WorldWideScience

Sample records for publicly released version

  1. NESHAP Area-Specific Dose-Release Factors for Potential Onsite Member-of-the-Public Locations at SRS using CAP88-PC Version 4.0

    Energy Technology Data Exchange (ETDEWEB)

    Trimor, P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-08-09

    The Environmental Protection Agency (EPA) requires the use of the computer model CAP88-PC to estimate the total effective doses (TED) for demonstrating compliance with 40 CFR 61, Subpart H (EPA 2006), the National Emission Standards for Hazardous Air Pollutants (NESHAP) regulations. As such, CAP88 Version 4.0 was used to calculate the receptor dose due to routine atmospheric releases at the Savannah River Site (SRS). For estimation, NESHAP dose-release factors (DRFs) have been supplied to Environmental Compliance and Area Closure Projects (EC&ACP) for many years. DRFs represent the dose to a maximum receptor exposed to 1 Ci of a specified radionuclide being released into the atmosphere. They are periodically updated to include changes in the CAP88 version, input parameter values, site meteorology, and location of the maximally exposed individual (MEI). In this report, the DRFs were calculated for potential radionuclide atmospheric releases from 13 SRS release points. The three potential onsite MEI locations to be evaluated are B-Area, Three Rivers Landfill (TRL), and Savannah River Ecology Lab Conference Center (SRELCC) with TRL’s onsite workers considered as members-of-the-public, and the potential future constructions of dormitories at SRELCC and Barracks at B-Area. Each MEI location was evaluated at a specified compass sector with different area to receptor distances and was conducted for both ground-level and elevated release points. The analysis makes use of area-specific meteorological data (Viner 2014). The resulting DRFs are compared to the 2014 NESHAP offsite MEI DRFs for three operational areas; A-Area, H-Area, and COS for a release rate of 1 Ci of tritium oxide at 0 ft. elevation. CAP88 was executed again using the 2016 NESHAP MEI release rates for 0 and 61 m stack heights to determine the radionuclide dose at TRL from the center-of-site (COS).

  2. Release Early, Release Often: Predicting Change in Versioned Knowledge Organization Systems on the Web

    OpenAIRE

    Meroño-Peñuela, Albert; Guéret, Christophe; Schlobach, Stefan

    2015-01-01

    The Semantic Web is built on top of Knowledge Organization Systems (KOS) (vocabularies, ontologies, concept schemes) that provide a structured, interoperable and distributed access to Linked Data on the Web. The maintenance of these KOS over time has produced a number of KOS version chains: subsequent unique version identifiers to unique states of a KOS. However, the release of new KOS versions pose challenges to both KOS publishers and users. For publishers, updating a KOS is a knowledge int...

  3. SHAKER Version 0.0/5 Pre-release Notes

    CERN Document Server

    CERN. Geneva

    1993-01-01

    SHAKER V0.0/5 is a pre-release of a simple cocktail central rapidity phase space event generator developed for the simulation of LHC Heavy Ion events. A modified version of JETSET 7.3 (the / LUJETS / common has been enlarged to 50000 particles and the LUEDIT routine has been modified to rearrange the particle weights vectors when called with MEDIT=1) is used to manage the events. All event information is included in / LUJETS / according to Lund conventions [1].

  4. History of the CERN Web Software Public Releases

    CERN Document Server

    Fluckiger, Francois; CERN. Geneva. IT Department

    2016-01-01

    This note is an extended version of the article “Licencing the Web” (http://home.web.cern.ch/topics/birthweb/licensing-web) published by CERN, Nov 2013, in the “Birth of the Web” series of articles (http://home.cern/topics/birth-web). It describes the successive steps of the public release of the CERN Web software, from public domain to open source, and explains their rationale. It provides in annexes historical documents including release announcement and texts of the licences used by CERN and MIT in public software distributions.

  5. AF-GEOSpace Version 2.1 Release

    Science.gov (United States)

    Hilmer, R. V.; Ginet, G. P.; Hall, T.; Holeman, E.; Madden, D.; Perry, K. L.; Tautz, M.; Roth, C.

    2006-05-01

    AF-GEOSpace Version 2.1 is a graphics-intensive software program with space environment models and applications developed recently by the Space Weather Center of Excellence at AFRL. A review of new and planned AF-GEOSpace capabilities will be given. The software addresses a wide range of physical domains and addresses such topics as solar disturbance propagation, geomagnetic field and radiation belt configurations, auroral particle precipitation, and ionospheric scintillation. Building on the success of previous releases, AF-GEOSpace has become a platform for the rapid prototyping of automated operational and simulation space weather visualization products and helps with a variety of tasks, including: orbit specification for radiation hazard avoidance; satellite design assessment and post-event anomaly analysis; solar disturbance effects forecasting; determination of link outage regions for active ionospheric conditions; satellite magnetic conjugate studies, scientific model validation and comparison, physics research, and education. Previously, Version 2.0 provided a simplified graphical user interface, improved science and application modules, significantly enhanced graphical performance, common input data archive sets, and 1-D, 2-D, and 3- D visualization tools for all models. Dynamic capabilities permit multiple environments to be generated at user- specified time intervals while animation tools enable the display of satellite orbits and environment data together as a function of time. Building on the Version 2.0 software architecture, AF-GEOSpace Version 2.1 includes a host of new modules providing, for example, plasma sheet charged particle fluxes, neutral atmosphere densities, 3-D cosmic ray cutoff maps, low-altitude trapped proton belt flux specification, DMSP particle data displays, satellite magnetic field footprint mapping determination, and meteor sky maps and shower/storm fluxes with spacecraft impact probabilities. AF-GEOSpace Version 2.1 was

  6. The illustris simulation: Public data release

    Science.gov (United States)

    Nelson, D.; Pillepich, A.; Genel, S.; Vogelsberger, M.; Springel, V.; Torrey, P.; Rodriguez-Gomez, V.; Sijacki, D.; Snyder, G. F.; Griffen, B.; Marinacci, F.; Blecha, L.; Sales, L.; Xu, D.; Hernquist, L.

    2015-11-01

    We present the full public release of all data from the Illustris simulation project. Illustris is a suite of large volume, cosmological hydrodynamical simulations run with the moving-mesh code AREPO and including a comprehensive set of physical models critical for following the formation and evolution of galaxies across cosmic time. Each simulates a volume of (106.5 Mpc)3 and self-consistently evolves five different types of resolution elements from a starting redshift of z = 127 to the present day, z = 0. These components are: dark matter particles, gas cells, passive gas tracers, stars and stellar wind particles, and supermassive black holes. This data release includes the snapshots at all 136 available redshifts, halo and subhalo catalogs at each snapshot, and two distinct merger trees. Six primary realizations of the Illustris volume are released, including the flagship Illustris-1 run. These include three resolution levels with the fiducial "full" baryonic physics model, and a dark matter only analog for each. In addition, we provide four distinct, high time resolution, smaller volume "subboxes". The total data volume is ∼265 TB, including ∼800 full volume snapshots and ∼30,000 subbox snapshots. We describe the released data products as well as tools we have developed for their analysis. All data may be directly downloaded in its native HDF5 format. Additionally, we release a comprehensive, web-based API which allows programmatic access to search and data processing tasks. In both cases we provide example scripts and a getting-started guide in several languages: currently, IDL, Python, and Matlab. This paper addresses scientific issues relevant for the interpretation of the simulations, serves as a pointer to published and on-line documentation of the project, describes planned future additional data releases, and discusses technical aspects of the release.

