Recherche Scientifique, 45 - Orleans-la-Source (France). Lab. du cyclotron; Pinault, J L [Bureau de Recherches Geologiques et Minieres (BRGM), 45 - Orleans (France)

    1977-01-01

    Prompt gamma ray spectrometry has been used as an analytical tool for many years. The high level of background noise does, however, remain a major problem with this technique. From simple theoretical consideration, conditions (particle, energy) were determined to reduce significantly the background noise under irradiation. Alpha particles of 3.5 MeV were chosen. Some fifty elements were studied, of which 24 gave interesting results. The detection limits obtained for a sample of niobium were as follows: approximately 1 ppm (10/sup -6/g/g) for the light elements Li, B, F and Na, and between 50 ppm and 1% for the others. Numerous applications may be envisaged in the geo- and cosmo-sciences.

  3. Dosimetry for terrestrial gamma-ray sources

    International Nuclear Information System (INIS)

    Abdullah, S.A.; Dickson, H.W.; Kerr, G.D.; Miah, M.F.K.; Perdue, P.T.

    1975-01-01

    Dose rates from natural radionuclides and 137 Cs in soils of the Oak Ridge area have been determined from in situ and core sample measurements. Information on soil composition, density, and moisture content and on the distribution of cesium in the soil was obtained from the core samples. Measurements of radionuclide concentrations in the samples were made with a 4 x 4 in. NaI detector. Gamma-ray spectroscopy using a lithium-drifted germanium (GeLi) detector has been applied to the determination of radionuclide concentrations in soil and the associated gamma dose rates above the earth plane. An unshielded GeLi detector placed about 1 m above the earth detects gamma radiation from an area of about 100 m 2 . The equipment and data processing procedure are briefly described

  4. New lithology compensated capture gamma ray system

    International Nuclear Information System (INIS)

    Peatross, R.F.

    1976-01-01

    The results of the HYDROCARBON* log after a series of field tests in which gamma rays resulting from thermal neutron capture were measured utilizing an energy analyzer and a scintillation counter of unique construction are reported. A brief discussion covers the nuclear physics required for an understanding of gamma spectral logging. Included in the explanation will be the effects of different atoms on neutrons and photons. The HYDROCARBON log utilizes these nuclear principles to record cased hole measurements and quantitatively distinguish possible productive zones from non-productive zones. Different field examples are illustrated showing the response to shaly sands, porosity and water salinity. Interpretation techniques are discussed both qualitatively and quantitatively. The HYDROCARBON log has proven to be a reliable device in the determination of water saturation in sands behind casing even when shale content and porosity are not well known. This technique is also valuable in the location of the present position of gas--oil contacts and water levels

  5. A review of gamma ray bursts

    CERN Document Server

    Rees, Martin J

    2000-01-01

    Gamma-ray bursts, an enigma for more than 25 years, are now coming into focus. They involve extraordinary power outputs, and highly relativistic dynamics. The 'trigger' involves stellar-mass compact objects. The most plausible progenitors, ranging from neutron star binary mergers to collapsars (sometimes called 'hypernovae') eventually lead to the formation of a black hole with a torus of hot neutron-density material around it, the extractable energy being up to 10 sup 5 sup 4 ergs. Magnetic fields may exceed 10 sup 1 sup 5 G and particles may be accelerated up to > or approx. 10 sup 2 sup 0 eV. Details of the afterglow may be easier to understand than the initial trigger. Bursts at very high redshift can be astronomically-important as probes of the distant universe.

  6. Gamma-ray induced doppler broadening

    International Nuclear Information System (INIS)

    Robinson, S.J.

    1992-01-01

    The ultra high resolving power of the GAMS4 double-flat crystal spectrometer (M.S. Dewey et al Nucl. Instrum. Methods A 284 (1989) 151.) has been used to observe the Doppler broadening of gamma-rays emitted by nuclei recoiling at speeds as low as 10 -6 c. Such recoils may be induced by the previous emission of gamma-radiation following thermal neutron capture. If the population mechanism of an excited state is known (or can be approximated) and the slowing down mechanism can be modeled, then this technique can be used to extract the lifetime of excited nuclear states. The combination of this technique and the neutron capture reaction allows the study of states which cannot necessarily be accessed by other means. This has allowed the resolution of a number of long standing questions in low-spin nuclear structure. The basis of the technique is discussed and a number of examples given

  7. Gamma-Ray Bursts: A Radio Perspective

    Directory of Open Access Journals (Sweden)

    Poonam Chandra

    2016-01-01

    Full Text Available Gamma-ray bursts (GRBs are extremely energetic events at cosmological distances. They provide unique laboratory to investigate fundamental physical processes under extreme conditions. Due to extreme luminosities, GRBs are detectable at very high redshifts and potential tracers of cosmic star formation rate at early epoch. While the launch of Swift and Fermi has increased our understanding of GRBs tremendously, many new questions have opened up. Radio observations of GRBs uniquely probe the energetics and environments of the explosion. However, currently only 30% of the bursts are detected in radio bands. Radio observations with upcoming sensitive telescopes will potentially increase the sample size significantly and allow one to follow the individual bursts for a much longer duration and be able to answer some of the important issues related to true calorimetry, reverse shock emission, and environments around the massive stars exploding as GRBs in the early Universe.

  8. Gamma-Rays from Galactic Compact Sources

    Science.gov (United States)

    Kaaret, Philip

    2007-04-01

    Recent discoveries have revealed many sources of TeV photons in our Mikly Way galaxy powered by compact objects, either neutron stars or black holes. These objects must be powerful particle accelerators, some with peak energies of at least 100 TeV, and may be neutrino, as well as photon, sources. Future TeV observations will enable us to address key questions concerning particle acceleration by compact objects including the fraction of energy which accreting black holes channel into relativstic jet production, whether the compact object jets are leptonic or hadronic, and the mechanism by which pulsar winds accelerate relativistic particles. We report on work done related to compact Galactic objects in preparation of a White Paper on the status and future of ground-based gamma-ray astronomy requested by the Division of Astrophysics of the American Physical Society.

  9. Gamma-Ray Burst Prompt Correlations

    Directory of Open Access Journals (Sweden)

    M. G. Dainotti

    2018-01-01

    Full Text Available The mechanism responsible for the prompt emission of gamma-ray bursts (GRBs is still a debated issue. The prompt phase-related GRB correlations can allow discriminating among the most plausible theoretical models explaining this emission. We present an overview of the observational two-parameter correlations, their physical interpretations, and their use as redshift estimators and possibly as cosmological tools. The nowadays challenge is to make GRBs, the farthest stellar-scaled objects observed (up to redshift z=9.4, standard candles through well established and robust correlations. However, GRBs spanning several orders of magnitude in their energetics are far from being standard candles. We describe the advances in the prompt correlation research in the past decades, with particular focus paid to the discoveries in the last 20 years.

  10. Nuclear gamma ray lines from supernovae

    International Nuclear Information System (INIS)

    Jardim, J.O.D.

    1980-01-01

    From theoretical considerations of the behaviour of gamma ray line fluxes occurring after a supernova explosion, the 1.156 and 0.847 MeV lines are seen to be the most likely to be observed. The 1.156 MeV line has been previously observed by other investigators. Observations of the 0.847 MeV line, and 1.332, 1.173 and 0.059 MeV lines using a Ge(Li) telescope aboard a stratospheric balloon which was flown in Brazil in 1977 are reported. The observation using a NaI(Tl) detector of a line in the energy interval 1.5 - 1.6 MeV, which may be due to 0 18 (p,p') 0 18 sup (*) reaction is also reported. (Author) [pt

  11. Theoretical Study of Gamma-ray Pulsars

    Directory of Open Access Journals (Sweden)

    Kwong Sang Cheng

    2016-06-01

    Full Text Available We use the non-stationary three dimensional two-layer outer gap model to explain gamma-ray emissions from a pulsar magnetosphere. We found out that for some pulsars like the Geminga pulsar, it was hard to explain emissions above a level of around 1 GeV. We then developed the model into a non-stationary model. In this model we assigned a power-law distribution to one or more of the spectral parameters proposed in the previous model and calculated the weighted phaseaveraged spectrum. Though this model is suitable for some pulsars, it still cannot explain the high energy emission of the Geminga pulsar. An Inverse-Compton Scattering component between the primary particles and the radio photons in the outer magnetosphere was introduced into the model, and this component produced a sufficient number of GeV photons in the spectrum of the Geminga pulsar.

  12. Gamma ray induced somatic mutations in rose

    International Nuclear Information System (INIS)

    Datta, S.K.

    1989-01-01

    Budwood of 32 rose cultivars (Rosa spp.) was exposed to 3-4 krad of gamma rays and eyes were grafted on Rosa indica var. odorata root stock. Radiosensitivity with respect to sprouting, survival and plant height, and mutation frequency varied with the cultivar and dose of gamma rays. Somatic mutations in flower colour/shape were detected as chimera in 21 cultivars. The size of the mutant sector varied from a narrow streak on a petal to a whole flower and from a portion of a branch to an entire branch. 14 mutants were detected in M 1 V 1 , four in M 1 V 2 and three in M 1 V 3 . Maximum number of mutations was detected following 3 krad treatment. Eyes from mutant branches were grafted again on root stock and non-chimeric mutants were aimed at by vegetative propagation. Mutants from 11 cultivars only could be isolated in pure form. Isolation of non-chimeric mutants sometimes is difficult due to weak growth of a mutant branch. In such a case, all normal looking branches are removed to force a better growth of the mutant branch. It is advisable to maintain irradiated plants at least for four years with drastic pruning in each year. Nine mutants viz. 'Sharada', 'Sukumari', 'Tangerine Contempo', 'Yellow Contempo', 'Pink Contempo', 'Striped Contempo', 'Twinkle', 'Curio' and 'Light Pink Prize' have already been released as new cultivars for commercialization [ref. MBNL No. 23 and 31] and others are being multiplied and assessed. The mutation spectrum appears to be wider for the cultivars 'Contempo' and 'Imperator'. Pigment composition of the original variety is relevant for the kind of flower colour mutations that can be induced

  13. High dose gamma-ray standard

    International Nuclear Information System (INIS)

    Macrin, R.; Moraru, R.

    1999-01-01

    The high gamma-ray doses produced in a gamma irradiator are used, mainly, for radiation processing, i.e. sterilization of medical products, processing of food, modifications of polymers, irradiation of electronic devices, a.s.o. The used absorbed doses depend on the application and cover the range 10 Gy to 100 MGy. The regulations in our country require that the response of the dosimetry systems, used for the irradiation of food and medical products, be calibrated and traceable to the national standards. In order to be sure that the products receive the desired absorbed dose, appropriate dosimetric measurements must be performed, including the calibration of the dosemeters and their traceability to the national standards. The high dose gamma-ray measurements are predominantly based on the use of reference radiochemical dosemeters. Among them the ferrous sulfate can be used as reference dosemeter for low doses (up to 400 Gy) but due to its characteristics it deserves to be considered a standard dosemeter and to be used for transferring the conventional absorbed dose to other chemical dosemeters used for absorbed doses up to 100 MGy. The study of the ferrous sulfate dosemeter consisted in preparing many batches of solution by different operators in quality assurance conditions and in determining for all batches the linearity, the relative intrinsic error, the repeatability and the reproducibility. The principal results are the following: the linear regression coefficient: 0.999, the relative intrinsic error: max.6 %, the repeatability (for P* = 95 %): max.3 %, the reproducibility (P* = 95%): max.5 %. (authors)

  14. Activation of wine bentonite with gamma rays

    International Nuclear Information System (INIS)

    Goranov, N.; Antonov, M.

    1997-01-01

    The action of gamma rays on wine bentonite as well as influence of its adsorption and technologic qualities on the composition and stability of wines against protein darkening and precipitation has been studied. The experiments were carried out with wine bentonite produced in the firm Bentonite and irradiated with doses of 0.4, 0.6, 0.8 and 1.0 MR. White and red wines have been treated with irradiated bentonite under laboratory conditions at 1.0 g/dm 3 . All samples are treated at the same conditions. The flocculation rate of the sediment was determined visually. Samples have been taken 24 h later from the cleared wine layers. The following parameters have been determined: clarification, filtration rate, phenolic compounds, calcium, colour intensity, total extracted substances, etc. The volume of the sediment has been determined also. The control samples have been taken from the same unirradiated wines. The results showed better and faster clarification in on the third, the 20th and the 24th hours with using of gamma-irradiated at doses 0.8 and 1.0 MR. The sediment was the most compact and its volume - the smallest compared to the samples treated with bentonite irradiated with doses of 0.6 and 0.4 MR. This ensures a faster clarification and better filtration of treated wines. The bentonite activated with doses of 0.8 and 1.0 MR adsorbs the phenolic compounds and the complex protein-phenolic molecules better. In the same time it adsorbs less extracted substances compared to untreated bentonite and so preserves all organoleptic properties of wine. The irradiated bentonite adsorbs less the monomers of anthocyan compounds which ensures brighter natural colour of wine. The gamma-rays activation consolidates calcium in the crystal lattice of bentonite particles and in this way eliminates the formation of crystal precipitates

  15. A new processing technique for airborne gamma-ray data

    DEFF Research Database (Denmark)

    Hovgaard, Jens

    1997-01-01

    The mathematical-statistical background for at new technique for processing gamma-ray spectra is presented. The technique - Noise Adjusted Singular Value Decomposition - decomposes at set of gamma-ray spectra into a few basic spectra - the spectral components. The spectral components can be proce...

  16. Effectiveness of gamma ray irradiation and ethyl methane ...

    African Journals Online (AJOL)

    Survival rate and plantlet performance of DNKW001 in gamma ray + EMS 7uM treatment declined profoundly with increasing doses and LD50 was lower (104 Gy) than LD50 in gamma ray irradiation (177 Gy) alone. Variants of plantlets were detected in pre (white streaked leaf and bigger petiole with distorted leaf) and post ...

  17. Wolf-Rayet stars as gamma-ray burst progenitors

    NARCIS (Netherlands)

    Langer, N.; van Marle, A. -J; Yoon, S.C.

    2010-01-01

    It became clear in the last few years that long gamma-ray bursts are associated with the endpoints of massive star evolution. They occur in star forming regions at cosmological distances (Jakobsson et al., 2005), and are associated with supernova-type energies. The collapsar model explains gamma-ray

  18. The First Fermi-LAT Gamma-Ray Burst Catalog

    NARCIS (Netherlands)

    Ackermann, M.; et al., [Unknown; van der Horst, A.J.

    2013-01-01

    In three years of observations since the beginning of nominal science operations in 2008 August, the Large Area Telescope (LAT) on board the Fermi Gamma-Ray Space Telescope has observed high-energy (gsim 20 MeV) γ-ray emission from 35 gamma-ray bursts (GRBs). Among these, 28 GRBs have been detected

  19. Gamma ray bursts observed with WATCH‐EURECA

    DEFF Research Database (Denmark)

    Brandt, Søren; Lund, Niels; Castro-Tirado, A. J.

    1994-01-01

    The WATCH wide field x‐ray monitor has the capability of independently locating bright Gamma Ray Bursts to 1° accuracy. We report the preliminary positions of 12 Gamma Ray Bursts observed with the WATCH monitor flown on the ES spacecraft EURECA during its 11 month mission. Also the recurrence...

  20. The many phases of gamma-ray burst afterglows

    NARCIS (Netherlands)

    Leventis, K.

    2013-01-01

    Gamma-ray bursts are the brightest sources in the universe. Their afterglows have been observed for about 15 years now, and their study has greatly advanced our understanding of these, mysterious until recently, events. In a way, gamma-ray bursts can be seen as huge cosmic bombs which convert

  1. Gamma ray bursts: Current status of observations and theory

    International Nuclear Information System (INIS)

    Meegan, C.A.

    1990-04-01

    Gamma ray bursts display a wide range of temporal and spectral characteristics, but typically last several seconds and emit most of their energy in a low energy, gamma ray region. The burst sources appear to be isotropically distributed on the sky. Several lines of evidence suggest magnetic neutron stars as sources for bursts. A variety of energy sources and emission mechanisms are proposed

  2. Supernova sheds light on gamma-ray bursts

    CERN Multimedia

    2003-01-01

    On 29 March the HETE-II satellite detected the most violent explosion in the universe to date - an enormous burst of gamma rays. Observers across the world recorded and studied the event. It appears to prove that gamma ray bursts originate in supernovae (1 page)

  3. X and gamma ray backgroud observations in Antarctic

    International Nuclear Information System (INIS)

    Jayanthi, U.B.

    1988-01-01

    Atmospheric X amd gamma rays are products of complex electromagnetic interation between charged particles and atmospheric constituents. The latitudinal dependence of the cosmic rays secondaries, auroral and South Atlantic Anomaly phenomena produce flux variations, especially the later temporal flux variations. We propose to discuss these variations in relevance to balloon flight observations of X and gamma ray atmospheric background at polar latitudes. (author) [pt

  4. Jet simulations and gamma-ray burst afterglow jet breaks

    NARCIS (Netherlands)

    van Eerten, H.J.; Meliani, Z.; Wijers, R.A.M.J.; Keppens, R.

    2011-01-01

    The conventional derivation of the gamma-ray burst afterglow jet break time uses only the blast wave fluid Lorentz factor and therefore leads to an achromatic break. We show that in general gamma-ray burst afterglow jet breaks are chromatic across the self-absorption break. Depending on

  5. Jet simulations and gamma-ray burst afterglow jet breaks

    NARCIS (Netherlands)

    van Eerten, H. J.; Meliani, Z.; Wijers, R.A.M.J.; Keppens, R.

    2010-01-01

    The conventional derivation of the gamma-ray burst afterglow jet break time uses only the blast wave fluid Lorentz factor and therefore leads to an achromatic break. We show that in general gamma-ray burst afterglow jet breaks are chromatic across the self-absorption break. Depending on

  6. Observational techniques of gamma rays astronomy in low energy

    International Nuclear Information System (INIS)

    Costa, J.M. da.