  7. The first WASP public data release

    CERN Document Server

    Butters, O W; Anderson, D R; Cameron, A Collier; Clarkson, W I; Enoch, B; Haswell, C A; Hellier, C; Horne, K; Joshi, Y; Kane, S R; Lister, T A; Maxted, P F L; Parley, N; Pollacco, D; Smalley, B; Street, R A; Todd, I; Wheatley, P J; Wilson, D M; 10.1051/0004-6361/201015655

    2010-01-01

    The WASP (Wide Angle Search for Planets) project is an exoplanet transit survey that has been automatically taking wide field images since 2004. Two instruments, one in La Palma and the other in South Africa, continually monitor the night sky, building up light curves of millions of unique objects. These light curves are used to search for the characteristics of exoplanetary transits. This first public data release (DR1) of the WASP archive makes available all the light curve data and images from 2004 up to 2008 in both the Northern and Southern hemispheres. A web interface (www.wasp.le.ac.uk/public/) to the data allows easy access over the Internet. The data set contains 3 631 972 raw images and 17 970 937 light curves. In total the light curves have 119 930 299 362 data points available between them.

  8. The Illustris Simulation: Public Data Release

    CERN Document Server

    Nelson, Dylan; Genel, Shy; Vogelsberger, Mark; Springel, Volker; Torrey, Paul; Rodriguez-Gomez, Vicente; Sijacki, Debora; Snyder, Gregory F; Griffen, Brendan; Marinacci, Federico; Blecha, Laura; Sales, Laura; Xu, Dandan; Hernquist, Lars

    2015-01-01

    We present the full public release of all data from the Illustris simulation project. Illustris is a suite of large volume, cosmological hydrodynamical simulations run with the moving-mesh code Arepo and including a comprehensive set of physical models critical for following the formation and evolution of galaxies across cosmic time. Each simulates a volume of (106.5 Mpc)^3 and self-consistently evolves five different types of resolution elements from a starting redshift of z=127 to the present day, z=0. These components are: dark matter particles, gas cells, passive gas tracers, stars and stellar wind particles, and supermassive black holes. This data release includes the snapshots at all 136 available redshifts, halo and subhalo catalogs at each snapshot, and two distinct merger trees. Six primary realizations of the Illustris volume are released, including the flagship Illustris-1 run. These include three resolution levels with the fiducial "full" baryonic physics model, and a dark matter only analog for e...

  9. Urban Terrain Building Types: Second Edition Public Releasable Version

    Science.gov (United States)

    2012-11-01

    Singapore Sri Lanka Colombo Thailand Bangkok Vietnam Ho Chi Minh City Subtotal 13 19 Latin America Costa Rica Heredia, Puntarenas, San Jose Mexico...textile factory, that needed as much natural light as possible, especially in the early days of electricity . (Largely abandoned factory buildings in...with ground truth photographs. For Uppsala, local knowledge plus aerial photo coverage in both oblique and vertical form ( supplied by the Swedish

  10. ms2: A molecular simulation tool for thermodynamic properties, new version release

    CERN Document Server

    Glass, Colin W; Rutkai, Gábor; Deublein, Stephan; Köster, Andreas; Carrión, Gabriela Guevara; Wafai, Amer; Horsch, Martin; Bernreuther, Martin F; Windmann, Thorsten; Hasse, Hans; Vrabec, Jadran

    2015-01-01

    A new version release (2.0) of the molecular simulation tool ms2 [S. Deublein et al., Comput. Phys. Commun. 182 (2011) 2350] is presented. Version 2.0 of ms2 features a hybrid parallelization based on MPI and OpenMP for molecular dynamics simulation to achieve higher scalability. Furthermore, the formalism by Lustig [R. Lustig, Mol. Phys. 110 (2012) 3041] is implemented, allowing for a systematic sampling of Massieu potential derivatives in a single simulation run. Moreover, the Green-Kubo formalism is extended for the sampling of the electric conductivity and the residence time. To remove the restriction of the preceding version to electro-neutral molecules, Ewald summation is implemented to consider ionic long range interactions. Finally, the sampling of the radial distribution function is added.

  11. Ladtap XL Version 2017: A Spreadsheet For Estimating Dose Resulting From Aqueous Releases

    Energy Technology Data Exchange (ETDEWEB)

    Minter, K. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jannik, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-06-15

    LADTAP XL© is an EXCEL© spreadsheet used to estimate dose to offsite individuals and populations resulting from routine and accidental releases of radioactive materials to the Savannah River. LADTAP XL© contains two worksheets: LADTAP and IRRIDOSE. The LADTAP worksheet estimates dose for environmental pathways including external exposure resulting from recreational activities on the Savannah River and internal exposure resulting from ingestion of water, fish, and invertebrates originating from the Savannah River. IRRIDOSE estimates offsite dose to individuals and populations from irrigation of foodstuffs with contaminated water from the Savannah River. In 2004, a complete description of the LADTAP XL© code and an associated user’s manual was documented in LADTAP XL©: A Spreadsheet for Estimating Dose Resulting from Aqueous Release (WSRC-TR-2004-00059) and revised input parameters, dose coefficients, and radionuclide decay constants were incorporated into LADTAP XL© Version 2013 (SRNL-STI-2011-00238). LADTAP XL© Version 2017 is a slight modification to Version 2013 with minor changes made for more user-friendly parameter inputs and organization, updates in the time conversion factors used within the dose calculations, and fixed an issue with the expected time build-up parameter referenced within the population shoreline dose calculations. This manual has been produced to update the code description, verification of the models, and provide an updated user’s manual. LADTAP XL© Version 2017 has been verified by Minter (2017) and is ready for use at the Savannah River Site (SRS).

  12. Development of KPLO Science Data Archive for Public Release

    Science.gov (United States)

    Kim, J. H.; Choi, Y.-J.; Kim, B.-Y.

    2017-06-01

    Korea Aerospace Research Institute is carrying out development of KARI Planetary Data System for public release of the scientific measurement data of the Korean domestic science instruments onboard the Korea Pathfinder Lunar Orbiter.

  13. Publicly Released Prompt Radiation Spectra Suitable for Nuclear Detonation Simulations

    Science.gov (United States)

    2017-03-01

    emission. During the Hiroshima and Nagasaki bombings, the prompt radiation contributed from 40%-70% of the free-in-air dose depending on distance from...intermediate- and low -yield thermonuclear weapons for initial radiation shielding calculations No Gritzner, et al. 1976 (EM-1, Low , Henre...Publicly Released Prompt Radiation Spectra Suitable for Nuclear Detonation Simulations DISTRIBUTION A. Approved for public release; distribution is

  14. World Digital Magnetic Anomaly Map version 2 (WDMAM v.2) - released for research and education

    Science.gov (United States)

    CHOI-Dyment, Y.; Lesur, V.; Dyment, J.; Hamoudi, M.; Thebault, E.; Catalan, M.