    1982-02-01

    Due to the absorption of great part of the gamma-ray spectrum of cosmic origin, by the earth's atmosphere at heights above 20Km, gamma-ray astronomy achieved its full development only after the advent of the space age. Ballons and satellites are the space vehicles which have been used to transport gamma-ray telescopes to observational heights in the atmosphere, or out of it. The results of these experiments can determine the sources, the energy spectra and the intensities of the cosmic gamma-rays, and provide other important information of astrophysical interest. The detection of gamma-rays of cosmic origin is very difficult. The observational techniques used in gamma-ray astronomy are dependent on the energy range of the gamma-rays which one desires to detect. The most common telescopes of low energy gamma-ray astronomy (50KeV - 20MeV) use NaI(Tl) scintillators, or germanium diodes, as principal detectors, surrounded by an active shield (anticoincidence) of organic or inorganic scintillators. (Author) [pt

  7. Gamma Ray Tomographic Scan Method for Large Scale Industrial Plants

    International Nuclear Information System (INIS)

    Moon, Jin Ho; Jung, Sung Hee; Kim, Jong Bum; Park, Jang Geun

    2011-01-01

    The gamma ray tomography systems have been used to investigate a chemical process for last decade. There have been many cases of gamma ray tomography for laboratory scale work but not many cases for industrial scale work. Non-tomographic equipment with gamma-ray sources is often used in process diagnosis. Gamma radiography, gamma column scanning and the radioisotope tracer technique are examples of gamma ray application in industries. In spite of many outdoor non-gamma ray tomographic equipment, the most of gamma ray tomographic systems still remained as indoor equipment. But, as the gamma tomography has developed, the demand on gamma tomography for real scale plants also increased. To develop the industrial scale system, we introduced the gamma-ray tomographic system with fixed detectors and rotating source. The general system configuration is similar to 4 th generation geometry. But the main effort has been made to actualize the instant installation of the system for real scale industrial plant. This work would be a first attempt to apply the 4th generation industrial gamma tomographic scanning by experimental method. The individual 0.5-inch NaI detector was used for gamma ray detection by configuring circular shape around industrial plant. This tomographic scan method can reduce mechanical complexity and require a much smaller space than a conventional CT. Those properties make it easy to get measurement data for a real scale plant

  8. Bulk density calculations from prompt gamma ray yield

    International Nuclear Information System (INIS)

    Naqvi, A.A.; Nagadi, M.M.; Al-Amoudi, O.S.B.; Maslehuddin, M.

    2006-01-01

    Full text: The gamma ray yield from a Prompt Gamma ray Neutron Activation Analysis (PGNAA) setup is a linear function of element concentration and neutron flux in a the sample with constant bulk density. If the sample bulk density varies as well, then the element concentration and the neutron flux has a nonlinear correlation with the gamma ray yield [1]. The measurement of gamma ray yield non-linearity from samples and a standard can be used to estimate the bulk density of the samples. In this study the prompt gamma ray yield from Blast Furnace Slag, Fly Ash, Silica Fumes and Superpozz cements samples have been measured as a function of their calcium and silicon concentration using KFUPM accelerator-based PGNAA setup [2]. Due to different bulk densities of the blended cement samples, the measured gamma ray yields have nonlinear correlation with calcium and silicon concentration of the samples. The non-linearity in the yield was observed to increase with gamma rays energy and element concentration. The bulk densities of the cement samples were calculated from ratio of gamma ray yield from blended cement and that from a Portland cement standard. The calculated bulk densities have good agreement with the published data. The result of this study will be presented

  9. Discoveries by the Fermi Gamma Ray Space Telescope

    Science.gov (United States)

    Gehrels, Neil

    2011-01-01

    Fermi is a large space gamma-ray mission developed by NASA and the DOE with major contributions from France, Germany, Italy, Japan and Sweden. It was launched in June 2008 and has been performing flawlessly since then. The main instrument is the Large Area Telescope (LAT) operating in the 20 MeV to 300 GeV range and a smaller monitor instrument is the Gamma-ray Burst Monitor (GBM) operating in the 8 keV to 40 MeV range. New findings are occurring every week. Some of the key discoveries are: 1) Discovery of many new gamma-ray pulsars, including gamma-ray only and millisecond pulsars. 2) Detection of high energy gamma-ray emission from globular clusters, most likely due to summed emission from msec pulsars. 3) Discovery of delayed and extended high energy gamma-ray emission from short and long gamma-ray busts. 4) Detection of approximately 250 gamma-ray bursts per year with the GBM instrument. 5) Most accurate measurement of the cosmic ray electron spectrum between 30 GeV and 1 TeV, showing some excess above the conventional diffusion model. The talk will present the new discoveries and their implications.

  10. MAGNETIC STRUCTURES IN GAMMA-RAY BURST JETS PROBED BY GAMMA-RAY POLARIZATION

    Energy Technology Data Exchange (ETDEWEB)

    Yonetoku, Daisuke; Murakami, Toshio; Morihara, Yoshiyuki; Takahashi, Takuya; Wakashima, Yudai; Yonemochi, Hajime; Sakashita, Tomonori; Fujimoto, Hirofumi; Kodama, Yoshiki [College of Science and Engineering, School of Mathematics and Physics, Kanazawa University, Kakuma, Kanazawa, Ishikawa 920-1192 (Japan); Gunji, Shuichi; Toukairin, Noriyuki [Department of Physics, Faculty of Science, Yamagata University, 1-4-12, Koshirakawa, Yamagata, Yamagata 990-8560 (Japan); Mihara, Tatehiro [Cosmic Radiation Laboratory, RIKEN, 2-1, Hirosawa, Wako City, Saitama 351-0198 (Japan); Toma, Kenji, E-mail: yonetoku@astro.s.kanazawa-u.ac.jp [Department of Earth and Space Science, Osaka University, Toyonaka 560-0043 (Japan)

    2012-10-10

    We report polarization measurements in two prompt emissions of gamma-ray bursts, GRB 110301A and GRB 110721A, observed with the gamma-ray burst polarimeter (GAP) on borad the IKAROS solar sail mission. We detected linear polarization signals from each burst with polarization degree of {Pi} = 70 {+-} 22% with statistical significance of 3.7{sigma} for GRB 110301A, and {Pi} = 84{sup +16}{sub -28}% with 3.3{sigma} confidence level for GRB 110721A. We did not detect any significant change of polarization angle. These two events had shorter durations and dimmer brightness compared with GRB 100826A, which showed a significant change of polarization angle, as reported in Yonetoku et al. Synchrotron emission model can be consistent with the data of the three GRBs, while the photospheric quasi-thermal emission model is not favored. We suggest that magnetic field structures in the emission region are globally ordered fields advected from the central engine.

  11. The supernova-gamma-ray burst-jet connection.

    Science.gov (United States)

    Hjorth, Jens

    2013-06-13

    The observed association between supernovae and gamma-ray bursts represents a cornerstone in our understanding of the nature of gamma-ray bursts. The collapsar model provides a theoretical framework for this connection. A key element is the launch of a bipolar jet (seen as a gamma-ray burst). The resulting hot cocoon disrupts the star, whereas the (56)Ni produced gives rise to radioactive heating of the ejecta, seen as a supernova. In this discussion paper, I summarize the observational status of the supernova-gamma-ray burst connection in the context of the 'engine' picture of jet-driven supernovae and highlight SN 2012bz/GRB 120422A--with its luminous supernova but intermediate high-energy luminosity--as a possible transition object between low-luminosity and jet gamma-ray bursts. The jet channel for supernova explosions may provide new insights into supernova explosions in general.

  12. Gamma-Ray Bursts: 4th Huntsville Symposium. Proceedings

    International Nuclear Information System (INIS)

    Meegan, C.A.; Preece, R.D.; Koshut, T.M.

    1998-01-01

    These proceedings represent papers presented at the Fourth Huntsville Gamma-Ray Bursts Symposium held in September, 1997 in Huntsville, Alabama, USA. This conference occurred at a crucial time in the history of the gamma-ray burst research. In early 1997, 30 years after the detection of the first gamma-ray burst by the Vela satellites, counterparts to bursts were finally detected at optical and radio wavelengths. The symposium attracted about 200 scientists from 16 countries. Some of the topics discussed include gamma-ray burst spectra, x-ray observations, optical observations, radio observations, host galaxies, shocks and afterglows and models of gamma-ray bursts. There were 183 papers presented, out of these, 16 have been abstracted for the Energy Science and Technology database

  13. Recent achievements in the field of gamma-ray bursts

    International Nuclear Information System (INIS)

    Lu Tan; Dai Zigao

    2001-01-01

    Recent progresses in the field of gamma-ray bursts is briefly introduced. Gamma-ray bursts are the most energetic explosion since the Big Bang of the universe. Within a few tens of seconds, the energy released in gamma-ray bursts could be several hundred times larger than that released form the sun in its whole life (about 10 billion years). The authors will first briefly discuss the observational facts, based on which the authors will discuss the standard fireball model, the dynamical behavior and evolution of gamma-ray bursts and their afterglows. Then, various observational phenomena that contradict the standard model are given and the importance of these post-standard effects are pointed out. The questions related to the energy source of gamma-ray bursts are still unanswered, and other important questions also remain to be solved

  14. Gamma-Ray imaging for nuclear security and safety: Towards 3-D gamma-ray vision

    Science.gov (United States)

    Vetter, Kai; Barnowksi, Ross; Haefner, Andrew; Joshi, Tenzing H. Y.; Pavlovsky, Ryan; Quiter, Brian J.

    2018-01-01

    The development of portable gamma-ray imaging instruments in combination with the recent advances in sensor and related computer vision technologies enable unprecedented capabilities in the detection, localization, and mapping of radiological and nuclear materials in complex environments relevant for nuclear security and safety. Though multi-modal imaging has been established in medicine and biomedical imaging for some time, the potential of multi-modal data fusion for radiological localization and mapping problems in complex indoor and outdoor environments remains to be explored in detail. In contrast to the well-defined settings in medical or biological imaging associated with small field-of-view and well-constrained extension of the radiation field, in many radiological search and mapping scenarios, the radiation fields are not constrained and objects and sources are not necessarily known prior to the measurement. The ability to fuse radiological with contextual or scene data in three dimensions, in analog to radiological and functional imaging with anatomical fusion in medicine, provides new capabilities enhancing image clarity, context, quantitative estimates, and visualization of the data products. We have developed new means to register and fuse gamma-ray imaging with contextual data from portable or moving platforms. These developments enhance detection and mapping capabilities as well as provide unprecedented visualization of complex radiation fields, moving us one step closer to the realization of gamma-ray vision in three dimensions.

  15. Multiwavelength Study of Gamma-Ray Bright Blazars

    Science.gov (United States)

    Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.

    2011-01-01

    We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

  16. Characteristics of the telescope for high energy gamma-ray astronomy selected for definition studies on the Gamma Ray Observatory

    Science.gov (United States)

    Hughes, E. B.; Hofstadter, R.; Rolfe, J.; Johansson, A.; Bertsch, D. L.; Cruickshank, W. J.; Ehrmann, C. H.; Fichtel, C. E.; Hartman, R. C.; Kniffen, D. A.

    1980-01-01

    The high energy gamma-ray telescope selected for definition studies on the Gamma Ray Observatory provides a substantial improvement in observational capability over earlier instruments. It will have about 20 times more sensitivity, cover a much broader energy range, have considerably better energy resolution and provide a significantly improved angular resolution. The design and performance are described.

  17. Gamma ray sensitivity of superheated liquid

    International Nuclear Information System (INIS)

    Sawamura, Teruko; Sugiyama, Noriyuki; Narita, Masakuni

    2000-01-01

    The superheated drop detector (SDD) is composed of droplets of sensitive liquid with a low-boiling point and a medium supporting the dispersed droplets throughout the medium. The SDD has been mainly used for neutron dosimetry and recently also for gamma-rays. While for neutrons the conditions for bubble formation have been discussed, there has been little work for gamma-rays. We investigated the conditions for low LET radiation, such as protons and gamma-rays, and showed octafluoropropane (C 3 F 8 , boiling point -36.7degC) as advantageous liquid. The bubble formation condition is given by the energy density imparted from the charged particle to the sensitive liquid. The energy density requirement means that the energy must be deposited over a definite region length, effective to produce the vapor nucleus that becomes the visible bubble. Recently for γ-rays, Evans and Wang proposed the model that the vaporization was triggered by the energy deposition in a 'cluster' including many events in proximity in a superheated liquid. Measurements of the γ-ray sensitivity have not been sufficiently carried out and therefore the effective length or the cluster model has not been well-established. In this study the detection sensitivity was evaluated by measuring the life time of a liquid drop exposed to γ-rays. We developed a device trapping a superheated drop, where a single drop of test liquid was trapped and decompressed by an acoustic standing wave field. When a liquid drop with volume V[cm 3 ] is exposed to a γ-ray flux φ γ [cm -2 s -1 ], the average evaporation rate λ(T, P) [s -1 ] (T: temperature, P: decompressed pressure) is expressed as λ(T, P)=K γ Vφ γ (1), K γ [cm -1 ] is the γ-ray detection sensitivity per unit volume of the sensitive liquid and unit fluence. If the average rate of spontaneous evaporation is λ 0 (T, P), then the probability distribution of the life time t, the probability that t > τ, is expressed by X(τ)=exp{-(λ+λ 0 )

  18. Development of a Watt-level gamma-ray source based on high-repetition-rate inverse Compton scattering

    Energy Technology Data Exchange (ETDEWEB)

    Mihalcea, D.; Murokh, A.; Piot, P.; Ruan, J.

    2017-07-01

    A high-brilliance (~1022 photon s-1 mm-2 mrad-2 /0.1%) gamma-ray source experiment is currently being planned at Fermilab (Eγ≃1.1 MeV). The source implements a high-repetition-rate inverse Compton scattering by colliding electron bunches formed in a ~300-MeV superconducting linac with a high-intensity laser pulse. This paper describes the design rationale along with some of technical challenges associated to producing high-repetition-rate collision. The expected performances of the gamma-ray source are also presented.

  19. ICF gamma-ray reaction history diagnostics

    International Nuclear Information System (INIS)

    Herrmann, H W; Young, C S; Mack, J M; Kim, Y H; McEvoy, A; Evans, S; Sedillo, T; Batha, S; Schmitt, M; Wilson, D C; Langenbrunner, J R; Malone, R; Kaufman, M I; Cox, B C; Frogget, B; Tunnell, T W; Miller, E K; Ali, Z A; Stoeffl, W; Horsfield, C J

    2010-01-01

    Reaction history measurements, such as nuclear bang time and burn width, are fundamental components of diagnosing ICF implosions and will be employed to help steer the National Ignition Facility (NIF) towards ignition. Fusion gammas provide a direct measure of nuclear interaction rate (unlike x-rays) without being compromised by Doppler spreading (unlike neutrons). Gas Cherenkov Detectors that convert fusion gamma rays to UV/visible Cherenkov photons for collection by fast optical recording systems have established their usefulness in illuminating ICF physics in several experimental campaigns at OMEGA. In particular, bang time precision better than 25 ps has been demonstrated, well below the 50 ps accuracy requirement defined by the NIF. NIF Gamma Reaction History (GRH) diagnostics are being developed based on optimization of sensitivity, bandwidth, dynamic range, cost, and NIF-specific logistics, requirements and extreme radiation environment. Implementation will occur in two phases. The first phase consists of four channels mounted to the outside of the target chamber at ∼6 m from target chamber center (GRH-6m) coupled to ultra-fast photo-multiplier tubes (PMT). This system is intended to operate in the 10 13 -10 17 neutron yield range expected during the early THD campaign. It will have high enough bandwidth to provide accurate bang times and burn widths for the expected THD reaction histories (> 80 ps fwhm). Successful operation of the first GRH-6m channel has been demonstrated at OMEGA, allowing a verification of instrument sensitivity, timing and EMI/background suppression. The second phase will consist of several channels located just inside the target bay shield wall at 15 m from target chamber center (GRH-15m) with optical paths leading through the cement shield wall to well-shielded streak cameras and PMTs. This system is intended to operate in the 10 16 -10 20 yield range expected during the DT ignition campaign, providing higher temporal resolution

  20. ICF gamma-ray reaction history diagnostics

    Science.gov (United States)

    Herrmann, H. W.; Young, C. S.; Mack, J. M.; Kim, Y. H.; McEvoy, A.; Evans, S.; Sedillo, T.; Batha, S.; Schmitt, M.; Wilson, D. C.; Langenbrunner, J. R.; Malone, R.; Kaufman, M. I.; Cox, B. C.; Frogget, B.; Miller, E. K.; Ali, Z. A.; Tunnell, T. W.; Stoeffl, W.; Horsfield, C. J.; Rubery, M.

    2010-08-01

    Reaction history measurements, such as nuclear bang time and burn width, are fundamental components of diagnosing ICF implosions and will be employed to help steer the National Ignition Facility (NIF) towards ignition. Fusion gammas provide a direct measure of nuclear interaction rate (unlike x-rays) without being compromised by Doppler spreading (unlike neutrons). Gas Cherenkov Detectors that convert fusion gamma rays to UV/visible Cherenkov photons for collection by fast optical recording systems have established their usefulness in illuminating ICF physics in several experimental campaigns at OMEGA. In particular, bang time precision better than 25 ps has been demonstrated, well below the 50 ps accuracy requirement defined by the NIF. NIF Gamma Reaction History (GRH) diagnostics are being developed based on optimization of sensitivity, bandwidth, dynamic range, cost, and NIF-specific logistics, requirements and extreme radiation environment. Implementation will occur in two phases. The first phase consists of four channels mounted to the outside of the target chamber at ~6 m from target chamber center (GRH-6m) coupled to ultra-fast photo-multiplier tubes (PMT). This system is intended to operate in the 1013-1017 neutron yield range expected during the early THD campaign. It will have high enough bandwidth to provide accurate bang times and burn widths for the expected THD reaction histories (> 80 ps fwhm). Successful operation of the first GRH-6m channel has been demonstrated at OMEGA, allowing a verification of instrument sensitivity, timing and EMI/background suppression. The second phase will consist of several channels located just inside the target bay shield wall at 15 m from target chamber center (GRH-15m) with optical paths leading through the cement shield wall to well-shielded streak cameras and PMTs. This system is intended to operate in the 1016-1020 yield range expected during the DT ignition campaign, providing higher temporal resolution for the

  1. Development of gamma-ray-suppression type of small-sized neutron detector based on a 6Li-glass scintillator

    International Nuclear Information System (INIS)

    Matsumoto, T.; Harano, H.; Shimoyama, T.; Kudo, K.; Uritani, A.