    2015-12-01

    The World Digital Magnetic Anomaly Map is an international initiative carried out under the auspices of the International Association of Geomagnetism and Aeronomy (IAGA) and the Commission for the Geological Map of the World (CGMW). A first version of the map has been published and distributed eight years ago (WDMAM v1; Korhonen et al., 2007). We have produced a candidate which has been accepted as the second version of this map (WDMAM v2) at the International Union of Geophysics and Geodesy in Prag, in June 2015. On land, we adopted an alternative approach avoiding any unnecessary processing on existing aeromagnetic compilations. When available, we used the original aeromagnetic data. As a result the final compilation remains an acceptable representation of the national and international data grids. Over oceanic areas the marine data have been extended. In areas of insufficient data coverage, a model has been computed based on a modified digital grid of the oceanic lithosphere age, considering plate motions in the determination of magnetization vector directions. This model has been further adjusted to the available data, resulting in a better representation of the anomalies. The final grid will be periodically upgraded. Version 2.0 has been released and is available at wdmam.org to support both research and education projects. Colleagues willing to contribute data for future releases (and become a co-author of the map) should contact any of the authors or Jerome Dyment (chair of the WDMAM Task Force) at jdy@ipgp.fr .

  15. Responsiveness of the Korean version of the Michigan Hand Outcomes Questionnaire after carpal tunnel release.

    Science.gov (United States)

    Wi, Seung Myung; Gong, Hyun Sik; Bae, Kee Jeong; Roh, Young Hak; Lee, Young Ho; Baek, Goo Hyun

    2014-06-01

    The Korean version of the Michigan Hand Outcomes Questionnaire (K-MHQ) was recently validated; however, the questionnaire's responsiveness as well as the degree to which the instrument is sensitive to change has not been thoroughly evaluated in a specific condition in Koreans. We evaluated the responsiveness of the K-MHQ in a homogenous cohort of patients with carpal tunnel syndrome (CTS) and we compared it with that of the Korean version of the Disability of the Arm, Shoulder, and Hand Questionnaire (K-DASH), which was found to have a large degree of responsiveness after carpal tunnel release for Korean patients with CTS. Thirty-seven patients with CTS prospectively completed the K-MHQ and the K-DASH before and 6 months after surgery. The responsiveness statistics were assessed for both the K-MHQ and the K-DASH by using the standardized response mean (SRM), which was defined as the mean change of the original scores after surgery divided by the standard deviation of the change. All domains of the K-MHQ significantly improved after carpal tunnel release (p responsiveness of ≥ 0.8. The aesthetics scale showed medium responsiveness of 0.6. The combined function/symptom scale of the K-DASH significantly improved after surgery (p responsiveness of 0.9. The K-MHQ was found to have a large degree of responsiveness after carpal tunnel release for Korean patients with CTS, which is comparable not only to the K-DASH, but also to the original version of the MHQ. The region-specific K-MHQ can be useful for outcomes research related to carpal tunnel surgery, especially for research comparing CTS with various other hand and wrist health conditions.

  16. Big Bang pour le grand public - French version only

    CERN Multimedia

    2004-01-01

    Pour commémorer les 50 ans du CERN et l'année de la physique en 2005, la section de physique de l'Université de Genève ouvre une fois de plus ses portes aux non initiés et organise une série de conférences de vulgarisation scientifique. La première conférence, le 7 décembre prochain aura pour thème le Big-Bang et les observations qui corroborent cette théorie. Le Professeur Georges Meylan, Directeur du Laboratoire d'Astrophysique de l'EPFL, donnera cette conférence destinée à tous les publics. Chacune des conférences débutera par une démonstration de détection de rayons cosmiques dans l'auditoire et l'utilisation de ces signaux venus du fond de l'univers pour créer une ?musique cosmique', en collaboration avec le Professeur Ellberger et Nikolai Mihailov du conservatoire de musique de Genève. Ces processus cosmiques étant aléatoires, chacun de ces concerts sera unique. Les preuves observationnelles du Big Bang par le Professeur Georges Meylan Directeur du Laboratoire d'Astrophysique ...

  17. Publicly Releasing a Large Simulation Dataset with NDS Labs

    Science.gov (United States)

    Goldbaum, Nathan

    2016-03-01

    Optimally, all publicly funded research should be accompanied by the tools, code, and data necessary to fully reproduce the analysis performed in journal articles describing the research. This ideal can be difficult to attain, particularly when dealing with large (>10 TB) simulation datasets. In this lightning talk, we describe the process of publicly releasing a large simulation dataset to accompany the submission of a journal article. The simulation was performed using Enzo, an open source, community-developed N-body/hydrodynamics code and was analyzed using a wide range of community- developed tools in the scientific Python ecosystem. Although the simulation was performed and analyzed using an ecosystem of sustainably developed tools, we enable sustainable science using our data by making it publicly available. Combining the data release with the NDS Labs infrastructure allows a substantial amount of added value, including web-based access to analysis and visualization using the yt analysis package through an IPython notebook interface. In addition, we are able to accompany the paper submission to the arXiv preprint server with links to the raw simulation data as well as interactive real-time data visualizations that readers can explore on their own or share with colleagues during journal club discussions. It is our hope that the value added by these services will substantially increase the impact and readership of the paper.

  18. Newly Released TRMM Version 7 Products, Other Precipitation Datasets and Data Services at NASA GES DISC

    Science.gov (United States)

    Liu, Zhong; Ostrenga, D.; Teng, W. L.; Trivedi, Bhagirath; Kempler, S.

    2012-01-01

    The NASA Goddard Earth Sciences Data and Information Services Center (GES DISC) is home of global precipitation product archives, in particular, the Tropical Rainfall Measuring Mission (TRMM) products. TRMM is a joint U.S.-Japan satellite mission to monitor tropical and subtropical (40 S - 40 N) precipitation and to estimate its associated latent heating. The TRMM satellite provides the first detailed and comprehensive dataset on the four dimensional distribution of rainfall and latent heating over vastly undersampled tropical and subtropical oceans and continents. The TRMM satellite was launched on November 27, 1997. TRMM data products are archived at and distributed by GES DISC. The newly released TRMM Version 7 consists of several changes including new parameters, new products, meta data, data structures, etc. For example, hydrometeor profiles in 2A12 now have 28 layers (14 in V6). New parameters have been added to several popular Level-3 products, such as, 3B42, 3B43. Version 2.2 of the Global Precipitation Climatology Project (GPCP) dataset has been added to the TRMM Online Visualization and Analysis System (TOVAS; URL: http://disc2.nascom.nasa.gov/Giovanni/tovas/), allowing online analysis and visualization without downloading data and software. The GPCP dataset extends back to 1979. Version 3 of the Global Precipitation Climatology Centre (GPCC) monitoring product has been updated in TOVAS as well. The product provides global gauge-based monthly rainfall along with number of gauges per grid. The dataset begins in January 1986. To facilitate data and information access and support precipitation research and applications, we have developed a Precipitation Data and Information Services Center (PDISC; URL: http://disc.gsfc.nasa.gov/precipitation). In addition to TRMM, PDISC provides current and past observational precipitation data. Users can access precipitation data archives consisting of both remote sensing and in-situ observations. Users can use these data