    2005-01-01

    A small-sized thermal neutron detector based on a 6 Li-glass scintillator and a plastic optical fiber was developed for measurement of a dose distribution of thermal neutrons in a thermal neutron standard field. A contribution of gamma rays can not be neglected in the neutron measurement with this detector, although the 6 Li-glass scintillator can be distinguishable for the neutrons and the gamma rays by difference of each pulse height. Moreover, to reduce an uncertainty of neutron counts caused by the gamma ray background around a discrimination level, we suggested a gamma-ray-suppression type of small-sized thermal neutron detector with a 6 Li-glass scintillator, a hollow CsI(Tl) scintillator and plastic optical fibers. The detector can reject signals due to the gamma rays with an anti-coincidence method. In the present paper, we evaluated an ability of a gamma-ray suppression of the detector using the EGS4 electron-photon transport Monte-Carlo code with the PRESTA routine. As the results, the sufficient gamma-ray suppression effect was shown. (author)

  2. Gamma rays induced bold seeded high yielding mutant in chickpea

    International Nuclear Information System (INIS)

    Wani, A.A.; Anis, M.

    2001-01-01

    In pulses especially in chickpea (Cicer arietinum L.), genetic variability has been exhausted due to natural selection and hence conventional breeding methods are not very fruitful. Mutation techniques are the best methods to enlarge the genetically conditioned variability of a species within a short time and have played a significant role in the development of many crop varieties. Investigations on the effects of ionizing radiations and chemical mutagens in induction of macro-mutations have received much attention owing to their utmost importance in plant breeding. The present study reports a bold seeded mutant in chickpea, the most dominating pulse crop on the Indian subcontinent. Fresh seeds of chickpea variety 'Pusa-212' were procured from IARI, New Delhi and treated with different doses/concentrations of gamma rays ( 60 Co source at NBRI, Lucknow) and ethyl methanesulphonate (EMS), individually as well as in combination, to raise the M1 generation. Seeds of M 1 plants were sown to raise M2 plant progenies. A bold seeded mutant was isolated from 400 Gy gamma ray treatments. The mutant was confirmed as true bred, all the mutant seeds gave rise to morphologically similar plants in M 3 , which were quite distinct from the control. The bold seeded mutant showed 'gigas' characteristics and vigorous growth. The plant remained initially straight but later on attained a trailing habit due to heavy secondary branching. The leaves, petioles, flowers, pods and seeds were almost double that of the parent variety, in size. The flowering occurred 10 days later than the parent and maturity was also delayed accordingly. Observations were recorded on various quantitative traits. Plant height and number of primary branches showed a significant improvement over the parent. It is interesting to note that the number of pods and number of seeds per pod significantly decreased. However, the hundred seed weight (31.73±0.59g) in the mutant plants was more than double in the parent

  3. Scanning of Cargo Containers by Gamma-Ray and Fast Neutron Radiography

    International Nuclear Information System (INIS)

    Yousri, A.M.; Bashter, I.I.; Megahid, M.R.; Osman, A.M.; Kansouh, W.A.; Reda, A.M.

    2011-01-01

    This paper describes the combined systems which were installed and tested to detect contraband smuggled in cargo containers. These combined systems are based on radiographers work by gamma-rays emitted from point source 60 Co with 0.5 Ci activity and neutrons emitted from point isotopic sources of Pu-α-Be as well as 14 MeV neutrons emitted from sealed tube neutron generator. The transmitted gamma ray through the inspected object was measured by gamma detection system with NaI(Tl) detector while the transmitted fast neutron beam was measured by a neutron gamma detection system with stilbene organic scintillator. The later possess the capability of discrimination between between gamma and neutron pulses using a discrimination system based on pulse shape discrimination method. The measured intensities of primary incident and transmitted beams of gamma-rays and fast neutrons were used to construct 2D cross-sectional images of the inspected objects hidden directly within benign materials of the container and for object screened by high dense material to stop object detection by gamma or X-rays. The constructed images for the inspected objects show the good capability and effectiveness of the installed gamma and neutron radiographers to detect illicit materials hidden in air cargo containers and sea containers of med size. They have also indicated that the developed scanning systems possess the ease of mobility and low cost of scanning

  4. A new gamma ray imaging diagnostic for runaway electron studies at DIII-D

    Science.gov (United States)

    Cooper, C. M.; Pace, D. C.; Eidietis, N. W.; Paz-Soldan, C.; Commaux, N.; Shiraki, D.; Hollmann, E. M.; Moyer, R. A.; Risov, V.

    2015-11-01

    A new Gamma Ray Imager (GRI) is developed to probe the electron distribution function with 2D spatial resolution during runaway electron (RE) experiments at DIII-D. The diagnostic is sensitive to 0.5 - 50 MeV gamma rays, allowing characterization of the RE distribution function evolution during RE dissipation from pellet injection. The GRI consists of a lead ``pinhole camera'' mounted on the midplane with 11x11 counter-current tangential chords 20 cm wide that span the vessel. Up to 30 bismuth germanate (BGO) scintillation detectors capture RE Bremsstrahlung radiation. Detectors operate in current saturation mode at 10 MHz, or the flux is attenuated for Pulse Height Analysis (PHA) capable of discriminating up to ~10k pulses per second. Digital signal processing routines combining shaping filters are performed during PHA to reject noise and record gamma ray energy. The GRI setup and PHA algorithms will be described and initial data from experiments will be presented. Work supported by the US DOE under DE-AC05-00OR22725, DE-FG02-07ER54917 & DE-FC02-04ER54698.

  5. Prompt gamma-ray analysis of steel slag in concrete

    International Nuclear Information System (INIS)

    Naqvi, Akhtar Abbas; Garwan, Muhammad Ahmad; Nagadi, Mahmoud Mohammad; Rehman, Khateeb-ur; Raashid, Mohammad; Masalehuddin Mohiuddin, Mohammad; Al-Amoudi, Omar Saeed Baghabra

    2009-01-01

    Blast furnace slag (BFS) is added to Portland cement concrete to increase its durability, particularly its corrosion resistance. Monitoring the concentration of BFS in concrete for quality control purposes is desired. In this study, the concentration of BFS in concrete was measured by utilizing an accelerator-based prompt gamma-ray neutron activation analysis (PGNAA) setup. The optimum size of the BFS cement concrete specimen that produces the maximum intensity of gamma rays at the detector location was calculated through Monte Carlo simulations. The simulation results were experimentally validated through the gamma-ray yield measurement from BFS cement concrete specimens having different radii. The concentration of BFS in the cement concrete specimens was assessed through calcium and silicon gamma-ray yield measurement from cement concrete specimens containing 5 to 80 wt% BFS. The yield of calcium gamma rays decreases with increasing BFS concentration in concrete while the yield of silicon gamma rays increases with increasing BFS concentration in concrete. The calcium-to-silicon gamma-ray yield ratio has an inverse relation with BFS concentration in concrete. (author)

  6. Guidelines for radioelement mapping using gamma ray spectrometry data

    International Nuclear Information System (INIS)

    2003-07-01

    The purpose of the report is to provide an up-to-date review on the use of gamma ray spectrometry for radioelement mapping and, where appropriate, provide guidelines on the correct application of the method. It is a useful training guide for those new to the method. It gives a broad coverage of all aspects of the gamma ray method and provides a comprehensive list of references. The report gives an overview of the theoretical background to radioactivity and the gamma ray spectrometric method followed by a review of the application of the method to mapping the radiation environment. A brief outline is presented of the principles of radioactivity, the interaction of gamma rays with matter, instrumentation applied to the measurement of gamma rays, and the quantities and units in contemporary use in gamma ray spectrometry. This is followed by a review of the fundamentals of gamma ray spectrometry, and its application to ground and airborne mapping. Covered are also all aspects of the calibration and data processing procedures required for estimating the ground concentrations of the radioelements. The procedures required for the recovery of older survey data are also presented as well as an overview of data presentation and integration for mapping applications

  7. Design Study for Direction Variable Compton Scattering Gamma Ray

    Science.gov (United States)

    Kii, T.; Omer, M.; Negm, H.; Choi, Y. W.; Kinjo, R.; Yoshida, K.; Konstantin, T.; Kimura, N.; Ishida, K.; Imon, H.; Shibata, M.; Shimahashi, K.; Komai, T.; Okumura, K.; Zen, H.; Masuda, K.; Hori, T.; Ohgaki, H.

    2013-03-01

    A monochromatic gamma ray beam is attractive for isotope-specific material/medical imaging or non-destructive inspection. A laser Compton scattering (LCS) gamma ray source which is based on the backward Compton scattering of laser light on high-energy electrons can generate energy variable quasi-monochromatic gamma ray. Due to the principle of the LCS gamma ray, the direction of the gamma beam is limited to the direction of the high-energy electrons. Then the target object is placed on the beam axis, and is usually moved if spatial scanning is required. In this work, we proposed an electron beam transport system consisting of four bending magnets which can stick the collision point and control the electron beam direction, and a laser system consisting of a spheroidal mirror and a parabolic mirror which can also stick the collision point. Then the collision point can be placed on one focus of the spheroid. Thus gamma ray direction and collision angle between the electron beam and the laser beam can be easily controlled. As the results, travelling direction of the LCS gamma ray can be controlled under the limitation of the beam transport system, energy of the gamma ray can be controlled by controlling incident angle of the colliding beams, and energy spread can be controlled by changing the divergence of the laser beam.

  8. Guideline of Monte Carlo calculation. Neutron/gamma ray transport simulation by Monte Carlo method

    CERN Document Server

    2002-01-01

    This report condenses basic theories and advanced applications of neutron/gamma ray transport calculations in many fields of nuclear energy research. Chapters 1 through 5 treat historical progress of Monte Carlo methods, general issues of variance reduction technique, cross section libraries used in continuous energy Monte Carlo codes. In chapter 6, the following issues are discussed: fusion benchmark experiments, design of ITER, experiment analyses of fast critical assembly, core analyses of JMTR, simulation of pulsed neutron experiment, core analyses of HTTR, duct streaming calculations, bulk shielding calculations, neutron/gamma ray transport calculations of the Hiroshima atomic bomb. Chapters 8 and 9 treat function enhancements of MCNP and MVP codes, and a parallel processing of Monte Carlo calculation, respectively. An important references are attached at the end of this report.

  9. Advanced Laser-Compton Gamma-Ray Sources for Nuclear Materials Detection, Assay and Imaging

    Science.gov (United States)

    Barty, C. P. J.

    2015-10-01

    Highly-collimated, polarized, mono-energetic beams of tunable gamma-rays may be created via the optimized Compton scattering of pulsed lasers off of ultra-bright, relativistic electron beams. Above 2 MeV, the peak brilliance of such sources can exceed that of the world's largest synchrotrons by more than 15 orders of magnitude and can enable for the first time the efficient pursuit of nuclear science and applications with photon beams, i.e. Nuclear Photonics. Potential applications are numerous and include isotope-specific nuclear materials management, element-specific medical radiography and radiology, non-destructive, isotope-specific, material assay and imaging, precision spectroscopy of nuclear resonances and photon-induced fission. This review covers activities at the Lawrence Livermore National Laboratory related to the design and optimization of mono-energetic, laser-Compton gamma-ray systems and introduces isotope-specific nuclear materials detection and assay applications enabled by them.

  10. X-RAY PULSATIONS FROM THE RADIO-QUIET GAMMA-RAY PULSAR IN CTA 1

    International Nuclear Information System (INIS)

    Caraveo, P. A.; De Luca, A.; Marelli, M.; Bignami, G. F.; Ray, P. S.; Saz Parkinson, P. M.; Kanbach, G.

    2010-01-01

    Prompted by the Fermi-LAT discovery of a radio-quiet gamma-ray pulsar inside the CTA 1 supernova remnant, we obtained a 130 ks XMM-Newton observation to assess the timing behavior of this pulsar. Exploiting both the unprecedented photon harvest and the contemporary Fermi-LAT timing measurements, a 4.7σ single-peak pulsation is detected, making PSR J0007+7303 the second example, after Geminga, of a radio-quiet gamma-ray pulsar also seen to pulsate in X-rays. Phase-resolved spectroscopy shows that the off-pulse portion of the light curve is dominated by a power-law, non-thermal spectrum, while the X-ray peak emission appears to be mainly of thermal origin, probably from a polar cap heated by magnetospheric return currents, pointing to a hot spot varying throughout the pulsar rotation.

  11. Experimental investigation of silicon photomultipliers as compact light readout systems for gamma-ray spectroscopy applications in fusion plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Nocente, M., E-mail: massimo.nocente@mib.infn.it; Gorini, G. [Dipartimento di Fisica “G. Occhialini,” Università degli Studi di Milano-Bicocca, Milano (Italy); Istituto di Fisica del Plasma “P. Caldirola,” EURATOM-ENEA-CNR Association, Milano (Italy); Fazzi, A.; Lorenzoli, M.; Pirovano, C. [Dipartimento di Energia, CeSNEF, Politecnico di Milano, Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Milano, Milano (Italy); Tardocchi, M. [Istituto di Fisica del Plasma “P. Caldirola,” EURATOM-ENEA-CNR Association, Milano (Italy); Cazzaniga, C.; Rebai, M. [Dipartimento di Fisica “G. Occhialini,” Università degli Studi di Milano-Bicocca, Milano (Italy); Uboldi, C.; Varoli, V. [Dipartimento di Energia, CeSNEF, Politecnico di Milano, Milano (Italy)

    2014-11-15

    A matrix of Silicon Photo Multipliers has been developed for light readout from a large area 1 in. × 1 in. LaBr{sub 3} crystal. The system has been characterized in the laboratory and its performance compared to that of a conventional photo multiplier tube. A pulse duration of 100 ns was achieved, which opens up to spectroscopy applications at high counting rates. The energy resolution measured using radioactive sources extrapolates to 3%–4% in the energy range E{sub γ} = 3–5 MeV, enabling gamma-ray spectroscopy measurements at good energy resolution. The results reported here are of relevance in view of the development of compact gamma-ray detectors with spectroscopy capabilities, such as an enhanced gamma-ray camera for high power fusion plasmas, where the use of photomultiplier is impeded by space limitation and sensitivity to magnetic fields.

  12. Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..

    2012-04-05

    We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  13. The LASL gamma-ray burst astronomy program

    International Nuclear Information System (INIS)

    Klebesadel, R.W.; Evans, W.D.; Laros, J.G.

    1981-01-01

    Gamma-ray burst observations performed by LASL began with the identification and initial report of the phenomenon from data acquired by the Vela satellites. The Vela instruments have recorded responses to 73 gamma-ray bursts over a ten-year interval, and are continuing to contribute toward these observations. Similar instrumentation was included aboard the NRL SOLRAD 11 spacecraft. These performed well but suffered an early demise. Recently, the LASL gamma-ray burst astronomy program has been enhanced through the implementation of experiments aboard the Pioneer Venus Orbiter and ISEF-C spacecraft. Both of these experiments are continuing to contribute data vital to trigonometric directional analyses. (orig.)

  14. Evaluation of effective dose equivalent from environmental gamma rays

    International Nuclear Information System (INIS)

    Saito, K.; Tsutsumi, M.; Moriuchi, S.; Petoussi, N.; Zankl, M.; Veit, R.; Jacob, P.; Drexler, G.

    1991-01-01

    Organ doses and effective dose equivalents for environmental gamma rays were calculated using human phantoms and Monte Carlo methods accounting rigorously the environmental gamma ray fields. It was suggested that body weight is the dominant factor to determine organ doses. The weight function expressing organ doses was introduced. Using this function, the variation in organ doses due to several physical factors were investigated. A detector having gamma-ray response similar to that of human bodies has been developed using a NaI(Tl) scintillator. (author)

  15. Gamma-ray bursts from black hole accretion disks

    International Nuclear Information System (INIS)

    Strong, I.B.

    1975-01-01

    The suggestion was first made more than a year ago that gamma-ray bursts might originate in the neighborhood of black holes, based on some rather circumstantial evidence linking Cygnus X-1, the prime black-hole candidate, with two of the then-known gamma-ray bursts. Since then additional evidence makes the idea still more plausible. The evidence is summarized briefly, a physical model for production of gamma-ray bursts is given, and several of the more interesting consequences of such an origin are pointed out. (orig.) [de

  16. Cellular response to low Gamma-ray doses

    Energy Technology Data Exchange (ETDEWEB)

    Manzanares A, E; Vega C, H R; Leon, L.C. de . [Unidades Academicas de Estudios Nucleares, Universidad Autonoma de Zacatecas, A.P. 336, 98000 Zacatecas (Mexico); Rebolledo D, O; Radillo J, F [Facultad de Ciencias Biologicas y Agropecuarias de la Universidad de Colima, Colima (Mexico)

    2002-07-01

    Lymphocytes, obtained from healthy donors, were exposed to a low strength gamma-ray field to determine heat shock protein expression in function of radiation dose. Protein identification was carried out using mAb raised against Hsp70 and Hsc70.Hsp70 protein was detected after lymphocyte irradiation. In all cases, an increasing trend of relative amounts of Hsp70 in function to irradiation time was observed. After 1.25 c Gy gamma-ray dose, lymphocytes expressed Hsp70 protein, indicating a threshold response to gamma rays. (Author)

  17. High energy photons and neutrinos from gamma ray bursts

    International Nuclear Information System (INIS)

    Dar, A.

    1998-01-01

    The Hubble space telescope has recently discovered thousands of gigantic comet-like objects in a ring around the central star in the nearest planetary nebula. It is suggested that such circumstellar rings exist around most of stars. Collisions of the relativistic debris from gamma ray bursts in dense stellar regions with such gigantic comet-like objects, which have been stripped off from the circumstellar rings by gravitational perturbations, produce detectable fluxes of high energy gamma-rays and neutrinos from gamma ray bursts

  18. Analytical applications of neutron capture gamma-rays

    International Nuclear Information System (INIS)

    Lindstrom, R.M.; Paul, R.L.; Anderson, D.L.; Paul, R.L.

    1997-01-01

    Field and industrial applications of neutron capture gamma-ray spectrometry with isotopic sources or neutron generators are economically important. Geochemical exploration in boreholes is done routinely with neutron probes. Coal and ores are assayed with analyzers adjacent to a conveyor belt in dozens of industrial facilities. The use of capture gamma rays for explosives detection has been described in the literature, both for scanning airline baggage and for characterizing obsolete munitions; a packaged system for the latter is available commercially. Generalizations are drawn from the history of the field, and predictions are made about the future usefulness of capture gamma rays. (author)

  19. Optical telescope BIRT in ORIGIN for gamma ray burst observing

    DEFF Research Database (Denmark)

    Content, Robert; Content, Robert; Sharples, Ray

    2012-01-01

    The ORIGIN concept is a space mission with a gamma ray, an X-ray and an optical telescope to observe the gamma ray bursts at large Z to determine the composition and density of the intergalactic matter in the line of sight. It was an answer to the ESA M3 call for proposal. The optical telescope i...... length. All 3 instruments use the same 2k x 2k detector simultaneously so that telescope pointing and tip-tilt control of a fold mirror permit to place the gamma ray burst on the desired instrument without any other mechanism. © 2012 SPIE....

  20. Cellular response to low Gamma-ray doses

    International Nuclear Information System (INIS)

    Manzanares A, E.; Vega C, H.R.; Leon, L.C. de; Rebolledo D, O.; Radillo J, F.

    2002-01-01

    Lymphocytes, obtained from healthy donors, were exposed to a low strength gamma-ray field to determine heat shock protein expression in function of radiation dose. Protein identification was carried out using mAb raised against Hsp70 and Hsc70.Hsp70 protein was detected after lymphocyte irradiation. In all cases, an increasing trend of relative amounts of Hsp70 in function to irradiation time was observed. After 1.25 c Gy gamma-ray dose, lymphocytes expressed Hsp70 protein, indicating a threshold response to gamma rays. (Author)

  1. Gamma ray astronomy and search for antimatter in the universe

    International Nuclear Information System (INIS)

    Schoenfelder, V.

    1989-01-01

    Gamma ray astronomy provides a powerful tool for searching antimatter in the universe; it probably provides the only means to determine, if the universe has baryon symmetry. Presently existing gamma-ray observations can be interpreted without postulating the existence of antimatter. However, the measurements are not precise enough to definitely exclude the possibility of its existence. The search for antimatter belongs to one of the main scientific objectives of the Gamma Ray Observatory GRO of NASA, which will be launched in 1990 by the Space Shuttle. (orig.)

  2. Discovery of Pulsations from the Pulsar J0205 6449 in SNR 3C 58 with the Fermi Gamma-Ray Space Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, Roger D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bouvier, A.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /NASA, Goddard /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Manchester U. /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..

    2011-12-01

    We report the discovery of {gamma}-ray pulsations ({ge}0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the {gamma}-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold {gamma}-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 {+-} 0.01 {+-} 0.01 cycles which are aligned with the X-ray peaks. The first {gamma}-ray peak trails the radio pulse by 0.08 {+-} 0.01 {+-} 0.01, while its amplitude decreases with increasing energy as for the other {gamma}-ray pulsars. Spectral analysis of the pulsed {gamma}-ray emission suggests a simple power law of index -2.1 {+-} 0.1 {+-} 0.2 with an exponential cutoff at 3.0{sub -0.7}{sup +1.1} {+-} 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral {gamma}-ray photon flux above 0.1 GeV is (13.7 {+-} 1.4 {+-} 3.0) x 10{sup -8} cm{sup -2} s{sup -1}, which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10{sup 34} erg s{sup -1} and an efficiency {eta} of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10{sup -8} cm{sup -2} s{sup -1} for off-pulse emission from the object.

  3. Gamma ray induced mutants in Coleus

    International Nuclear Information System (INIS)

    Vasudevan, K.; Jos, J.S.

    1988-01-01

    The germplasm collection of Chinese potato (Coleus parviflorus Benth) contains almost no variation for yield contributing traits. The crop does not produce seeds. Treatment of underground tubers with 1 kR, 2 kR, 3 kR and 4 kR gamma rays resulted in 50 morphologically different mutants which are maintained as mutant clones. In the M 1 V 1 generation, suspected mutant sprouts, were carefully removed and grown separately. The most interesting mutant types are the following: (i) erect mutant with spoon shaped light green leaves, 30 cm long inflorescences against 20 cm in the control, cylindrical tubers measuring ca. 7.0 cm long and 3 cm girth against 4 cm and 2.5 cm in the control (ii) early mutants 1 and 2, one having less leaf serration, the other having light green small leaves and dwarf type (iii) fleshy leaf mutant, dark green, thick and smooth leaves. Control plants spread almost in 1 m 2 area and bear tubers from the nodes of branches. In the early mutants tuber formation is mainly restricted to the base of the plant, which makes harvest easier. The crop usually matures within 150 - 160 days, the early mutants are ready for harvest 100 days after planting. As the mutants are less spreading, the yield could be increased by closer spacing

  4. Observations of short gamma-ray bursts.

    Science.gov (United States)

    Fox, Derek B; Roming, Peter W A

    2007-05-15

    We review recent observations of short-hard gamma-ray bursts and their afterglows. The launch and successful ongoing operations of the Swift satellite, along with several localizations from the High-Energy Transient Explorer mission, have provoked a revolution in short-burst studies: first, by quickly providing high-quality positions to observers; and second, via rapid and sustained observations from the Swift satellite itself. We make a complete accounting of Swift-era short-burst localizations and proposed host galaxies, and discuss the implications of these observations for the distances, energetics and environments of short bursts, and the nature of their progenitors. We then review the physical modelling of short-burst afterglows: while the simplest afterglow models are inadequate to explain the observations, there have been several notable successes. Finally, we address the case of an unusual burst that threatens to upset the simple picture in which long bursts are due to the deaths of massive stars, and short bursts to compact-object merger events.

  5. Gamma ray induced mutants in Coleus

    Energy Technology Data Exchange (ETDEWEB)

    Vasudevan, K; Jos, J S [Central Tuber Crops Research Institute, Trivandrum, Kerala (India)

    1988-07-01

    The germplasm collection of Chinese potato (Coleus parviflorus Benth) contains almost no variation for yield contributing traits. The crop does not produce seeds. Treatment of underground tubers with 1 kR, 2 kR, 3 kR and 4 kR gamma rays resulted in 50 morphologically different mutants which are maintained as mutant clones. In the M{sub 1}V{sub 1} generation, suspected mutant sprouts, were carefully removed and grown separately. The most interesting mutant types are the following: (i) erect mutant with spoon shaped light green leaves, 30 cm long inflorescences against 20 cm in the control, cylindrical tubers measuring ca. 7.0 cm long and 3 cm girth against 4 cm and 2.5 cm in the control (ii) early mutants 1 and 2, one having less leaf serration, the other having light green small leaves and dwarf type (iii) fleshy leaf mutant, dark green, thick and smooth leaves. Control plants spread almost in 1 m{sup 2} area and bear tubers from the nodes of branches. In the early mutants tuber formation is mainly restricted to the base of the plant, which makes harvest easier. The crop usually matures within 150 - 160 days, the early mutants are ready for harvest 100 days after planting. As the mutants are less spreading, the yield could be increased by closer spacing.

  6. Portable high energy gamma ray imagers

    International Nuclear Information System (INIS)

    Guru, S.V.; Squillante, M.R.

    1996-01-01

    To satisfy the needs of high energy gamma ray imagers for industrial nuclear imaging applications, three high energy gamma cameras are presented. The RMD-Pinhole camera uses a lead pinhole collimator and a segmented BGO detector viewed by a 3 in. square position sensitive photomultiplier tube (PSPMT). This pinhole gamma camera displayed an energy resolution of 25.0% FWHM at the center of the camera at 662 keV and an angular resolution of 6.2 FWHM at 412 keV. The fixed multiple hole collimated camera (FMCC), used a multiple hole collimator and a continuous slab of NaI(Tl) detector viewed by the same PSPMT. The FMCC displayed an energy resolution of 12.4% FWHM at 662 keV at the center of the camera and an angular resolution of 6.0 FWHM at 412 keV. The rotating multiple hole collimated camera (RMCC) used a 180 antisymmetric rotation modulation collimator and CsI(Tl) detectors coupled to PIN silicon photodiodes. The RMCC displayed an energy resolution of 7.1% FWHM at 662 keV and an angular resolution of 4.0 FWHM at 810 keV. The performance of these imagers is discussed in this paper. (orig.)

  7. Uses Of Gamma Rays In Peas Breeding

    International Nuclear Information System (INIS)

    Ghunim, A.; Mobakher, H.; Salman, S.

    2004-01-01

    Most of peas varieties grown in Syria are introduced and they have variable characteristics and unstable in the productivity. Therefore this study aims to utilize physical mutagens as the developed technology in plant breeding to obtain high, stable productivity and suitable for human consumption and processing. Two green peas vars (onward, local homsi) were used in this study, and their dry seeds were subjected to different doses of Gamma rays (5.0,7.5,10.0) KR and planted conventional used methods at AL Taibba searching station (20 Km from Damascus) in 1985/1986 season. Individual selection from M2 was practiced based on yield traits. Starting from 1991/1992 season the best selected mutants were used in yield trials to be compared with the best common cultivars. After/3/years of yield trials, the advanced lines were incorporated into field test trials. Some morphological and phonological scores, i.e. green pods yield, dry seeds yield per area were achieved in addition to lab tests. Some strains have advanced in yield of green pods and dry seeds per area compared with the local check. Some other strains. Showed an increase in earliness, length of pods, number of seeds per pod, and number of pods per plant than the local check. Therefore these can be called promising strains and as nucleus for new vars. will be used into verifiable fields, and in large-scale cultivation in order to be released. (Authors)

  8. Relation between sedimentation behaviour of DNA-membrane complexes and DNA single- and double-strand breaks after irradiation with gamma-rays, pulse neutrons and 12C ions

    International Nuclear Information System (INIS)

    Erzgraber, G.; Lapidus, I.L.

    1985-01-01

    The experimental data on sedimentation behaviour of DNA-membrane complexes at radiation of the Chinese hamster cells (V79-4) in a wide dose range of 127 Cs γ-rays, pulse neutrons (reactor IBR-2, Laboratory of Neutron Physics, JINR, Dubna) are accelerated 12 C ions (cyclotron U-200, Laboratory of Nuclear Reactions, JINR, Dubna) are presented An assumption on the role of DNA single- and double-strend breaks in changing the sedimentation properties of DNA-membrane complexes has been confirmed by the experiments with radiation of different quality. The possibility of estimating induction and repair of DNA breaks on the basis of dependence of the relative sedimentation velocity of complexes on the irradiation does is discussed

  9. Planetary gamma-ray spectroscopy: the effects of hydrogen absorption cross-section of the gamma-ray spectrum

    International Nuclear Information System (INIS)

    Lapides, J.R.

    1981-01-01

    The gamma-ray spectroscopy of planet surfaces is one of several possible methods that are useful in determining the elemental composition of planet surfaces from orbiting spacecraft. This has been demonstrated on the Apollos 15 and 16 missions as well as the Soviet Mars-5 mission. Planetary gamma-ray emission is primarily the result of natural radioactive decay and cosmic-ray and solar-flare-induced nuclear reactions. Secondary neutron reactions play a large role in the more intense gamma-ray emission. The technique provides information on the elemental composition of the top few tens of centimeters of the planet surface. Varying concentrations of hydrogen and compositional variations that alter the macroscopic thermal-neutron absorption cross section have a significant effect on the neutron flux in the planet surface and therefore also on the gamma-ray emission from the surface. These effects have been systematically studied for a wide range of possible planetary compositions that include Mercury, the moon, Mars, the comets, and the asteroids. The problem of the Martian atmosphere was also investigated. The results of these calculations, in which both surface neutron fluxes and gamma-ray emission fluxes were determined, were used to develop general procedures for obtaining planet compositions from the gamma-ray spectrum. Several changes have been suggested for reanalyzing the Apollos 15 and 16 gamma-ray results. In addition, procedures have been suggested that can be applied to neutron-gamma techniques in mineral and oil exploration

  10. New technique for tissue-equivalent gamma ray dosimetry

    International Nuclear Information System (INIS)

    Squillante, M.R.; Stern, I.; Nagarkar, V.; Entine, G.

    1992-01-01

    The use of semiconductor sensors in dosimeters is attractive for a variety of reasons including potential low cost and high sensitivity. However, the accurate measurement of the radiation dose to tissue using solid state detectors is made difficult by the relatively high atomic number of semiconductor materials. This leads to an over response to gamma ray energies below 100 keV and an under response above that. If the energy spectrum is known, corrections can be applied to yield accurate dose. In real life situations, however, the energy spectrum is not always known and may be difficult to determine at high flux rates. Also, in some cases, the energy spectrum may change with time. This paper reports that, by operating a custom-designed CdTe sensor in the pulse mode and measuring the average energy deposited, a nearly-linear relationship between the tissue dose rate and the sensor signal was obtained. Based on this technique, a prototype detector and dosimeter system were developed

  11. Gamma ray induced male sterility mutant in lentil

    International Nuclear Information System (INIS)

    Srivastava, A.; Yadav, A.K.

    2001-01-01

    Full text: Male sterility refers to the failure of pollen grains to bring about effective fertilization, either due to structural default or physiological disfunctioning and has special significance in hybridization programmes. Male steriles have been produced in a number of crop plants like red gram, pigeon pea, mung bean, khesari and lentil. A completely male sterile mutant was isolated in Lens culinaris Medik, after seed treatment with 100 Gy dose of gamma rays. The male sterile mutant showed 100% pollen sterility but was morphologically more vigorous than the parent plants. It showed more branches and its leaves were bigger, more oblong and dark green. The number of flowers borne by the mutant was significantly higher than any other plant of the treatment. The size of the flowers was also increased but the anthers were smaller in size. Pollen grains were few in number, round in shape but empty and did not take up any stain, indicating that normal microsporogenesis had not taken place. This male sterile mutant was used as the female parent and pollinated with pollen of a parent. Four pods with one seed in each were formed indicating that the mutant was female fertile. The seeds were smaller than those of the parent variety and also dark coloured. The mutant showed increased vigour and flower number as compared to parental plants. Lentil is an important pulse crop and induction of variability in its germplasm is necessary for its improvement. Male steriles can be used conveniently in lentil hybridization programmes. (author)

  12. Research on digital airborne gamma-ray spectrometry

    International Nuclear Information System (INIS)

    Ge Liangquan; Lai Wanchang; Zeng Guoqiang; Fan Zhenguo; Xiong Shengqing; Ni Weizhong

    2010-01-01

    Airborne Gamma-ray Spectrometry (AGS) is a main supporting technique for looking for uranium deposits and other non-radioactive mineral deposit, as well as for investigating environmental radiation pollution and monitoring nuclear equipment. This paper describes the newest achievements about the AGS instrument developed by Chengdu university of Technology. Those are: 1) the probe of AGS is composed of 5 NaI(Tl) + PMT scintillation counters with 10 x 10 x 40 mm size, and a special temperature sensor, preamplifier with circuit negative feedback and high voltage with lower electronic noise have been designed. 2)A Y/U double channel digital controlled gain amplifier for adjusting the spectrum drift finely and high speed ADC and CPLD are designed to perform digitalized spectroscopy and to improve the energy resolution and pulse through output rate (more than 100k/s). 3) Two self-stabilization spectrum loops have been designed for spectrum stability: The first loop is roughly adjusted by temperature and the second loop is finely by Kalman filter. 4) The significant characters of new AGS system are: the detective gamma energy range is 0.02∼10.0 MeV, the spectrum drift is ±1 channel, the collecting period is 0.5-1 s, and 20 NaI(Tl)+PMT scintillation counters can be operated at the same time. (authors)

  13. Detection of Primordial Magnetic Fields in TeV gamma-ray data

    Science.gov (United States)

    Wingler, A.

    The analysis of the time-variable flux of γ-ray photons from extragalactic sources is currently the only proposed way to directly determine the magnetic field strengths in intergalactic space - far away from galaxies and clusters (in the cosmological "voids") - in the range below about 10,10 Gauss (Plaga 1995). Remnant magnetic fields with field strengths much below this, which may well have formed in early cosmological times, could exist in these voids. Due to their interaction with infrared photons TeV gamma-rays induce pair production in intergalactic space. The electrons and positrons are deflected by ambient magnetic fields and produce γ-rays via inverse Compton scattering that are delayed with respect to the original photons in an energy-dependent, characteristic manner. A standard method to identify these delayed events in a data sample of a source with a variable VHE γ-ray flux (as available from several Cherenkov telescope experiments for the high-emission phase of the AGN Mrk 501 in 1997) is described. Monte-Carlo simulations of existing data sets (taking into backgrounds and instrumental limitations) are used to explore how sensitive data sets similar to the existing ones are to primordial magnetic fields. We find that about 22000 (15000) events from a source with characteristics similar to Mrk 501 are needed to detect a primordial B field of 3 (10) atto Gauss (10,18 G) with a 3 significance.

  14. TARGET: A multi-channel digitizer chip for very-high-energy gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Bechtol, K.; Funk, S.; /Stanford U., HEPL /KIPAC, Menlo Park; Okumura, A.; /JAXA, Sagamihara /Stanford U., HEPL /KIPAC, Menlo Park; Ruckman, L.; /Hawaii U.; Simons, A.; Tajima, H.; Vandenbroucke, J.; /Stanford U., HEPL /KIPAC, Menlo Park; Varner, G.; /Hawaii U.