  19. Validation of the state version of the Self-Statement during Public Speaking Scale.

    Science.gov (United States)

    Osório, Flávia L; Crippa, José Alexandre S; Loureiro, Sonia Regina

    2013-03-01

    To adapt the trait version of the Self Statements during Public Speaking (SSPS) scale to a state version (SSPS-S) and to assess its discriminative validity for use in the Simulated Public Speaking Test (SPST). Subjects with and without social anxiety disorder (n = 45) were assessed while performing the SPST, a clinical-experimental model of anxiety with seven different phases. Alterations in negative self-assessment occurred with significant changes throughout the different phases of the procedure (p = .05). Non-cases presented significantly higher mean values of the SSPS-S in all phases of the procedure than cases (p < .01). Cases assessed themselves in a less positive and more negative manner during the SPST than did non-cases. SSPS-S is adequate for this assessment, especially its negative subscale, and shows good psychometric qualities.

  20. Validation of the state version of the Self-Statement during Public Speaking Scale

    Directory of Open Access Journals (Sweden)

    Flávia L. Osório

    2013-03-01

    Full Text Available OBJECTIVE: To adapt the trait version of the Self Statements during Public Speaking (SSPS scale to a state version (SSPS-S and to assess its discriminative validity for use in the Simulated Public Speaking Test (SPST. METHOD: Subjects with and without social anxiety disorder (n = 45 were assessed while performing the SPST, a clinical-experimental model of anxiety with seven different phases. RESULTS: Alterations in negative self-assessment occurred with significant changes throughout the different phases of the procedure (p = .05. Non-cases presented significantly higher mean values of the SSPS-S in all phases of the procedure than cases (p < .01. CONCLUSION: Cases assessed themselves in a less positive and more negative manner during the SPST than did non-cases. SSPS-S is adequate for this assessment, especially its negative subscale, and shows good psychometric qualities.

  1. The EAGLE simulation of galaxy formation: public release of halo and galaxy catalogues

    CERN Document Server

    McAlpine, Stuart; Schaller, Matthieu; Trayford, James W; Qu, Yan; Furlong, Michelle; Bower, Richard G; Crain, Robert A; Schaye, Joop; Theuns, Tom; Vecchia, Claudio Dalla; Frenk, Carlos S; McCarthy, Ian G; Jenkins, Adrian; Rosas-Guevara, Yetli; White, Simon D M; Baes, Maarten; Camps, Peter; Lemson, Gerard

    2015-01-01

    We present the public data release of halo and galaxy catalogues extracted from the EAGLE suite of cosmological hydrodynamical simulations of galaxy formation. These simulations were performed with an enhanced version of the GADGET code that includes a modified hydrodynamics solver, time-step limiter and subgrid treatments of baryonic physics, such as stellar mass loss, element-by-element radiative cooling, star formation and feedback from star formation and black hole accretion. The simulation suite includes runs performed in volumes ranging from 25 to 100 comoving megaparsecs per side, with numerical resolution chosen to marginally resolve the Jeans mass of the gas at the star formation threshold. The free parameters of the subgrid models for feedback are calibrated to the redshift z=0 galaxy stellar mass function, galaxy sizes and black hole mass - stellar mass relation. The simulations have been shown to match a wide range of observations for present-day and higher-redshift galaxies. The raw particle data...

  2. JaxoDraw: A graphical user interface for drawing Feynman diagrams. Version 2.0 release notes

    Science.gov (United States)

    Binosi, D.; Collins, J.; Kaufhold, C.; Theussl, L.

    2009-09-01

    variety of new features and bug fixes. Summary of revisions: Major revisions since the last published user guide were versions 1.1, 1.2 and 1.3 with several minor bug-fix releases in between. Restrictions: To make use of the latex export/preview functionality, a latex style file has to be installed separately. Certain operations (like internal latex compilation, Postscript preview) require the execution of external commands that might not work on untested operating systems. Running time: As an interactive program, the running time depends on the complexity of the diagram to be drawn.

  3. CALIFA, the Calar Alto Legacy Integral Field Area survey. III. Second public data release

    NARCIS (Netherlands)

    García-Benito, R.; Zibetti, S.; Sánchez, S. F.; Husemann, B.; de Amorim, A. L.; Castillo-Morales, A.; Cid Fernandes, R.; Ellis, S. C.; Falcón-Barroso, J.; Galbany, L.; Gil de Paz, A.; González Delgado, R. M.; Lacerda, E. A. D.; López-Fernandez, R.; de Lorenzo-Cáceres, A.; Lyubenova, M.; Marino, R. A.; Mast, D.; Mendoza, M. A.; Pérez, E.; Vale Asari, N.; Aguerri, J. A. L.; Ascasibar, Y.; Bekerait*error*ė, S.; Bland-Hawthorn, J.; Barrera-Ballesteros, J. K.; Bomans, D. J.; Cano-Díaz, M.; Catalán-Torrecilla, C.; Cortijo, C.; Delgado-Inglada, G.; Demleitner, M.; Dettmar, R.-J.; Díaz, A. I.; Florido, E.; Gallazzi, A.; García-Lorenzo, B.; Gomes, J. M.; Holmes, L.; Iglesias-Páramo, J.; Jahnke, K.; Kalinova, V.; Kehrig, C.; Kennicutt, R. C.; López-Sánchez, Á. R.; Márquez, I.; Masegosa, J.; Meidt, S. E.; Mendez-Abreu, J.; Mollá, M.; Monreal-Ibero, A.; Morisset, C.; del Olmo, A.; Papaderos, P.; Pérez, I.; Quirrenbach, A.; Rosales-Ortega, F. F.; Roth, M. M.; Ruiz-Lara, T.; Sánchez-Blázquez, P.; Sánchez-Menguiano, L.; Singh, R.; Spekkens, K.; Stanishev, V.; Torres-Papaqui, J. P.; van de Ven, G.; Vilchez, J. M.; Walcher, C. J.; Wild, V.; Wisotzki, L.; Ziegler, B.; Alves, J.; Barrado, D.; Quintana, J. M.; Aceituno, J.