    2011-08-11

    The next-generation very-high-energy (VHE) gamma-ray observatory, the Cherenkov Telescope Array, will feature dozens of imaging atmospheric Cherenkov telescopes (IACTs), each with thousands of pixels of photosensors. To be affordable and reliable, reading out such a mega-channel array requires event recording technology that is highly integrated and modular, with a low cost per channel. We present the design and performance of a chip targeted to this application: the TeV Array Readout with GSa/s sampling and Event Trigger (TARGET). This application-specific integrated circuit (ASIC) has 16 parallel input channels, a 4096-sample buffer for each channel, adjustable input termination, self-trigger functionality, and tight window-selected readout. We report the performance of TARGET in terms of sampling frequency, power consumption, dynamic range, current-mode gain, analog bandwidth, and cross talk. The large number of channels per chip allows a low cost per channel ($10 to $20 including front-end and back-end electronics but not including photosensors) to be achieved with a TARGET-based IACT readout system. In addition to basic performance parameters of the TARGET chip itself, we present a camera module prototype as well as a second-generation chip (TARGET 2), both of which have been produced.

  15. Gamma-Ray Imaging Spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; Maccallum, C.J.; Stang, P.D.; Sandia Labs., Albuquerque, NM)

    1985-01-01

    High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload, a balloon program was initiated to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments

  16. NO CORRELATION BETWEEN HOST GALAXY METALLICITY AND GAMMA-RAY ENERGY RELEASE FOR LONG-DURATION GAMMA-RAY BURSTS

    International Nuclear Information System (INIS)

    Levesque, Emily M.; Kewley, Lisa J.; Soderberg, Alicia M.; Berger, Edo

    2010-01-01

    We compare the redshifts, host galaxy metallicities, and isotropic (E γ,iso ) and beaming-corrected (E γ ) gamma-ray energy release of 16 long-duration gamma-ray bursts (LGRBs) at z γ,iso , or E γ . These results are at odds with previous theoretical and observational predictions of an inverse correlation between gamma-ray energy release and host metallicity, as well as the standard predictions of metallicity-driven wind effects in stellar evolutionary models. We consider the implications that these results have for LGRB progenitor scenarios, and discuss our current understanding of the role that metallicity plays in the production of LGRBs.

  17. Gamma-Ray Instrument for Polarimetry, Spectroscopy and Imaging (GIPSI)

    National Research Council Canada - National Science Library

    Kroeger, R. A; Johnson, W. N; Kinzer, R. L; Kurfess, J. D; Inderhees, S. E; Phlips, B. F; Graham, B. L

    1996-01-01

    .... Gamma-ray polarimetry in the energy band around 60-300 keV is an interesting area of high energy astrophysics where observations have not been possible with the technologies employed in current and past space missions...

  18. AGIS -- the Advanced Gamma-ray Imaging System

    Science.gov (United States)

    Krennrich, Frank

    2009-05-01

    The Advanced Gamma-ray Imaging System, AGIS, is envisioned to become the follow-up mission of the current generation of very high energy gamma-ray telescopes, namely, H.E.S.S., MAGIC and VERITAS. These instruments have provided a glimpse of the TeV gamma-ray sky, showing more than 70 sources while their detailed studies constrain a wealth of physics and astrophysics. The particle acceleration, emission and absorption processes in these sources permit the study of extreme physical conditions found in galactic and extragalactic TeV sources. AGIS will dramatically improve the sensitivity and angular resolution of TeV gamma-ray observations and therefore provide unique prospects for particle physics, astrophysics and cosmology. This talk will provide an overview of the science drivers, scientific capabilities and the novel technical approaches that are pursued to maximize the performance of the large array concept of AGIS.

  19. Gamma-ray emission profile measurements during JET ICRH discharges

    Energy Technology Data Exchange (ETDEWEB)

    Jarvis, O N; Marcus, F B; Sadler, G; Van Belle, P [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Howarth, P J.A. [Birmingham Univ. (United Kingdom); Adams, J M; Bond, D S [UKAEA Harwell Lab. (United Kingdom). Energy Technology Div.

    1994-07-01

    Gamma-ray emission from plasma-impurity reactions caused by minority ICRH accelerating fuel ions to MeV energies has been measured using the JET neutron profile monitor. A successful data analysis technique has been used to isolate the RF-induced gamma-ray emission that was detected, enabling profiles of gamma-ray emission to be obtained. The 2-d gamma-ray emission profiles show that virtually all the radiation originates from the low field side of the RF resonance layer, as expected from RF-induced pitch angle diffusion. The emission profiles indicate the presence of a small population of resonant {sup 3}He ions that possess orbits lying near the passing-trapped boundary. 6 refs., 4 figs.

  20. Gamma-ray flares from the Crab Nebula.

    Science.gov (United States)

    Abdo, A A; Ackermann, M; Ajello, M; Allafort, A; Baldini, L; Ballet, J; Barbiellini, G; Bastieri, D; Bechtol, K; Bellazzini, R; Berenji, B; Blandford, R D; Bloom, E D; Bonamente, E; Borgland, A W; Bouvier, A; Brandt, T J; Bregeon, J; Brez, A; Brigida, M; Bruel, P; Buehler, R; Buson, S; Caliandro, G A; Cameron, R A; Cannon, A; Caraveo, P A; Casandjian, J M; Çelik, Ö; Charles, E; Chekhtman, A; Cheung, C C; Chiang, J; Ciprini, S; Claus, R; Cohen-Tanugi, J; Costamante, L; Cutini, S; D'Ammando, F; Dermer, C D; de Angelis, A; de Luca, A; de Palma, F; Digel, S W; do Couto e Silva, E; Drell, P S; Drlica-Wagner, A; Dubois, R; Dumora, D; Favuzzi, C; Fegan, S J; Ferrara, E C; Focke, W B; Fortin, P; Frailis, M; Fukazawa, Y; Funk, S; Fusco, P; Gargano, F; Gasparrini, D; Gehrels, N; Germani, S; Giglietto, N; Giordano, F; Giroletti, M; Glanzman, T; Godfrey, G; Grenier, I A; Grondin, M-H; Grove, J E; Guiriec, S; Hadasch, D; Hanabata, Y; Harding, A K; Hayashi, K; Hayashida, M; Hays, E; Horan, D; Itoh, R; Jóhannesson, G; Johnson, A S; Johnson, T J; Khangulyan, D; Kamae, T; Katagiri, H; Kataoka, J; Kerr, M; Knödlseder, J; Kuss, M; Lande, J; Latronico, L; Lee, S-H; Lemoine-Goumard, M; Longo, F; Loparco, F; Lubrano, P; Madejski, G M; Makeev, A; Marelli, M; Mazziotta, M N; McEnery, J E; Michelson, P F; Mitthumsiri, W; Mizuno, T; Moiseev, A A; Monte, C; Monzani, M E; Morselli, A; Moskalenko, I V; Murgia, S; Nakamori, T; Naumann-Godo, M; Nolan, P L; Norris, J P; Nuss, E; Ohsugi, T; Okumura, A; Omodei, N; Ormes, J F; Ozaki, M; Paneque, D; Parent, D; Pelassa, V; Pepe, M; Pesce-Rollins, M; Pierbattista, M; Piron, F; Porter, T A; Rainò, S; Rando, R; Ray, P S; Razzano, M; Reimer, A; Reimer, O; Reposeur, T; Ritz, S; Romani, R W; Sadrozinski, H F-W; Sanchez, D; Saz Parkinson, P M; Scargle, J D; Schalk, T L; Sgrò, C; Siskind, E J; Smith, P D; Spandre, G; Spinelli, P; Strickman, M S; Suson, D J; Takahashi, H; Takahashi, T; Tanaka, T; Thayer, J B; Thompson, D J; Tibaldo, L; Torres, D F; Tosti, G; Tramacere, A; Troja, E; Uchiyama, Y; Vandenbroucke, J; Vasileiou, V; Vianello, G; Vitale, V; Wang, P; Wood, K S; Yang, Z; Ziegler, M

    2011-02-11

    A young and energetic pulsar powers the well-known Crab Nebula. Here, we describe two separate gamma-ray (photon energy greater than 100 mega-electron volts) flares from this source detected by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. The first flare occurred in February 2009 and lasted approximately 16 days. The second flare was detected in September 2010 and lasted approximately 4 days. During these outbursts, the gamma-ray flux from the nebula increased by factors of four and six, respectively. The brevity of the flares implies that the gamma rays were emitted via synchrotron radiation from peta-electron-volt (10(15) electron volts) electrons in a region smaller than 1.4 × 10(-2) parsecs. These are the highest-energy particles that can be associated with a discrete astronomical source, and they pose challenges to particle acceleration theory.

  1. Some deficiencies and solutions in gamma ray spectrometry

    International Nuclear Information System (INIS)

    Westmeier, W.

    1998-01-01

    A number of problems in high-resolution gamma ray spectrometry as well as some deficiencies of existing computer programs for the quantitative evaluation of spectra are discussed and some practical solutions are proposed. (author)

  2. Multidimensional analysis of high resolution. gamma. -ray data

    Energy Technology Data Exchange (ETDEWEB)

    Flibotte, S.; Huettmeier, U.J.; France, G. de; Haas, B.; Romain, P.; Theisen, C.; Vivien, J.P.; Zen, J. (Centre de Recherches Nucleaires, 67 - Strasbourg (France)); Bednarczyk, P. (Inst. of Nuclear Physics, Krakow (Poland))

    1992-08-15

    Algorithms are developed to analyze high-fold {gamma}-ray coincidences. Performances of the programs have been tested in 3, 4 and 5 dimensions using events generated with a Monte Carlo simulation. (orig.).

  3. A new measurement-while-drilling gamma ray log calibrator

    International Nuclear Information System (INIS)

    Meisner, J.; Brooks, A.; Wisniewski, W.

    1985-01-01

    Many of the present methods of calibration for both wireline and MWD gamma ray detectors use a point source at a fixed distance from the detector. MWD calibration errors are introduced from scattering effects, from spectral differences, from position sensitivity and form lack of cylindrical geometry. A new method has been developed at Exploration Logging INc. (EXLOG) that eliminates these errors. The method uses a wrap-around or annular calibrator, referenced to the University of Houston gamma ray API pit. The new calibrator is designed to simulate the API pit's gamma ray emission spectrum with a finite amount of natural source material in the annular shape. Because of the thickness of steel between the MWD gamma ray detector and the formation, there is theoretical necessity for spectral matching. A simple theoretical approach was used to calibrate the new calibrator. Spectral matching allows a closer approximation to wireline logs and makes it possible to estimate the relative spectral content of a formation

  4. Saccharification of gamma-ray and alkali pretreated lignocellulosics

    International Nuclear Information System (INIS)

    Begum, A.; Choudhury, N.

    1988-01-01

    Enzymic saccharification of gamma ray and alkali pretreated sawdust, rice straw, and sugar cane bagasse showed higher release of reducing sugar from pretreated substrates. By gamma ray treatment alone (500 kGy) reducing sugar release of 2.8, 9.2, and 10 g/l was obtained from 7.5% (w/v) sawdust, rice straw, and bagasse and the same substrates showed reducing sugar release of 4.2, 30, and 20 g/l respectively when treated with alkali (0.1 g/g). Combination of gamma ray with alkali treatment further increased the reducing sugar release to 10.2, 33, and 36 g/l from sawdust, rice straw, and bagasse respectively. The effects of gamma ray and alkali treatment on saccharification varied with the nature of the substrate

  5. Gamma-ray dosimetry measurements of the Little Boy replica

    International Nuclear Information System (INIS)

    Plassmann, E.A.; Pederson, R.A.

    1984-01-01

    We present the current status of our gamma-ray dosimetry results for the Little Boy replica. Both Geiger-Mueller and thermoluminescent detectors were used in the measurements. Future work is needed to test assumptions made in data analysis

  6. Gamma-ray spectroscopy with relativistic exotic heavy-ions

    Indian Academy of Sciences (India)

    Abstract. Feasibility of gamma-ray spectroscopy at relativistic energies with exotic heavy-ions and new generation of germanium detectors (segmented Clover) is discussed. An experiment with such detector array and radioactive is discussed.

  7. Generation of laser Compton gamma-rays using Compact ERL

    International Nuclear Information System (INIS)

    Shizuma, Toshiyuki; Hajima, Ryoichi; Nagai, Ryoji; Hayakawa, Takehito; Mori, Michiaki; Seya, Michio

    2015-01-01

    Nondestructive isotope-specific assay system using nuclear resonance fluorescence has been developed at JAEA. In this system, intense, mono-energetic laser Compton scattering (LCS) gamma-rays are generated by combining an energy recovery linac (ERL) and laser enhancement cavity. As technical development for such an intense gamma-ray source, we demonstrated generation of LCS gamma-rays using Compact ERL (supported by the Ministry of Education, Culture, Sports, Science and Technology) developed in collaboration with KEK. We also measured X-ray fluorescence for elements near iron region by using mono-energetic LCS gamma-rays. In this presentation, we will show results of the experiment and future plan. (author)

  8. Secondary gamma-ray data for shielding calculation

    International Nuclear Information System (INIS)

    Miyasaka, Sunichi

    1979-01-01

    In deep penetration transport calculations, the integral design parameters is determined mainly by secondary particles which are produced by interactions of the primary radiation with materials. The shield thickness and the biological dose rate at a given point of a bulk shield are determined from the contribution from secondary gamma rays. The heat generation and the radiation damage in the structural and shield materials depend strongly on the secondary gamma rays. In this paper, the status of the secondary gamma ray data and its further problems are described from the viewpoint of shield design. The secondary gamma-ray data in ENDF/B-IV and POPOP4 are also discussed based on the test calculations made for several shield assemblies. (author)

  9. Public List of LAT-Detected Gamma-Ray Pulsars

    Data.gov (United States)

    National Aeronautics and Space Administration — The following is a compilation of all publicly-announced gamma-ray pulsars detected using the Fermi LAT. Each of the detections has been vetted by the LAT team,...

  10. High energy astrophysics with ground-based gamma ray detectors

    International Nuclear Information System (INIS)

    Aharonian, F; Buckley, J; Kifune, T; Sinnis, G

    2008-01-01

    Recent advances in ground-based gamma ray astronomy have led to the discovery of more than 70 sources of very high energy (E γ ≥ 100 GeV) gamma rays, falling into a number of source populations including pulsar wind nebulae, shell type supernova remnants, Wolf-Rayet stars, giant molecular clouds, binary systems, the Galactic Center, active galactic nuclei and 'dark' (yet unidentified) galactic objects. We summarize the history of TeV gamma ray astronomy up to the current status of the field including a description of experimental techniques and highlight recent astrophysical results. We also discuss the potential of ground-based gamma ray astronomy for future discoveries and describe possible directions for future instrumental developments

  11. Gamma-ray flares from the Crab nebula

    International Nuclear Information System (INIS)

    Abdo, A.A.; Ackermann, M.; Ajello, M.; Allafort, A.; Baldini, L.; Ballet, J.; Casandjian, J.M.; Grenier, I.A.; Naumann-Godo, M.; Pierbattista, M.; Tibaldo, L.

    2011-01-01

    A young and energetic pulsar powers the well-known Crab Nebula. Here, we describe two separate gamma-ray (photon energy greater than 100 mega-electron volts) flares from this source detected by the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. The first flare occurred in February 2009 and lasted approximately 16 days. The second flare was detected in September 2010 and lasted approximately 4 days. During these outbursts, the gamma-ray flux from the nebula increased by factors of four and six, respectively. The brevity of the flares implies that the gamma rays were emitted via synchrotron radiation from peta-electron-volt (10 15 electron volts) electrons in a region smaller than 1.4 * 10 -2 parsecs. These are the highest-energy particles that can be associated with a discrete astronomical source, and they pose challenges to particle acceleration theory. (authors)

  12. Gamma-ray astronomy and cosmic-ray origin theory

    International Nuclear Information System (INIS)

    Ginzburg, V.L.

    1973-01-01

    A theory of the origin of cosmic radiation is discussed in light of the advances made in gamma-ray astronomy. Arguments against metagalactic models for the origin of cosmic rays are emphasized. (U.S.)

  13. Upgrade of the JET gamma-ray cameras

    International Nuclear Information System (INIS)

    Soare, S.; Curuia, M.; Anghel, M.; Constantin, M.; David, E.; Craciunescu, T.; Falie, D.; Pantea, A.; Tiseanu, I.; Kiptily, V.; Prior, P.; Edlington, T.; Griph, S.; Krivchenkov, Y.; Loughlin, M.; Popovichev, S.; Riccardo, V; Syme, B.; Thompson, V.; Lengar, I.; Murari, A.; Bonheure, G.; Le Guern, F.

    2007-01-01

    Full text: The JET gamma-ray camera diagnostics have already provided valuable information on the gamma-ray imaging of fast ion in JET plasmas. The applicability of gamma-ray imaging to high performance deuterium and deuterium-tritium JET discharges is strongly dependent on the fulfilment of rather strict requirements for the characterisation of the neutron and gamma-ray radiation fields. These requirements have to be satisfied within very stringent boundary conditions for the design, such as the requirement of minimum impact on the co-existing neutron camera diagnostics. The JET Gamma-Ray Cameras (GRC) upgrade project deals with these issues with particular emphasis on the design of appropriate neutron/gamma-ray filters ('neutron attenuators'). Several design versions have been developed and evaluated for the JET GRC neutron attenuators at the conceptual design level. The main design parameter was the neutron attenuation factor. The two design solutions, that have been finally chosen and developed at the level of scheme design, consist of: a) one quasi-crescent shaped neutron attenuator (for the horizontal camera) and b) two quasi-trapezoid shaped neutron attenuators (for the vertical one). The second design solution has different attenuation lengths: a short version, to be used together with the horizontal attenuator for deuterium discharges, and a long version to be used for high performance deuterium and DT discharges. Various neutron-attenuating materials have been considered (lithium hydride with natural isotopic composition and 6 Li enriched, light and heavy water, polyethylene). Pure light water was finally chosen as the attenuating material for the JET gamma-ray cameras. The neutron attenuators will be steered in and out of the detector line-of-sight by means of an electro-pneumatic steering and control system. The MCNP code was used for neutron and gamma ray transport in order to evaluate the effect of the neutron attenuators on the neutron field of the

  14. The Advanced Gamma-ray Imaging System (AGIS): Simulation Studies

    Science.gov (United States)

    Fegan, Stephen; Buckley, J. H.; Bugaev, S.; Funk, S.; Konopelko, A.; Maier, G.; Vassiliev, V. V.; Simulation Studies Working Group; AGIS Collaboration

    2008-03-01

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation instrument in ground-based very high energy gamma-ray astronomy. It has the goal of achieving significant improvement in sensitivity over current experiments. We present the results of simulation studies of various possible designs for AGIS. The primary characteristics of the array performance, collecting area, angular resolution, background rejection, and sensitivity are discussed.