    2015-01-01

    This paper describes the Second Public Data Release (DR2) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. The data for 200 objects are made public, including the 100 galaxies of the First Public Data Release (DR1). Data were obtained with the integral-field spectrograph PMAS/PPak mount

  4. The Spanish Version of the Self-Statements during Public Speaking Scale: Validation in Adolescents.

    Science.gov (United States)

    Rivero, Raul; Garcia-Lopez, Luisjoaquin; Hofmann, Stefan G

    2010-01-01

    Contemporary theories of social anxiety emphasize the role of cognitive processes. Although social anxiety disorder is one of the most common mental health problems in adolescents, there are very few self-report instruments available to measure cognitive processes related to social anxiety in adolescents, let alone non-English instruments. The Self-Statements during Public Speaking Scale (SSPS; Hofmann & DiBartolo, 2000) is a brief self-report measure designed to assess self-statements related to public speaking, the most commonly feared social performance situation. In order to fill this gap in the literature, we translated the SSPS into Spanish and administered it to 1,694 adolescents from a community sample, a clinical sample composed of 71 subjects with a principal diagnosis of social anxiety disorder; and a clinical control group consisting of 154 patients. The scale showed good psychometric properties, supporting the use of the Spanish version of the SSPS in adolescents.

  5. Determining Fitness-For-Use of Ontologies Through Change Management, Versioning and Publication Best Practices

    Science.gov (United States)

    West, P.; Zednik, S.; Fu, L.; Ma, X.; Fox, P. A.

    2015-12-01

    There is a large and growing number of domain ontologies available for researchers to leverage in their applications. When evaluating the use of an ontology it is important to not only consider whether the concepts and relationships defined in the ontology meet the requirements for purpose of use, but also how the change management, versioning and publication practices followed by the ontology publishers affect the maturity, stability, and long-term fitness-for-use of the ontology. In this presentation we share our experiences and a list of best practices we have developed when determining fitness for use of existing ontologies, and the process we follow when developing of our own ontologies and extensions to existing ontologies. Our experience covers domains such as solar terrestrial physics, geophysics and oceanography; and the use of general purpose ontologies such as those with representations of people, organizations, data catalogs, observations and measurements and provenance. We will cover how we determine ontology scope, manage ontology change, specify ontology version, and what best practices we follow for ontology publication and use. The implications of following these best practices is that the ontologies we use and develop are mature, stable, have a well-defined scope, and are published in accordance with linked data principles.

  6. CALIFA, the Calar Alto Legacy Integral Field Area survey. IV. Third public data release

    Science.gov (United States)

    Sánchez, S. F.; García-Benito, R.; Zibetti, S.; Walcher, C. J.; Husemann, B.; Mendoza, M. A.; Galbany, L.; Falcón-Barroso, J.; Mast, D.; Aceituno, J.; Aguerri, J. A. L.; Alves, J.; Amorim, A. L.; Ascasibar, Y.; Barrado-Navascues, D.; Barrera-Ballesteros, J.; Bekeraitè, S.; Bland-Hawthorn, J.; Cano Díaz, M.; Cid Fernandes, R.; Cavichia, O.; Cortijo, C.; Dannerbauer, H.; Demleitner, M.; Díaz, A.; Dettmar, R. J.; de Lorenzo-Cáceres, A.; del Olmo, A.; Galazzi, A.; García-Lorenzo, B.; Gil de Paz, A.; González Delgado, R.; Holmes, L.; Iglésias-Páramo, J.; Kehrig, C.; Kelz, A.; Kennicutt, R. C.; Kleemann, B.; Lacerda, E. A. D.; López Fernández, R.; López Sánchez, A. R.; Lyubenova, M.; Marino, R.; Márquez, I.; Mendez-Abreu, J.; Mollá, M.; Monreal-Ibero, A.; Ortega Minakata, R.; Torres-Papaqui, J. P.; Pérez, E.; Rosales-Ortega, F. F.; Roth, M. M.; Sánchez-Blázquez, P.; Schilling, U.; Spekkens, K.; Vale Asari, N.; van den Bosch, R. C. E.; van de Ven, G.; Vilchez, J. M.; Wild, V.; Wisotzki, L.; Yıldırım, A.; Ziegler, B.

    2016-10-01

    This paper describes the third public data release (DR3) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. Science-grade quality data for 667 galaxies are made public, including the 200 galaxies of the second public data release (DR2). Data were obtained with the integral-field spectrograph PMAS/PPak mounted on the 3.5 m telescope at the Calar Alto Observatory. Three different spectral setups are available: i) a low-resolution V500 setup covering the wavelength range 3745-7500 Å (4240-7140 Å unvignetted) with a spectral resolution of 6.0 Å (FWHM) for 646 galaxies, ii) a medium-resolution V1200 setup covering the wavelength range 3650-4840 Å (3650-4620 Å unvignetted) with a spectral resolution of 2.3 Å (FWHM) for 484 galaxies, and iii) the combination of the cubes from both setups (called COMBO) with a spectral resolution of 6.0 Å and a wavelength range between 3700-7500 Å (3700-7140 Å unvignetted) for 446 galaxies. The Main Sample, selected and observed according to the CALIFA survey strategy covers a redshift range between 0.005 and 0.03, spans the color-magnitude diagram and probes a wide range of stellar masses, ionization conditions, and morphological types. The Extension Sample covers several types of galaxies that are rare in the overall galaxy population and are therefore not numerous or absent in the CALIFA Main Sample. All the cubes in the data release were processed using the latest pipeline, which includes improved versions of the calibration frames and an even further improved image reconstruction quality. In total, the third data release contains 1576 datacubes, including ~1.5 million independent spectra. Based on observations collected at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated jointly by the Max-Planck-Institut für Astronomie (MPIA) and the Instituto de Astrofísica de Andalucía (CSIC).The spectra are available at http://califa.caha.es/DR3

  7. The VIMOS Public Extragalactic Survey (VIPERS): First Release of spectra

    CERN Document Server

    Franzetti, P; Guzzo, L; Marchetti, A; Scodeggio, M

    2014-01-01

    We release the spectra for the more than 57000 objects presented in the First VIPERS Data Release. For each object we distribute the observed, wavelength and flux calibrated spectrum, as well as cleaned spectra, where artifacts due to fringing are removed. We also provide the sky and noise spectrum and the 2D spectrum. Data can be downloaded from http://vipers.inaf.it.

  8. 49 CFR 369.10 - Public release of motor carrier of property data.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Public release of motor carrier of property data... REGULATIONS REPORTS OF MOTOR CARRIERS § 369.10 Public release of motor carrier of property data. (a) In general. Unless otherwise provided in this section, the data contained in a report filed under §...

  9. Environmental Skeptics and Critics (http://www.iaees.org/publications/journals/environsc/online-version.asp

    Directory of Open Access Journals (Sweden)

    environsc@iaees.org

    Full Text Available Environmental Skeptics and Critics ISSN 2224-4263 URL: http://www.iaees.org/publications/journals/environsc/online-version.asp RSS: http://www.iaees.org/publications/journals/environsc/rss.xml E-mail: environsc@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope The more truth is debated, the clearer it becomes. Science will not proceed without debate and controversy. Wide and in-depth debate and controversy on human's knowledge, attitudes, policies and practices on the environment determines the future of our planet. There are numerous controversial and potentially controversial issues on environmental sciences and practices. ENVIRONMENTAL SKEPTICS and CRITICS (ISSN 2224-4263 is an international journal devoted to the publication of skeptical and critical articles/short communications/letters on theories, viewpoints, methodologies, practices, policies, etc., in ecological and environmental areas. The journal provides a forum for questioning, disputing, arguing, challenging, criticizing and judging known theories, methdologies, practices, and policies, etc., or presenting different ideas. The scope of Environmental Skeptics and Critics is wide and embraces all controversial, non-conclusive or unexplained issues in ecological and environmental areas. Authors can submit their works to the email box of this journal, environsc@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

  10. Arthropods (http://www.iaees.org/publications/journals/arthropods/online-version.asp

    Directory of Open Access Journals (Sweden)

    arthropods@iaees.org

    Full Text Available Arthropods ISSN 2224-4255 URL: http://www.iaees.org/publications/journals/arthropods/online-version.asp RSS: http://www.iaees.org/publications/journals/arthropods/rss.xml E-mail: arthropods@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope ARTHROPODS (ISSN 2224-4255 is an international journal devoted to the publication of articles on various aspects of arthropods, e.g., ecology, biogeography, systematics, biodiversity (species diversity, genetic diversity, et al., conservation, control, etc. The journal provides a forum for examining the importance of arthropods in biosphere (both terrestrial and marine ecosystems and human life in such fields as agriculture, forestry, fishery, environmental management and human health. The scope of Arthropods is wide and embraces all arthropods-insects, arachnids, crustaceans, centipedes, millipedes, and other arthropods. Articles/short communications on new taxa (species, genus, families, orders, etc. and new records of arthropods are particularly welcome. Authors can submit their works to the email box of this journal, arthropods@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

  11. The Systems Biology Markup Language (SBML) Level 3 Package: Qualitative Models, Version 1, Release 1.

    Science.gov (United States)

    Chaouiya, Claudine; Keating, Sarah M; Berenguier, Duncan; Naldi, Aurélien; Thieffry, Denis; van Iersel, Martijn P; Le Novère, Nicolas; Helikar, Tomáš

    2015-09-04

    Quantitative methods for modelling biological networks require an in-depth knowledge of the biochemical reactions and their stoichiometric and kinetic parameters. In many practical cases, this knowledge is missing. This has led to the development of several qualitative modelling methods using information such as, for example, gene expression data coming from functional genomic experiments. The SBML Level 3 Version 1 Core specification does not provide a mechanism for explicitly encoding qualitative models, but it does provide a mechanism for SBML packages to extend the Core specification and add additional syntactical constructs. The SBML Qualitative Models package for SBML Level 3 adds features so that qualitative models can be directly and explicitly encoded. The approach taken in this package is essentially based on the definition of regulatory or influence graphs. The SBML Qualitative Models package defines the structure and syntax necessary to describe qualitative models that associate discrete levels of activities with entity pools and the transitions between states that describe the processes involved. This is particularly suited to logical models (Boolean or multi-valued) and some classes of Petri net models can be encoded with the approach.

  12. Soil Moisture Active Passive Mission L4_C Data Product Assessment (Version 2 Validated Release)

    Science.gov (United States)

    Kimball, John S.; Jones, Lucas A.; Glassy, Joseph; Stavros, E. Natasha; Madani, Nima; Reichle, Rolf H.; Jackson, Thomas; Colliander, Andreas

    2016-01-01

    The SMAP satellite was successfully launched January 31st 2015, and began acquiring Earth observation data following in-orbit sensor calibration. Global data products derived from the SMAP L-band microwave measurements include Level 1 calibrated and geolocated radiometric brightness temperatures, Level 23 surface soil moisture and freezethaw geophysical retrievals mapped to a fixed Earth grid, and model enhanced Level 4 data products for surface to root zone soil moisture and terrestrial carbon (CO2) fluxes. The post-launch SMAP mission CalVal Phase had two primary objectives for each science product team: 1) calibrate, verify, and improve the performance of the science algorithms, and 2) validate accuracies of the science data products as specified in the L1 science requirements. This report provides analysis and assessment of the SMAP Level 4 Carbon (L4_C) product pertaining to the validated release. The L4_C validated product release effectively replaces an earlier L4_C beta-product release (Kimball et al. 2015). The validated release described in this report incorporates a longer data record and benefits from algorithm and CalVal refinements acquired during the SMAP post-launch CalVal intensive period. The SMAP L4_C algorithms utilize a terrestrial carbon flux model informed by SMAP soil moisture inputs along with optical remote sensing (e.g. MODIS) vegetation indices and other ancillary biophysical data to estimate global daily net ecosystem CO2 exchange (NEE) and component carbon fluxes for vegetation gross primary production (GPP) and ecosystem respiration (Reco). Other L4_C product elements include surface (10 cm depth) soil organic carbon (SOC) stocks and associated environmental constraints to these processes, including soil moisture and landscape freeze/thaw (FT) controls on GPP and respiration (Kimball et al. 2012). The L4_C product encapsulates SMAP carbon cycle science objectives by: 1) providing a direct link between terrestrial carbon fluxes and

  13. Object-Oriented Version of Glenn-HT Code Released: Glenn-HT2000

    Science.gov (United States)

    Heidmann, James D.; Ameri, Ali A.; Rigby, David I.; Garg, Vijay K.; Fabian, John C.; Lucci, Barbara L.; Steinthorsson, Erlendur

    2005-01-01

    NASA Glenn Research Center s General Multi-Block Navier-Stokes Convective Heat Transfer Code (Glenn-HT) has been used extensively to predict heat transfer and fluid flow for a variety of steady gas turbine engine problems. Efforts have focused on turbine heat transfer, where computations have modeled tip clearance, internal coolant, and film cooling flows. Excellent agreement has been achieved for a variety of experimental test cases, and results have been published in over 40 technical publications. The code is available to U.S. industry and has been used by several domestic gas turbine engine companies. The following figure shows a typical flow solution from the Glenn-HT code for a film-cooled turbine blade.

  14. XMM-Newton Remote Interface to Science Analysis Software: First Public Version

    Science.gov (United States)

    Ibarra, A.; Gabriel, C.

    2011-07-01

    We present the first public beta release of the XMM-Newton Remote Interface to Science Analysis (RISA) software, available through the official XMM-Newton web pages. In a nutshell, RISA is a web based application that encapsulates the XMM-Newton data analysis software. The client identifies observations and creates XMM-Newton workflows. The server processes the client request, creates job templates and sends the jobs to a computer. RISA has been designed to help, at the same time, non-expert and professional XMM-Newton users. Thanks to the predefined threads, non-expert users can easily produce light curves and spectra. And on the other hand, expert user can use the full parameter interface to tune their own analysis. In both cases, the VO compliant client/server design frees the users from having to install any specific software to analyze XMM-Newton data.