  15. The Advanced Gamma-ray Imaging System (AGIS): Simulation Studies

    OpenAIRE

    Maier, G.; Collaboration, for the AGIS

    2009-01-01

    The Advanced Gamma-ray Imaging System (AGIS) is a next-generation ground-based gamma-ray observatory being planned in the U.S. The anticipated sensitivity of AGIS is about one order of magnitude better than the sensitivity of current observatories, allowing it to measure gammaray emmission from a large number of Galactic and extra-galactic sources. We present here results of simulation studies of various possible designs for AGIS. The primary characteristics of the array performance - collect...

  16. Significant gamma-ray lines from dark matter annihilation

    Energy Technology Data Exchange (ETDEWEB)

    Duerr, Michael [DESY, Notkestrasse 85, 22607 Hamburg (Germany); Fileviez Perez, Pavel; Smirnov, Juri [Max-Planck-Institut fuer Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany)

    2016-07-01

    Gamma-ray lines from dark matter annihilation are commonly seen as a ''smoking gun'' for the particle nature of dark matter. However, in many dark matter models the continuum background from tree-level annihilations makes such a line invisible. I present two simple extensions of the Standard Model where the continuum contributions are suppressed and the gamma-ray lines are easily visible over the continuum background.

  17. Gamma-ray bursts: astrophysical puzzle of the century

    International Nuclear Information System (INIS)

    Hudec, R.

    1998-01-01

    An overview is given of the problems of gamma-ray bursts /GRB/. As GRB became one of the greatest mysteries in modern astrophysics, this field of astrophysics is a subject of intensive research. The article covers some topical aspects of experiments related to the indentification of gamma-ray bursts. The preparation and results of experiments in the Astronomical Institute of the Academy of Sciences of the Czech Republic are described. (Z.J.)

  18. Extragalactic Gamma Ray Excess from Coma Supercluster Direction

    Indian Academy of Sciences (India)

    More precise analysis of EGRET data however, makes it possible to estimate the diffuse gamma ray in Coma supercluster (i.e., Coma\\A1367 supercluster) direction with a value of ( > 30MeV) ≃ 1.9 × 10-6 cm-2 s-1, which is considered to be an upper limit for the diffuse gamma ray due to Coma supercluster. The related ...

  19. Population Studies of Radio and Gamma-Ray Pulsars

    Science.gov (United States)

    Harding, Alice K; Gonthier, Peter; Coltisor, Stefan

    2004-01-01

    Rotation-powered pulsars are one of the most promising candidates for at least some of the 40-50 EGRET unidentified gamma-ray sources that lie near the Galactic plane. Since the end of the EGRO mission, the more sensitive Parkes Multibeam radio survey has detected mere than two dozen new radio pulsars in or near unidentified EGRET sources, many of which are young and energetic. These results raise an important question about the nature of radio quiescence in gamma-ray pulsars: is the non-detection of radio emission a matter of beaming or of sensitivity? The answer is very dependent on the geometry of the radio and gamma-ray beams. We present results of a population synthesis of pulsars in the Galaxy, including for the first time the full geometry of the radio and gamma-ray beams. We use a recent empirically derived model of the radio emission and luminosity, and a gamma-ray emission geometry and luminosity derived theoretically from pair cascades in the polar slot gap. The simulation includes characteristics of eight radio surveys of the Princeton catalog plus the Parkes MB survey. Our results indicate that EGRET was capable of detecting several dozen pulsars as point sources, with the ratio of radio-loud to radio-quiet gamma-ray pulsars increasing significantly to about ten to one when the Parkes Survey is included. Polar cap models thus predict that many of the unidentified EGRET sources could be radio-loud gamma- ray pulsars, previously undetected as radio pulsars due to distance, large dispersion and lack of sensitivity. If true, this would make gamma-ray telescopes a potentially more sensitive tool for detecting distant young neutron stars in the Galactic plane.

  20. GLAST, the Gamma-ray Large Area Space Telescope

    CERN Document Server

    De Angelis, A

    2001-01-01

    GLAST, a detector for cosmic gamma rays in the range from 20 MeV to 300 GeV, will be launched in space in 2005. Breakthroughs are expected in particular in the study of particle acceleration mechanisms in space and of gamma ray bursts, and maybe on the search for cold dark matter; but of course the most exciting discoveries could come from the unexpected.

  1. Measuring The Variability Of Gamma-Ray Sources With AGILE

    International Nuclear Information System (INIS)

    Chen, Andrew W.; Vercellone, Stefano; Pellizzoni, Alberto; Tavani, Marco

    2005-01-01

    Variability in the gamma-ray flux above 100 MeV at various time scales is one of the primary characteristics of the sources detected by EGRET, both allowing the identification of individual sources and constraining the unidentified source classes. We present a detailed simulation of the capacity of AGILE to characterize the variability of gamma-ray sources, discussing the implications for source population studies

  2. Physics and astrophysics with gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)

    2012-08-15

    In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.

  3. The MAGIC gamma-ray telescope: status and first results

    International Nuclear Information System (INIS)

    Fernandez, Enrique

    2006-01-01

    MAGIC, a 17 m diameter Cherenkov telescope for gamma ray astronomy, has recently been commissioned at the Roque de los Muchachos site in the Island of La Palma, of the Canary Islands. The telescope was proposed in 1998 with the goal of lowering the threshold of observation of gamma rays by ground detectors to 20-30 GeV energies. This paper describes its main design features, its physics objectives and its first operations

  4. Catalogue of gamma rays from radionuclides ordered by nuclide

    International Nuclear Information System (INIS)

    Ekstroem, L.P.; Andersson, P.; Sheppard, H.M.

    1984-01-01

    A catalogue of about 28500 gamma-ray energies from 2338 radionuclides is presented. The nuclides are listed in order of increasing (A,Z) of the daughter nuclide. In addition the gamma-ray intensity per 100 decays of the parent (if known) and the decay half-life are given. All data are from a computer processing of a recent ENSDF (Evaluated Nuclear Structure Data File) file. (authors)

  5. Computers in activation analysis and gamma-ray spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, B. S.; D' Agostino, M. D.; Yule, H. P. [eds.

    1979-01-01

    Seventy-three papers are included under the following session headings: analytical and mathematical methods for data analysis; software systems for ..gamma..-ray and x-ray spectrometry; ..gamma..-ray spectra treatment, peak evaluation; least squares; IAEA intercomparison of methods for processing spectra; computer and calculator utilization in spectrometer systems; and applications in safeguards, fuel scanning, and environmental monitoring. Separate abstracts were prepared for 72 of those papers. (DLC)

  6. Gamma-Ray Imager With High Spatial And Spectral Resolution

    Science.gov (United States)

    Callas, John L.; Varnell, Larry S.; Wheaton, William A.; Mahoney, William A.

    1996-01-01

    Gamma-ray instrument developed to enable both two-dimensional imaging at relatively high spatial resolution and spectroscopy at fractional-photon-energy resolution of about 10 to the negative 3rd power in photon-energy range from 10 keV to greater than 10 MeV. In its spectroscopic aspect, instrument enables identification of both narrow and weak gamma-ray spectral peaks.

  7. Technical Aspect on Procedure of Gamma-Ray Pipeline Inspection

    International Nuclear Information System (INIS)

    Rasif Mohd Zain; Ainul Mardhiah Terry; Norman Shah Dahing

    2015-01-01

    The main problems happen in industrial pipelines are deposit build-up, blockage, corrosion and erosion. These effects will give a constraint in transporting refined products to process or production points and cause a major problem in production. One of the techniques to inspect the problem is using gamma-ray pipe scans. The principle of the technique is gamma-ray absorption technique. In this paper describes on the technical aspect to perform the pipe inspection in laboratory work. (author)

  8. A directional gamma-ray detector based on scintillator plates

    Energy Technology Data Exchange (ETDEWEB)

    Hanna, D., E-mail: hanna@physics.mcgill.ca; Sagnières, L.; Boyle, P.J.; MacLeod, A.M.L.

    2015-10-11

    A simple device for determining the azimuthal location of a source of gamma radiation, using ideas from astrophysical gamma-ray burst detection, is described. A compact and robust detector built from eight identical modules, each comprising a plate of CsI(Tl) scintillator coupled to a photomultiplier tube, can locate a point source of gamma rays with degree-scale precision by comparing the count rates in the different modules. Sensitivity to uniform environmental background is minimal.

  9. Gamma-ray effect on sweet potato

    International Nuclear Information System (INIS)

    Ferdes, O.; Ciofu, R.; Stroia, L.; Ghering, A.; Ferdes, M.

    1994-01-01

    The paper presents the results on modification occurred in biochemical properties of sweet potato (Ipomea batatus L.) after gamma irradiation. Two varieties, named Victoria Ianb (a white variety) and Portocaliu (a red variety), were selected and acclimatized for the agrometeorological conditions of Romania. The samples consist of roots from both usual and experimental crops. They were irradiated in batch, one week after harvesting, with a ICPR Co-60 gamma-ray source by approx. 370 TBq, dose range 100-500 Gy, dose rate 100±5 Gy/hour, dose uniformity ±5%, temperature 10 o C, 80±5% relative humidity (rh). The irradiation doses received were checked using the Fricke ferrous sulphate dosimeter procedure. The roots were kept two months at relative darkness, 6-11 o C, 60-75% rh and analyzed from time to time (initial, 5, 7, 14, 30 and 60 days). The following parameters are analyzed by conventional methods: total and reducing sugars (in De equivalent, %, on dry weight basis), starch content and the activities of sugar metabolizing enzymes. The red variety had a better behaviour towards irradiation that the white one. The sugar contents (both total and reducing), as well as starch, varied more in the white variety. The sugar metabolizing enzyme activities were influenced by both irradiation and storage conditions. Their activities were maximal at 200 and 300 Gy, and decreased significantly at higher doses. The activities also decreased in time, their variations being higher at lower doses (100 and 200 Gy). The results showed no significant influence of gamma irradiation on storage life. The modifications induced in sugar contents and enzyme activities had maximal effects at 200-300 Gy. (author)

  10. A study of gamma-ray bursts and a new detector for gamma-ray astronomy

    International Nuclear Information System (INIS)

    Carter, J.N.

    1979-09-01

    Three gamma-ray experiments flown on balloons between August 1975 and August 1976 are described in detail. The successful Transatlantic balloon flight enabled a rate of 3 bursts year -1 with energies > 7 x 10 -7 ergs cm -2 to be established. This result is discussed in the light of other work. The choice of γ-ray detector for optimum sensitivity is presented. In addition various techniques for determining the arrival direction of gamma-ray bursts are compared. A new balloon borne γ-ray burst telescope is proposed. The design, testing and results of the beam calibration of a new drift chamber detector system for high energy (> 50 MeV) γ-rays are presented. A projected angular resolution of 0.8 0 was obtained at 300 MeV. Techniques for the measurement of γ-ray energies are discussed in relation to this instrument. Finally the use of drift chambers in an integrated free flying satellite is illustrated, and the expected performance is presented. (author)

  11. The Fermi Gamma-ray Burst Monitor (GBM) Terrestrial Gamma-ray Flash (TGF) Catalog

    Science.gov (United States)

    Briggs, M. S.; Roberts, O.; Fitzpatrick, G.; Stanbro, M.; Cramer, E.; Mailyan, B. G.; McBreen, S.; Connaughton, V.; Grove, J. E.; Chekhtman, A.; Holzworth, R.

    2017-12-01

    The revised Second Fermi GBM TGF catalog includes data on 4144 TGFs detected by the Fermi Gamma-ray Burst Monitor through 2016 July 31. The catalog includes 686 bright TGFs there were detected in orbit and 4135 TGFs that were discovered by ground analysis of GBM data (the two samples overlap). Thirty of the events may have been detected as electrons and positrons rather than gamma-rays: Terrestrial Electron Beams (TEBs). We also provide results from correlating the GBM TGFs with VLF radio detections of the World Wide Lightning Location Network (WWLLN). TGFs with WWLLN associations have their localization uncertainties improved from 800 to 10 km, making it possible to identify specific thunderstorms responsible for the TGFs and opening up new types of scientific investigations. There are 1544 TGFs with WWLLN associations; maps are provided for these and the other TGFs of the catalog. The data tables of the catalog are available for use by the scientific community at the Fermi Science Support Center, at https://fermi.gsfc.nasa.gov/ssc/data/access/gbm/tgf/.

  12. LOCALIZATION OF GAMMA-RAY BURSTS USING THE FERMI GAMMA-RAY BURST MONITOR

    Energy Technology Data Exchange (ETDEWEB)

    Connaughton, V.; Briggs, M. S.; Burgess, J. M. [CSPAR and Physics Department, University of Alabama in Huntsville, 320 Sparkman Drive, Huntsville, AL 35899 (United States); Goldstein, A.; Wilson-Hodge, C. A. [Astrophysics Office, ZP12, NASA/Marshall Space Flight Center, Huntsville, AL 35812 (United States); Meegan, C. A.; Jenke, P.; Pelassa, V.; Xiong, S.; Bhat, P. N. [CSPAR, University of Alabama in Huntsville, 320 Sparkman Drive, Huntsville, AL 35899 (United States); Paciesas, W. S. [Universities Space Research Association, Huntsville, AL (United States); Preece, R. D. [Department of Space Science, University of Alabama in Huntsville, 320 Sparkman Drive, Huntsville, AL 35899 (United States); Gibby, M. H. [Jacobs Technology, Inc., Huntsville, AL (United States); Greiner, J.; Yu, H.-F. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Gruber, D. [Planetarium Südtirol, Gummer 5, I-39053 Karneid (Italy); Kippen, R. M. [Los Alamos National Laboratory, NM 87545 (United States); Byrne, D.; Fitzpatrick, G.; Foley, S., E-mail: valerie@nasa.gov [School of Physics, University College Dublin, Belfield, Stillorgan Road, Dublin 4 (Ireland); and others

    2015-02-01

    The Fermi Gamma-ray Burst Monitor (GBM) has detected over 1400 gamma-ray bursts (GRBs) since it began science operations in 2008 July. We use a subset of over 300 GRBs localized by instruments such as Swift, the Fermi Large Area Telescope, INTEGRAL, and MAXI, or through triangulations from the InterPlanetary Network, to analyze the accuracy of GBM GRB localizations. We find that the reported statistical uncertainties on GBM localizations, which can be as small as 1°, underestimate the distance of the GBM positions to the true GRB locations and we attribute this to systematic uncertainties. The distribution of systematic uncertainties is well represented (68% confidence level) by a 3.°7 Gaussian with a non-Gaussian tail that contains about 10% of GBM-detected GRBs and extends to approximately 14°. A more complex model suggests that there is a dependence of the systematic uncertainty on the position of the GRB in spacecraft coordinates, with GRBs in the quadrants on the Y axis better localized than those on the X axis.

  13. Modeling terrestrial gamma ray flashes produced by relativistic feedback discharges

    Science.gov (United States)

    Liu, Ningyu; Dwyer, Joseph R.

    2013-05-01

    This paper reports a modeling study of terrestrial gamma ray flashes (TGFs) produced by relativistic feedback discharges. Terrestrial gamma ray flashes are intense energetic radiation originating from the Earth's atmosphere that has been observed by spacecraft. They are produced by bremsstrahlung interactions of energetic electrons, known as runaway electrons, with air atoms. An efficient physical mechanism for producing large fluxes of the runaway electrons to make the TGFs is the relativistic feedback discharge, where seed runaway electrons are generated by positrons and X-rays, products of the discharge itself. Once the relativistic feedback discharge becomes self-sustaining, an exponentially increasing number of relativistic electron avalanches propagate through the same high-field region inside the thundercloud until the electric field is partially discharged by the ionization created by the discharge. The modeling results indicate that the durations of the TGF pulses produced by the relativistic feedback discharge vary from tens of microseconds to several milliseconds, encompassing all durations of the TGFs observed so far. In addition, when a sufficiently large potential difference is available in thunderclouds, a self-propagating discharge known as the relativistic feedback streamer can be formed, which propagates like a conventional positive streamer. For the relativistic feedback streamer, the positive feedback mechanism of runaway electron production by the positrons and X-rays plays a similar role as the photoionization for the conventional positive streamer. The simulation results of the relativistic feedback streamer show that a sequence of TGF pulses with varying durations can be produced by the streamer. The relativistic streamer may initially propagate with a pulsed manner and turn into a continuous propagation mode at a later stage. Milliseconds long TGF pulses can be produced by the feedback streamer during its continuous propagation. However

  14. Spatial distribution of reflected gamma rays by Monte Carlo simulation

    International Nuclear Information System (INIS)

    Jehouani, A.; Merzouki, A.; Boutadghart, F.; Ghassoun, J.

    2007-01-01

    In nuclear facilities, the reflection of gamma rays of the walls and metals constitutes an unknown origin of radiation. These reflected gamma rays must be estimated and determined. This study concerns reflected gamma rays on metal slabs. We evaluated the spatial distribution of the reflected gamma rays spectra by using the Monte Carlo method. An appropriate estimator for the double differential albedo is used to determine the energy spectra and the angular distribution of reflected gamma rays by slabs of iron and aluminium. We took into the account the principal interactions of gamma rays with matter: photoelectric, coherent scattering (Rayleigh), incoherent scattering (Compton) and pair creation. The Klein-Nishina differential cross section was used to select direction and energy of scattered photons after each Compton scattering. The obtained spectra show peaks at 0.511 * MeV for higher source energy. The Results are in good agreement with those obtained by the TRIPOLI code [J.C. Nimal et al., TRIPOLI02: Programme de Monte Carlo Polycinsetique a Trois dimensions, CEA Rapport, Commissariat a l'Energie Atomique.

  15. Self-powered neutron and gamma-ray flux detector

    International Nuclear Information System (INIS)

    Allan, C.J.; Shields, R.B.; Lynch, G.F.; Cuttler, J.M.

    1980-01-01

    A new type of self-powered neutron detector was developed which is sensitive to both the neutron and gamma-ray fluxes. The emitter comprises two parts. The central emitter core is made of materials that generate high-energy electrons on exposure to neutrons. The outer layer acts as a gamma-ray/electron converter, and since it has a higher atomic number and higher back-scattering coefficient than the collector, increases the net outflow or emmission of electrons. The collector, which is around the emitter outer layer, is insulated from the outer layer electrically with dielectric insulation formed from compressed metal-oxide powder. The fraction of electrons given off by the emitter that is reflected back by the collector is less than the fraction of electrons emitted by the collector that is reflected back by the emitter. The thickness of the outer layer needed to achieve this result is very small. A detector of this design responds to external reactor gamma-rays as well as to neutron capture gamma-rays from the collector. The emitter core is either nickel, iron or titanium, or alloys based on these metals. The outer layer is made of platinum, tantalum, osmium, molybdenum or cerium. The detector is particularly useful for monitoring neutron and gamma ray flux intensities in nuclear reactor cores in which the neutron and gamma ray flux intensities are closely proportional, are unltimately related to the fission rate, and are used as measurements of nuclear reactor power. (DN)

  16. A study on gamma rays from electrochemical cells

    International Nuclear Information System (INIS)

    Shin, Seung Ai

    1993-01-01

    The energies and intensities of gamma rays emitted from 3 cells with Pd-cathodes of φ 1mm x 10mm, φ 2mm x 20mm, φ 1mm x 10mm were determined using HPGe-detector system and compared with Pd-neutron capture model. Very strong gamma rays of 512keC, 622keC, 1051keC and 8 more important ones were found to be identical with characteristic gamma rays of 106 Pd and 109 Pd. It is likely that the neutron capture reaction, A PD(n, γ) A+1 Pd, occurred in the cell and the neutrons came from the fusion reaction of two deutrons. It is necessary, however, to retest the model since another strong 84keV-gamma rays do not belong to any A+1 Pd-gamma spectra and two important 106 Pd-gamma rays 717keV, 1046KeV were not detected. Total amount of emitted gamma rays was large when the size of the Pd-cathod was large. Its depedence on the time of measurement and the preheating period did not have any regularities. Thus the replication is not an easy thing. (Author)

  17. Gamma-ray emission profile measurements during JET ICRH discharges

    Energy Technology Data Exchange (ETDEWEB)

    Howarth, P.J.A. [Birmingham Univ. (United Kingdom); Adams, J.M.; Bond, D.S.; Watkins, N. [AEA Technology, Harwell (United Kingdom); Jarvis, O.N.; Marcus, F.B.; Sadler, G.; Belle, P. van [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking

    1994-12-31

    Ion Cyclotron Resonant Heating (ICRH) that is tuned to minority fuel ions can induce an energy diffusion of the heated species and create high energy tail temperatures of {approx} 1 MeV. The most energetic of these accelerated minority ions can undergo nuclear reactions with impurity Be and C that produces {gamma}-ray emission from the decay of the excited product nuclei. This RF-induced {gamma}-ray emission has been recorded using the JET neutron emission profile diagnostic which is capable of distinguishing neutrons and {gamma}-rays. Appropriate data processing has enabled the RF-induced {gamma}-ray emission signals to be isolated from the {gamma}-ray emission signals associated with neutron interactions in the material surrounding the profile monitor. The 2-d {gamma}-ray emission profiles show that virtually all the radiation originates from the low field side of the RF resonance layer, as expected from RF-induced pitch angle diffusion. The emission profiles indicate the presence of a small population of resonant {sup 3}He ions that possess orbits lying near the passing-trapped boundary. (author) 6 refs., 4 figs.

  18. Constraints on Cosmic Rays, Magnetic Fields, and Dark Matter from Gamma-ray Observations of the Coma Cluster of Galaxies with VERITAS and FERMI

    Science.gov (United States)

    Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cannon, A.; Cesarini, A.; hide

    2012-01-01

    Observations of radio halos and relics in galaxy clusters indicate efficient electron acceleration. Protons should likewise be accelerated and, on account of weak energy losses, can accumulate, suggesting that clusters may also be sources of very high energy (VHE; E greater than100 GeV) gamma-ray emission. We report here on VHE gamma-ray observations of the Coma galaxy cluster with the VERITAS array of imaging Cerenkov telescopes, with complementing Fermi Large Area Telescope observations at GeV energies. No significant gamma-ray emission from the Coma Cluster was detected. Integral flux upper limits at the 99 confidence level were measured to be on the order of (2-5) x 10(sup -8) photons m(sup -2) s(sup -1) (VERITAS,greater than 220 GeV) and approximately 2 x 10(sup -6) photons m(sup -2) s(sup -1) (Fermi, 1-3 GeV), respectively. We use the gamma-ray upper limits to constrain cosmic rays (CRs) and magnetic fields in Coma. Using an analytical approach, the CR-to-thermal pressure ratio is constrained to be less than 16% from VERITAS data and less than 1.7% from Fermi data (averaged within the virial radius). These upper limits are starting to constrain the CR physics in self-consistent cosmological cluster simulations and cap the maximum CR acceleration efficiency at structure formation shocks to be 50. Alternatively, this may argue for non-negligible CR transport processes such as CR streaming and diffusion into the outer cluster regions. Assuming that the radio-emitting electrons of the Coma halo result from hadronic CR interactions, the observations imply a lower limit on the central magnetic field in Coma of approximately (2-5.5)microG, depending on the radial magnetic field profile and on the gamma-ray spectral index. Since these values are below those inferred by Faraday rotation measurements in Coma (for most of the parameter space), this renders the hadronic model a very plausible explanation of the Coma radio halo. Finally, since galaxy clusters are dark

  19. A relativistic type Ibc supernova without a detected gamma-ray burst.

    Science.gov (United States)

    Soderberg, A M; Chakraborti, S; Pignata, G; Chevalier, R A; Chandra, P; Ray, A; Wieringa, M H; Copete, A; Chaplin, V; Connaughton, V; Barthelmy, S D; Bietenholz, M F; Chugai, N; Stritzinger, M D; Hamuy, M; Fransson, C; Fox, O; Levesque, E M; Grindlay, J E; Challis, P; Foley, R J; Kirshner, R P; Milne, P A; Torres, M A P

    2010-01-28

    Long duration gamma-ray bursts (GRBs) mark the explosive death of some massive stars and are a rare sub-class of type Ibc supernovae. They are distinguished by the production of an energetic and collimated relativistic outflow powered by a central engine (an accreting black hole or neutron star). Observationally, this outflow is manifested in the pulse of gamma-rays and a long-lived radio afterglow. Until now, central-engine-driven supernovae have been discovered exclusively through their gamma-ray emission, yet it is expected that a larger population goes undetected because of limited satellite sensitivity or beaming of the collimated emission away from our line of sight. In this framework, the recovery of undetected GRBs may be possible through radio searches for type Ibc supernovae with relativistic outflows. Here we report the discovery of luminous radio emission from the seemingly ordinary type Ibc SN 2009bb, which requires a substantial relativistic outflow powered by a central engine. A comparison with our radio survey of type Ibc supernovae reveals that the fraction harbouring central engines is low, about one per cent, measured independently from, but consistent with, the inferred rate of nearby GRBs. Independently, a second mildly relativistic supernova has been reported.

  20. A library least-squares approach for scatter correction in gamma-ray tomography

    International Nuclear Information System (INIS)

    Meric, Ilker; Anton Johansen, Geir; Valgueiro Malta Moreira, Icaro

    2015-01-01

    Scattered radiation is known to lead to distortion in reconstructed images in Computed Tomography (CT). The effects of scattered radiation are especially more pronounced in non-scanning, multiple source systems which are preferred for flow imaging where the instantaneous density distribution of the flow components is of interest. In this work, a new method based on a library least-squares (LLS) approach is proposed as a means of estimating the scatter contribution and correcting for this. The validity of the proposed method is tested using the 85-channel industrial gamma-ray tomograph previously developed at the University of Bergen (UoB). The results presented here confirm that the LLS approach can effectively estimate the amounts of transmission and scatter components in any given detector in the UoB gamma-ray tomography system. - Highlights: • A LLS approach is proposed for scatter correction in gamma-ray tomography. • The validity of the LLS approach is tested through experiments. • Gain shift and pulse pile-up affect the accuracy of the LLS approach. • The LLS approach successfully estimates scatter profiles

  1. Development of portable gamma ray tomography for imaging corrosion under insulation

    International Nuclear Information System (INIS)

    Rasif Mohd Zain; Roslan Yahya

    2009-01-01

    Corrosion under insulation (CUI) on the external wall of steel pipes is a common problem in many types of industrial plants. This is mainly due to the presence of moisture or water in the insulation materials. This type of corrosion can cause failures in areas that are normally of a primary concern to an inspection program. The failures are often the result of localized corrosion and not general wasting over large area. These failures can tee catastrophic in nature at least have an adverse economic effect in terms of downtime and repairs. There are number of techniques used today for CUI investigations. The main ones are profile radiography, pulse eddy current (PEC), ultrasonic spot readings and insulation removal. A new system that has been developed is gamma-ray computer tomography. The system is based on parallel-beam gamma ray absorption technique using NaI(Tl) 1 ' x 1 ' scintillation detectors. This paper describes the development of gamma ray tomography system. (author)

  2. Gamma-ray spectroscopy of neutron-rich products of heavy-ion collisions

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Janssens, R.V.F.; Ahmad, I. [and others

    1995-08-01

    Thick-target {gamma}{gamma} coincidence techniques are being used to explore the spectroscopy of otherwise hard-to-reach neutron-rich products of deep-inelastic heavy ion reactions. Extensive {gamma}{gamma} coincidence measurements were performed at ATLAS using pulsed beams of {sup 80}Se, {sup 136}Xe, and {sup 238}U on lead-backed {sup 122,124}Sn targets with energies 10-15% above the Coulomb barrier. Gamma-ray coincidence intensities were used to map out yield distributions with A and Z for even-even product nuclei around the target and around the projectile. The main features of the yield patterns are understandable in terms of N/Z equilibration. We had the most success in studying the decays of yrast isomers. Thus far, more than thirty new {mu}s isomers in the Z = 50 region were found and characterized. Making isotopic assignments for previously unknown {gamma}-ray cascades proves to be one of the biggest problems. Our assignments were based (a) on rare overlaps with radioactivity data, (b) on the relative yields with different beams, and (c) on observed cross-coincidences between {gamma} rays from light and heavy reaction partners. However, the primary products of deep inelastic collisions often are sufficiently excited for subsequent neutron evaporation, so {gamma}{gamma} cross-coincidence results require careful interpretation.

  3. Plastic Scintillator Based Detector for Observations of Terrestrial Gamma-ray Flashes.

    Science.gov (United States)

    Barghi, M. R., Sr.; Delaney, N.; Forouzani, A.; Wells, E.; Parab, A.; Smith, D.; Martinez, F.; Bowers, G. S.; Sample, J.

    2017-12-01

    We present an overview of the concept and design of the Light and Fast TGF Recorder (LAFTR), a balloon borne gamma-ray detector designed to observe Terrestrial Gamma-Ray Flashes (TGFs). Terrestrial Gamma-Ray Flashes (TGFs) are extremely bright, sub-millisecond bursts of gamma-rays observed to originate inside thunderclouds coincident with lightning. LAFTR is joint institutional project built by undergraduates at the University of California Santa Cruz and Montana State University. It consists of a detector system fed into analog front-end electronics and digital processing. The presentation focuses specifically on the UCSC components, which consists of the detector system and analog front-end electronics. Because of the extremely high count rates observed during TGFs, speed is essential for both the detector and electronics of the instrument. The detector employs a fast plastic scintillator (BC-408) read out by a SensL Silicon Photomultiplier (SiPM). BC-408 is chosen for its speed ( 4 ns decay time) and low cost and availability. Furthermore, GEANT3 simulations confirm the scintillator is sensitive to 500 counts at 7 km horizontal distance from the TGF source (for a 13 km source altitude and 26 km balloon altitude) and to 5 counts out to 20 km. The signal from the SiPM has a long exponential decay tail and is sent to a custom shaping circuit board that amplifies and shapes the signal into a semi-Gaussian pulse with a 40 ns FWHM. The signal is then input to a 6-channel discriminator board that clamps the signal and outputs a Low Voltage Differential Signal (LVDS) for processing by the digital electronics.

  4. Gamma-ray emission from internal shocks in novae

    Science.gov (United States)

    Martin, P.; Dubus, G.; Jean, P.; Tatischeff, V.; Dosne, C.

    2018-04-01

    Context. Gamma-ray emission at energies ≥100 MeV has been detected from nine novae using the Fermi Large Area Telescope (LAT), and can be explained by particle acceleration at shocks in these systems. Eight out of these nine objects are classical novae in which interaction of the ejecta with a tenuous circumbinary material is not expected to generate detectable gamma-ray emission. Aim. We examine whether particle acceleration at internal shocks can account for the gamma-ray emission from these novae. The shocks result from the interaction of a fast wind radiatively-driven by nuclear burning on the white dwarf with material ejected in the initial runaway stage of the nova outburst. Methods: We present a one-dimensional model for the dynamics of a forward and reverse shock system in a nova ejecta, and for the associated time-dependent particle acceleration and high-energy gamma-ray emission. Non-thermal proton and electron spectra are calculated by solving a time-dependent transport equation for particle injection, acceleration, losses, and escape from the shock region. The predicted emission is compared to LAT observations of V407 Cyg, V1324 Sco, V959 Mon, V339 Del, V1369 Cen, and V5668 Sgr. Results: The ≥100 MeV gamma-ray emission arises predominantly from particles accelerated up to 100 GeV at the reverse shock and undergoing hadronic interactions in the dense cooling layer downstream of the shock. The emission rises within days after the onset of the wind, quickly reaches a maximum, and its subsequent decrease reflects mostly the time evolution of the wind properties. Comparison to gamma-ray data points to a typical scenario where an ejecta of mass 10-5-10-4 M⊙ expands in a homologous way with a maximum velocity of 1000-2000 km s-1, followed within a day by a wind with a velocity values of which result in the majority of best-fit models having gamma-ray spectra with a high-energy turnover below 10 GeV. Our typical model is able to account for the main

  5. NEW FERMI-LAT EVENT RECONSTRUCTION REVEALS MORE HIGH-ENERGY GAMMA RAYS FROM GAMMA-RAY BURSTS

    Energy Technology Data Exchange (ETDEWEB)

    Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Baldini, L. [Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bregeon, J.; Pesce-Rollins, M.; Sgro, C.; Tinivella, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bruel, P. [Laboratoire Leprince-Ringuet, Ecole polytechnique, CNRS/IN2P3, Palaiseau (France); Chekhtman, A. [Center for Earth Observing and Space Research, College of Science, George Mason University, Fairfax, VA 22030 (United States); Cohen-Tanugi, J. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, F-34095 Montpellier (France); Drlica-Wagner, A.; Omodei, N.; Rochester, L. S.; Usher, T. L. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Granot, J. [Department of Natural Sciences, The Open University of Israel, 1 University Road, P.O. Box 808, Ra' anana 43537 (Israel); Longo, F. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Razzaque, S. [Department of Physics, University of Johannesburg, Auckland Park 2006 (South Africa); Zimmer, S., E-mail: melissa.pesce.rollins@pi.infn.it, E-mail: nicola.omodei@stanford.edu, E-mail: granot@openu.ac.il [Department of Physics, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden)

    2013-09-01

    Based on the experience gained during the four and a half years of the mission, the Fermi-LAT Collaboration has undertaken a comprehensive revision of the event-level analysis going under the name of Pass 8. Although it is not yet finalized, we can test the improvements in the new event reconstruction with the special case of the prompt phase of bright gamma-ray bursts (GRBs), where the signal-to-noise ratio is large enough that loose selection cuts are sufficient to identify gamma rays associated with the source. Using the new event reconstruction, we have re-analyzed 10 GRBs previously detected by the Large Area Telescope (LAT) for which an X-ray/optical follow-up was possible and found four new gamma rays with energies greater than 10 GeV in addition to the seven previously known. Among these four is a 27.4 GeV gamma ray from GRB 080916C, which has a redshift of 4.35, thus making it the gamma ray with the highest intrinsic energy ({approx}147 GeV) detected from a GRB. We present here the salient aspects of the new event reconstruction and discuss the scientific implications of these new high-energy gamma rays, such as constraining extragalactic background light models, Lorentz invariance violation tests, the prompt emission mechanism, and the bulk Lorentz factor of the emitting region.

  6. Gamma rays application in veterinary immunology

    International Nuclear Information System (INIS)

    Bulkhanov, R.U.; Butaev, M.K.; Mirzaev, B.Sh.; Ryasnyanskiy, I.V.; Yuldashev, R.Yu.