  15. Computational Ecology and Software (http://www.iaees.org/publications/journals/ces/online-version.asp

    Directory of Open Access Journals (Sweden)

    ces@iaees.org

    Full Text Available Computational Ecology and Software ISSN 2220-721X URL: http://www.iaees.org/publications/journals/ces/online-version.asp RSS: http://www.iaees.org/publications/journals/ces/rss.xml E-mail: ces@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope COMPUTATIONAL ECOLOGY AND SOFTWARE (ISSN 2220-721X is an open access, peer-reviewed online journal that considers scientific articles in all different areas of computational ecology. It is the transactions of the International Society of Computational Ecology. The journal is concerned with the ecological researches, constructions and applications of theories and methods of computational sciences including computational mathematics, computational statistics and computer science. It features the simulation, approximation, prediction, recognition, and classification of ecological issues. Intensive computation is one of the major stresses of the journal. The journal welcomes research articles, short communications, review articles, perspectives, and book reviews. The journal also supports the activities of the International Society of Computational Ecology. The topics to be covered by CES include, but are not limited to: •Computation intensive methods, numerical and optimization methods, differential and difference equation modeling and simulation, prediction, recognition, classification, statistical computation (Bayesian computing, randomization, bootstrapping, Monte Carlo techniques, stochastic process, etc., agent-based modeling, individual-based modeling, artificial neural networks, knowledge based systems, machine learning, genetic algorithms, data exploration, network analysis and computation, databases, ecological modeling and computation using Geographical Information Systems, satellite imagery, and other computation intensive theories and methods. •Artificial ecosystems, artificial life, complexity of ecosystems and virtual reality. •The development, evaluation and validation of software and

  16. Network Biology (http://www.iaees.org/publications/journals/nb/online-version.asp

    Directory of Open Access Journals (Sweden)

    networkbiology@iaees.org

    Full Text Available Network Biology ISSN 2220-8879 URL: http://www.iaees.org/publications/journals/nb/online-version.asp RSS: http://www.iaees.org/publications/journals/nb/rss.xml E-mail: networkbiology@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope NETWORK BIOLOGY (ISSN 2220-8879; CODEN NBEICS is an open access, peer-reviewed international journal that considers scientific articles in all different areas of network biology. It is the transactions of the International Society of Network Biology. It dedicates to the latest advances in network biology. The goal of this journal is to keep a record of the state-of-the-art research and promote the research work in these fast moving areas. The topics to be covered by Network Biology include, but are not limited to: •Theories, algorithms and programs of network analysis •Innovations and applications of biological networks •Ecological networks, food webs and natural equilibrium •Co-evolution, co-extinction, biodiversity conservation •Metabolic networks, protein-protein interaction networks, biochemical reaction networks, gene networks, transcriptional regulatory networks, cell cycle networks, phylogenetic networks, network motifs •Physiological networks •Network regulation of metabolic processes, human diseases and ecological systems •Social networks, epidemiological networks •System complexity, self-organized systems, emergence of biological systems, agent-based modeling, individual-based modeling, neural network modeling, and other network-based modeling, etc. We are also interested in short communications that clearly address a specific issue or completely present a new ecological network, food web, or metabolic or gene network, etc. Authors can submit their works to the email box of this journal, networkbiology@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal

  17. The EAGLE simulations of galaxy formation: Public release of halo and galaxy catalogues

    Science.gov (United States)

    McAlpine, S.; Helly, J. C.; Schaller, M.; Trayford, J. W.; Qu, Y.; Furlong, M.; Bower, R. G.; Crain, R. A.; Schaye, J.; Theuns, T.; Dalla Vecchia, C.; Frenk, C. S.; McCarthy, I. G.; Jenkins, A.; Rosas-Guevara, Y.; White, S. D. M.; Baes, M.; Camps, P.; Lemson, G.

    2016-04-01

    We present the public data release of halo and galaxy catalogues extracted from the EAGLE suite of cosmological hydrodynamical simulations of galaxy formation. These simulations were performed with an enhanced version of the GADGET code that includes a modified hydrodynamics solver, time-step limiter and subgrid treatments of baryonic physics, such as stellar mass loss, element-by-element radiative cooling, star formation and feedback from star formation and black hole accretion. The simulation suite includes runs performed in volumes ranging from 25 to 100 comoving megaparsecs per side, with numerical resolution chosen to marginally resolve the Jeans mass of the gas at the star formation threshold. The free parameters of the subgrid models for feedback are calibrated to the redshift z = 0 galaxy stellar mass function, galaxy sizes and black hole mass-stellar mass relation. The simulations have been shown to match a wide range of observations for present-day and higher-redshift galaxies. The raw particle data have been used to link galaxies across redshifts by creating merger trees. The indexing of the tree produces a simple way to connect a galaxy at one redshift to its progenitors at higher redshift and to identify its descendants at lower redshift. In this paper we present a relational database which we are making available for general use. A large number of properties of haloes and galaxies and their merger trees are stored in the database, including stellar masses, star formation rates, metallicities, photometric measurements and mock gri images. Complex queries can be created to explore the evolution of more than 105 galaxies, examples of which are provided in the Appendix. The relatively good and broad agreement of the simulations with a wide range of observational datasets makes the database an ideal resource for the analysis of model galaxies through time, and for connecting and interpreting observational datasets.

  18. 78 FR 24739 - Draft Policy Papers Released for Public Comment: Title VI of the Civil Rights Act of 1964...

    Science.gov (United States)

    2013-04-26

    ... AGENCY Draft Policy Papers Released for Public Comment: Title VI of the Civil Rights Act of 1964... programs and activities. Today, EPA has released two draft policy papers for public comment. The first.... EPA's policy is that all comments received will be included in the public docket without change...

  19. MULTILINGUAL PUBLICATION AS A LEGITIMATE TOOL TO INCREASE ACCESS TO SCIENCE (English translated version

    Directory of Open Access Journals (Sweden)

    Luis Fernando Aragón-Vargas

    2014-12-01

    Full Text Available Duplicate publication, including the submission or publication of the same manuscript in two or more languages, is considered scientific misconduct. Meanwhile, properly conducted multilingual publication has been an exception difficult to deal with, rather than part of the normal scientific publishing process. While publication of a manuscript in a second or third language should not receive the same credit as the original publication, it should not be punished. Provided the appropriate disclosures and preliminary steps are taken, it should be highly encouraged instead, as it will enhance scientific communication and may reduce the knowledge gap around the world. Different types of multilingual publications are summarized and some basic guidelines are offered for the sanctioned publication of the same paper in multiple languages. ALSO AVAILABLE IN SPANISH AND PORTUGUESE FROM THIS JOURNAL.