    2005-01-01

    Full text: The process based on stimulated action of ionized radiation, change of quality of agricultural goods and row materials, biocides including bactericide action of ionized radiation are among the methods of radiation biotechnology, which can be applied in agriculture. We used the bactericide action of ionized radiation in technological process for creation of fundamentally new preparation possessed by by immunogenic properties and named as 'radio vaccine'. This term is well known and frequently used in scientific papers in the field of applied radiobiology. It is well known that physical (thermal) and chemical actions are used for preparation of vaccine for veterinary. It was noted that this process resulted in destruction of antigenic structure of bacteria cells, with are responsible for immunity creation. The possibility of virulence reduction at constant immunogenic properties of microorganism and keeping its antigenic structure can be achieved by using ionized radiation as one of the factor, which influences on bacteria. Taking into account the necessity of vaccine improvement and increase of quantity of associated vaccine one of the most important problems of veterinary science and particle is creation of vaccines of new generation which are characterized by the ability to form immunity against several diseases of agricultural animals. As a result of many-years investigations using gamma rays radiations in UzSRIV (laboratory of radiobiology) the radiation biotechnology of vaccine preparation was developed. These vaccines are necessary for practical application. Radiation biotechnology allows to prepare high-effective mono-, associated and polyvalent radio vaccines against widespread infection diseases of agricultural animals especially cubs (calves, lambs, young pigs). On the basis of developed radiation biotechnology there were prepared the following vaccines: 'Associated radio vaccine against colibacteriosis and salmonellosis of small horned cattle

  7. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  8. Effect of /sup 60/Co. gamma. -rays on polyphenyl methacrylate obtained by. gamma. -ray irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Raghunath, S.; Rao, M.H.; Rao, K.N. (Bhabha Atomic Research Centre, Bombay (India). Chemistry Div.)

    1983-01-01

    Polyphenyl methacrylate of different molecular weights Msub(n) 13000, 34500 and crosslinked polymer prepared by /sup 60/Co ..gamma..-irradiation has been irradiated with /sup 60/Co ..gamma..-rays at 300 K. G(scission) of the 13000 molecular weight polymer was 15. The crosslinked polymer undergoes both degradation and crosslinking. G(x) value determined for that polymer is approx. 9. The gaseous product consists largely of CO with some CO/sub 2/ and H/sub 2/. Hydrocarbon gases were not detected. The yield of H/sub 2/ is only to the extent of 2 to 5% of the total gas and it is assumed that majority of scission takes place at the ester linkage. On the basis of the estimation of phenol and benzene, a mechanism for degradation and crosslinking is proposed.

  9. An Event Observed as a Terrestrial Gamma-ray Flash (TGF) and a Terrestrial Electron Beam (TEB) by Fermi GBM

    Science.gov (United States)

    Stanbro, M.; Briggs, M. S.; Cramer, E.; Dwyer, J. R.; Roberts, O.

    2017-12-01

    Terrestrial Gamma-ray Flashes (TGFs) are sub-ms, intense flashes of gamma-rays. They are due to the acceleration of electrons with relativistic energies in thunderstorms that emit gamma-rays via bremsstrahlung. When these photons reach the upper atmosphere, they can produce secondary electrons and positrons that escape the atmosphere and propagate along the Earth's magnetic field line. Space instruments can detect these charged particles, known as Terrestrial Electron Beams (TEBs), after traveling thousands of kilometers from the thunderstorm. We present an event that was observed by the Fermi Gamma-ray Burst Monitor (GBM) as both a TGF and a TEB. To our knowledge this is the first such event that has ever been observed. We interpret the first pulse as a TGF with a duration of 0.2 ms. After 0.5 ms a second pulse is seen with a duration of 2 ms that we interpret as a TEB. Confirming this interpretation, a third pulse is seen 90 ms later, which is understood as a TEB magnetic mirror pulse. The World Wide Lightning Location Network (WWLLN) and the Earth Networks Total Lightning Network (ENTLN) detected a sferic, under the spacecraft footprint and within the southern magnetic footprint that is simultaneous with the first pulse. Along with the sferic, this unique observation allows us for the first time to test TGF and TEB models for the same event. We present Monte Carlo simulations of the first two pulses, including pitch angles for electrons and positrons, to see if the models can consistently describe the TGF/TEB spectra and time profiles originating from the same source.

  10. The measurement of gamma ray induced heating in a mixed neutron and gamma ray environment

    International Nuclear Information System (INIS)

    Chiu, H.K.

    1991-10-01

    The problem of measuring the gamma heating in a mixed DT neutron and gamma ray environment was explored. A new detector technique was developed to make this measurement. Gamma heating measurements were made in a low-Z assembly irradiated with 14-Mev neutrons and (n, n') gammas produced by a Texas Nuclear Model 9400 neutron generator. Heating measurements were made in the mid-line of the lattice using a proportional counter operating in the Continuously-varied Bias-voltage Acquisition mode. The neutron-induced signal was separated from the gamma-induced signal by exploiting the signal rise-time differences inherent to radiations of different linear energy transfer coefficient, which are observable in a proportional counter. The operating limits of this measurement technique were explored by varying the counter position in the low-Z lattice, hence changing the irradiation spectrum observed. The experiment was modelled numerically to help interpret the measured results. The transport of neutrons and gamma rays in the assembly was modelled using the one- dimensional radiation transport code ANISN/PC. The cross-section set used for these calculations was derived from the ENDF/B-V library using the code MC 2 -2 for the case of DT neutrons slowing down in a low-Z material. The calculated neutron and gamma spectra in the slab and the relevant mass-stopping powers were used to construct weighting factors which relate the energy deposition in the counter fill-gas to that in the counter wall and in the surrounding material. The gamma energy deposition at various positions in the lattice is estimated by applying these weighting factors to the measured gamma energy deposition in the counter at those locations

  11. A One-Dimensional Relativistic Shock Model for the Light Curve of Gamma-ray Bursts

    Institute of Scientific and Technical Information of China (English)

    Cheng-Yue Su; Yi-Ping Qin; Jun-Hui Fan; Zhang-Yu Han

    2006-01-01

    We investigate the forming of gamma-ray burst pulses with a simple onedimensional relativistic shock model. The mechanism is that a "central engine" drives forward the nearby plasma inside the fireball to generate a series of pressure waves. We give a relativistic geometric recurrence formula that connects the time when the pressure waves are produced and the time when the corresponding shocks occurred. This relation enables us to relate the pulse magnitude with the observation time. Our analysis shows that the evolution of the pressure waves leads to a fast rise and an exponential decay pulses. In determining the width of the pulses, the acceleration time is more important than that of the deceleration.

  12. THE ORIGIN OF GAMMA RAYS FROM GLOBULAR CLUSTERS

    International Nuclear Information System (INIS)

    Cheng, K. S.; Chernyshov, D. O.; Dogiel, V. A.; Hui, C. Y.; Kong, A. K. H.

    2010-01-01

    Fermi has detected gamma-ray emission from eight globular clusters (GCs). It is commonly believed that the energy sources of these gamma rays are millisecond pulsars (MSPs) inside GCs. Also it has been standard to explain the spectra of most Fermi Large Area Telescope pulsars including MSPs resulting from the curvature radiation (CR) of relativistic electrons/positrons inside the pulsar magnetosphere. Therefore, gamma rays from GCs are expected to be the collection of CR from all MSPs inside the clusters. However, the angular resolution is not high enough to pinpoint the nature of the emission. In this paper, we calculate the gamma rays produced by the inverse Compton (IC) scattering between relativistic electrons/positrons in the pulsar wind of MSPs in the GCs and background soft photons including cosmic microwave/relic photons, background star lights in the clusters, the galactic infrared photons, and the galactic star lights. We show that the gamma-ray spectrum from 47 Tucanae can be explained equally well by upward scattering of either the relic photons, the galactic infrared photons, or the galactic star lights, whereas the gamma-ray spectra from the other seven GCs are best fitted by the upward scattering of either the galactic infrared photons or the galactic star lights. We also find that the observed gamma-ray luminosity is correlated better with the combined factor of the encounter rate and the background soft photon energy density. Therefore, the IC scattering may also contribute to the observed gamma-ray emission from GCs detected by Fermi in addition to the standard CR process. Furthermore, we find that the emission region of high-energy photons from GCs produced by the IC scattering is substantially larger than the cores of GCs with a radius >10 pc. The diffuse radio and X-rays emitted from GCs can also be produced by the synchrotron radiation and IC scattering, respectively. We suggest that future observations including radio, X-rays, and gamma rays

  13. Continued Development of a Soft Gamma-Ray Concentrator

    Science.gov (United States)

    Bloser, Peter

    We propose to continue our development of a concept for a soft gamma-ray (E > 100 keV) concentrator using thin-film multilayer structures. Alternating layers of low- and high-density materials will channel soft gamma-ray photons via total external reflection. A suitable arrangement of bent structures will then concentrate the incident radiation to a point. Gamma-ray optics made in this way offer the potential for soft gamma-ray telescopes with focal lengths of less than 10 m, removing the need for formation flying spacecraft and opening the field up to balloon-borne instruments. Under previous APRA funding we have been investigating methods for efficiently producing such multilayer structures and modeling their performance. We now propose to pursue magnetron sputtering (MS) techniques to quickly produce structures with the required smoothness and thickness, to measure their channeling efficiency and compare with calculations, and to design a "lens" with optimized bandpass and throughput and predict its scientific performance. If successful, this work will confirm that this innovative optics concept is suitable for a balloon-born soft gamma-ray telescope with unprecedented sensitivity.

  14. TL detectors for gamma ray dose measurements in criticality accidents

    International Nuclear Information System (INIS)

    Miljanic, S.; Zorko, B.; Gregori, B.; Knezevic, Z.

    2007-01-01

    Determination of gamma ray dose in mixed neutron + gamma ray fields is still a demanding task. Dosemeters used for gamma ray dosimetry are usually in some extent sensitive to neutrons and their response variations depend on neutron energy i.e., on neutron spectra. Besides, it is necessary to take into account the energy dependence of dosemeter responses to gamma rays. In this work, several types of thermoluminescent detectors (TLD) placed in different holders used for gamma ray dose determination in the mixed fields were examined. Dosemeters were from three different institutions: Ruder Boskovic Inst. (RBI), Croatia, Jozef Stefan Inst. (JSI), Slovenia and Autoridad Regulatoria Nuclear (ARN), Argentina. All dosemeters were irradiated during the International Intercomparison of Criticality Accident Dosimetry Systems at the SILENE Reactor, Valduc, June 2002. Three accidental scenarios were reproduced and in each irradiation the dosemeters were exposed placed on the front of phantom and 'free in air'. Following types of TLDs were used: 7 LiF (TLD-700), CaF 2 :Mn and Al2 O3 :Mg,Y - all from RBI; CaF 2 :Mn from JSI and 7 LiF (TLD-700) from ARN. Reported doses were compared with the reference values as well as with the values obtained from the results of all participants. The results show satisfactory agreement with other dosimetry systems used in the Intercomparison. The influence of different types of holders and applied corrections of dosemeters' readings are discussed. (authors)

  15. TL detectors for gamma ray dose measurements in criticality accidents.

    Science.gov (United States)

    Miljanić, Saveta; Zorko, Benjamin; Gregori, Beatriz; Knezević, Zeljka

    2007-01-01

    Determination of gamma ray dose in mixed neutron+gamma ray fields is still a demanding task. Dosemeters used for gamma ray dosimetry are usually in some extent sensitive to neutrons and their response variations depend on neutron energy i.e., on neutron spectra. Besides, it is necessary to take into account the energy dependence of dosemeter responses to gamma rays. In this work, several types of thermoluminescent detectors (TLD) placed in different holders used for gamma ray dose determination in the mixed fields were examined. Dosemeters were from three different institutions: Ruder Bosković Institute (RBI), Croatia, JoZef Stefan Institute (JSI), Slovenia and Autoridad Regulatoria Nuclear (ARN), Argentina. All dosemeters were irradiated during the International Intercomparison of Criticality Accident Dosimetry Systems at the SILENE Reactor, Valduc, June 2002. Three accidental scenarios were reproduced and in each irradiation the dosemeters were exposed placed on the front of phantom and 'free in air'. Following types of TLDs were used: 7LiF (TLD-700), CaF2:Mn and Al2O3:Mg,Y-all from RBI; CaF2:Mn from JSI and 7LiF (TLD-700) from ARN. Reported doses were compared with the reference values as well as with the values obtained from the results of all participants. The results show satisfactory agreement with other dosimetry systems used in the Intercomparison. The influence of different types of holders and applied corrections of dosemeters' readings are discussed.

  16. Timing of gamma rays in coaxial germanium detector systems

    International Nuclear Information System (INIS)

    El-Ibiary, M.Y.

    1979-01-01

    A study is reported on the timing uncertainty in gamma ray coaxial germanium detector systems. The work deals with the zero cross over method which is widely used to reduce the dependence of the instant of timing on the radiation energy absorbed and on the position within the detector at which absorption takes place. It is found that the amplitude risetime compensated (ARC) method gives, under normal conditions, the best resolution at a specific energy. For higher energies, the resolution improves and there is no shift of the mean instant of timing. The method is therefore well suited for wide energy coverage. The parameters involved in implementing an ARC system for optimum performance at a specific energy are identified in terms of the preamplifier noise level and risetime. A trade off can be made between the resolutions at high and at low energies. The time resolution attained is given by means of a series of charts which use normalized dimensionless variables for ready application to any given case. Lithium compensated Ge detectors which normally operate under conditions of velocity saturation of the charge carriers by applying sufficient bias voltage create an electric field in excess of 1 kV/cm throughout the depleted region. High purity Ge detectors where velocity saturation may not be reached within certain parts of the depleted region are studied. Special attention is given to the probability of pulses being incorrectly timed because of their slow rise or small magnitude. Such incorrect timing is energy-dependent and results in a noticeable distortion of the timing spectrum that relates to a wide energy range. Limitations on system parameters to keep the probability of incorrect timing below a specified fraction are given

  17. Evaluation of gamma ray fields by HPGE spectrometry in situ

    Energy Technology Data Exchange (ETDEWEB)

    Krnac, S; Slugen, V [Slovak Technical Univ., Bratislava (Slovakia); Ragan, P; Fueloep, M [Inst. of Preventive and Clinical Medicine, Bratislava (Slovakia)

    1996-12-31

    In this paper the in situ spectrometric measurement for application in gamma radiation dosimetry with portability and flexibility in use was studied. In order to allow operation of the detector in any orientation without liquid nitrogen (LN{sub 2}) spillage, a multi-attitude cryostat (MAC) has been used which consists of a Dewar with LN{sub 2} capacity of 7.0 litres and a holding time of 5 days. This allows the Dewar to be operated in the horizontal position, pointing vertically upward or vertically downward, without loss of LN{sub 2}. The MAC detector has been positioned in a 4{sup p}i{sup -}goniometer and, therefore is movable to any measurable angle. Pulses from the detector have been fed into a portable multichannel analyzer (Canberra 35+) with connection to a PC/AT compatible computer system. The main results and findings of present contribution may be summarized as follows: 1. A technique called the scaling confirmatory factor analysis (SCFA) presented else can be advantageously employed for determination of the response operator characterizing an influence of measuring device on physical gamma-spectra obtained. The in situ response operator has been reproduced only from the internal factors of appropriate latent structure that do not depend upon materials surrounding the detector. 2. The photon fluence rate response operator for in situ application has been obtained from the reduced response operator by a correction according to the geometric factor 4{sup p}i{sup (}r{sub 0}+r){sup 2}.The effective distance r{sub 0} has been determined via a performance of the radial calibration which yields a condition of, minimally, 10 cm distance of the detector cover from the potential sources. 3. The real incident gamma ray spectra achieved by application of the SCFA response allow direct evaluation of spectral distributions of the fundamental photon dosimetric quantities. (Abstract Truncated)

  18. A silicon photomultiplier readout for time of flight neutron spectroscopy with {gamma}-ray detectors

    Energy Technology Data Exchange (ETDEWEB)

    Pietropaolo, A.; Gorini, G. [Dipartimento di Fisica ' ' G. Occhialini' ' and CNISM, Universita Degli Studi di Milano-Bicocca, Piazza della Scienza 3, 20126 Milano (Italy); Festa, G.; Andreani, C.; De Pascale, M. P.; Reali, E. [Dipartimento di Fisica and Centro NAST, Universita degli Studi di Roma Tor Vergata, Via della Ricerca Scientifica 1, 00133, Roma (Italy); Grazzi, F. [Istituto dei Sistemi Complessi-Consiglio Nazionale delle Ricerche, Via Madonna del Piano n.10, I-50019 Sesto Fiorentino, Firenze (Italy); Schooneveld, E. M. [ISIS Facility, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire, OX11 0QX (United Kingdom)

    2009-09-15

    The silicon photomultiplier (SiPM) is a recently developed photosensor used in particle physics, e.g., for detection of minimum ionizing particles and/or Cherenkov radiation. Its performance is comparable to that of photomultiplier tubes, but with advantages in terms of reduced volume and magnetic field insensitivity. In the present study, the performance of a gamma ray detector made of an yttrium aluminum perovskite scintillation crystal and a SiPM-based readout is assessed for use in time of flight neutron spectroscopy. Measurements performed at the ISIS pulsed neutron source demonstrate the feasibility of {gamma}-detection based on the new device.

  19. Gamma ray energy loss spectra simulation in NaI detectors with the Monte Carlo method

    International Nuclear Information System (INIS)

    Vieira, W.J.

    1982-01-01

    With the aim of studying and applying the Monte Carlo method, a computer code was developed to calculate the pulse height spectra and detector efficiencies for gamma rays incident on NaI (Tl) crystals. The basic detector processes in NaI (Tl) detectors are given together with an outline of Monte Carlo methods and a general review of relevant published works. A detailed description of the application of Monte Carlo methods to ν-ray detection in NaI (Tl) detectors is given. Comparisons are made with published, calculated and experimental, data. (Author) [pt

  20. The 4U 0115+63: Another energetic gamma ray binary pulsar

    Science.gov (United States)

    Chadwick, P. M.; Dipper, N. A.; Dowthwaite, J. C.; Kirkman, I. W.; Mccomb, T. J. L.; Orford, K. J.; Turver, K. E.

    1985-01-01

    Following the discovery of Her X-1 as a source of pulsed 1000 Gev X-rays, a search for emission from an X-ray binary containing a pulsar with similar values of period, period derivative and luminosity was successful. The sporadic X-ray binary 4U 0115-63 has been observed, with probability 2.5 x 10 to the minus 6 power ergs/s to emit 1000 GeV gamma-rays with a time averaged energy flux of 6 to 10 to the 35th power.