  20. CALIFA, the Calar Alto Legacy Integral Field Area survey. II. First public data release

    NARCIS (Netherlands)

    Husemann, B.; Jahnke, K.; Sánchez, S. F.; Barrado, D.; Bekerait*error*ė, S.; Bomans, D. J.; Castillo-Morales, A.; Catalán-Torrecilla, C.; Cid Fernandes, R.; Falcón-Barroso, J.; García-Benito, R.; González Delgado, R. M.; Iglesias-Páramo, J.; Johnson, B. D.; Kupko, D.; López-Fernandez, R.; Lyubenova, M.; Marino, R. A.; Mast, D.; Miskolczi, A.; Monreal-Ibero, A.; Gil de Paz, A.; Pérez, E.; Pérez, I.; Rosales-Ortega, F. F.; Ruiz-Lara, T.; Schilling, U.; van de Ven, G.; Walcher, J.; Alves, J.; de Amorim, A. L.; Backsmann, N.; Barrera-Ballesteros, J. K.; Bland-Hawthorn, J.; Cortijo, C.; Dettmar, R.-J.; Demleitner, M.; Díaz, A. I.; Enke, H.; Florido, E.; Flores, H.; Galbany, L.; Gallazzi, A.; García-Lorenzo, B.; Gomes, J. M.; Gruel, N.; Haines, T.; Holmes, L.; Jungwiert, B.; Kalinova, V.; Kehrig, C.; Kennicutt, R. C.; Klar, J.; Lehnert, M. D.; López-Sánchez, Á. R.; de Lorenzo-Cáceres, A.; Mármol-Queraltó, E.; Márquez, I.; Mendez-Abreu, J.; Mollá, M.; del Olmo, A.; Meidt, S. E.; Papaderos, P.; Puschnig, J.; Quirrenbach, A.; Roth, M. M.; Sánchez-Blázquez, P.; Spekkens, K.; Singh, R.; Stanishev, V.; Trager, S. C.; Vilchez, J. M.; Wild, V.; Wisotzki, L.; Zibetti, S.; Ziegler, B.

    2013-01-01

    We present the first public data release (DR1) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. It consists of science-grade optical datacubes for the first 100 of eventually 600 nearby (0.005

  1. Religious Released Time Education: The Overlooked Open Door in Public Schools.

    Science.gov (United States)

    Ericsson, Samuel E.; And Others

    This paper presents arguments in favor of, and legal and constitutional guidelines for, religious released time education programs as a workable counterbalance for those concerned with the trend toward secularism in public education. The guidelines are necessarily general, because laws regarding the authority of school districts to adopt released…

  2. The 2008 Public Release of the International Multi-tokamak Confinement Profile Database

    NARCIS (Netherlands)

    Roach, C. M.; Walters, M.; Budny, R. V.; Imbeaux, F.; Fredian, T. W.; Greenwald, M.; Stillerman, J. A.; Alexander, D. A.; Carlsson, J.; Cary, J. R.; Ryter, F.; Stober, J.; Gohil, P.; Greenfield, C.; Murakami, M.; Bracco, G.; Esposito, B.; Romanelli, M.; Parail, V.; Stubberfield, P.; Voitsekhovitch, I.; Brickley, C.; Field, A. R.; Sakamoto, Y.; Fujita, T.; Fukuda, T.; Hayashi, N.; Hogeweij, G. M. D.; Chudnovskiy, A.; Kinerva, N. A.; Kessel, C. E.; Aniel, T.; Hoang, G. T.; Ongena, J.; Doyle, E. J.; Houlberg, W. A.; Polevoi, A. R.

    2008-01-01

    This paper documents the public release PR08 of the International Tokamak Physics Activity (ITPA) profile database, which should be of particular interest to the magnetic confinement fusion community. Data from a wide variety of interesting discharges from many of the world's leading tokamak ex

  3. CALIFA, the Calar Alto Legacy Integral Field Area survey : II. First public data release

    NARCIS (Netherlands)

    Husemann, B.; Jahnke, K.; Sanchez, S. F.; Barrado, D.; Bekeraite, S.; Bomans, D. J.; Castillo-Morales, A.; Catalan-Torrecilla, C.; Cid Fernandes, R.; Falcon-Barroso, J.; Garcia-Benito, R.; Gonzalez Delgado, R. M.; Iglesias-Paramo, J.; Johnson, B. D.; Kupko, D.; Lopez-Fernandez, R.; Lyubenova, M.; Marino, R. A.; Mast, D.; Miskolczi, A.; Monreal-Ibero, A.; Gil de Paz, A.; Perez, E.; Perez, I.; Rosales-Ortega, F. F.; Ruiz-Lara, T.; Schilling, U.; van de Ven, G.; Walcher, J.; Alves, J.; de Amorim, A. L.; Backsmann, N.; Barrera-Ballesteros, J. K.; Bland-Hawthorn, J.; Cortijo, C.; Dettmar, R. -J.; Demleitner, M.; Diaz, A. I.; Enke, H.; Florido, E.; Flores, H.; Galbany, L.; Gallazzi, A.; Garcia-Lorenzo, B.; Gomes, J. M.; Gruel, N.; Haines, T.; Holmes, L.; Jungwiert, B.; Kalinova, V.; Kehrig, C.; Kennicutt, R. C.; Klar, J.; Lehnert, M. D.; Lopez-Sanchez, A. R.; de Lorenzo-Caceres, A.; Marmol-Queralto, E.; Marquez, I.; Mendez-Abreu, J.; Molla, M.; del Olmo, A.; Meidt, S. E.; Papaderos, P.; Puschnig, J.; Quirrenbach, A.; Roth, M. M.; Sanchez-Blazquez, P.; Spekkens, K.; Singh, R.; Stanishev, V.; Trager, S. C.; Vilchez, J. M.; Wild, V.; Wisotzki, L.; Zibetti, S.; Ziegler, B.

    2013-01-01

    We present the first public data release (DR1) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. It consists of science-grade optical datacubes for the first 100 of eventually 600 nearby (0.005

  4. Public release of performance data in changing the behaviour of healthcare consumers, professionals or organisations.

    Science.gov (United States)

    Ketelaar, Nicole A B M; Faber, Marjan J; Flottorp, Signe; Rygh, Liv Helen; Deane, Katherine H O; Eccles, Martin P

    2011-11-09

    It is becoming increasingly common to release information about the performance of hospitals, health professionals or providers, and healthcare organisations into the public domain. However, we do not know how this information is used and to what extent such reporting leads to quality improvement by changing the behaviour of healthcare consumers, providers and purchasers, or to what extent the performance of professionals and providers can be affected. To determine the effectiveness of the public release of performance data in changing the behaviour of healthcare consumers, professionals and organisations. We searched the Cochrane Central Register of Controlled Trials (CENTRAL), Cochrane Effective Practice and Organisation of Care (EPOC) Trials Register, MEDLINE Ovid (from 1966), EMBASE Ovid (from 1979), CINAHL, PsycINFO Ovid (from 1806) and DARE up to 2011. We searched for randomised or quasi-randomised trials, interrupted time series and controlled before-after studies of the effects of publicly releasing data regarding any aspect of the performance of healthcare organisations or individuals. The papers had to report at least one main outcome related to selecting or changing care. Other outcome measures were awareness, attitude, views and knowledge of performance data and costs. Two review authors independently screened studies for eligibility and extracted data. For each study, we extracted data about the target groups (healthcare consumers, healthcare providers and healthcare purchasers), performance data, main outcomes (choice of healthcare provider and improvement by means of changes in care) and other outcomes (awareness, attitude, views, knowledge of performance data and costs). We included four studies containing more than 35,000 consumers, and 1560 hospitals. Three studies were conducted in the USA and examined consumer behaviour after the public release of performance data. Two studies found no effect of Consumer Assessment of Healthcare Providers and

  5. First version of a categorization of arguments for counting methods for publication and citation indicators

    DEFF Research Database (Denmark)

    Gauffriau, Marianne

    2016-01-01

    in four groups which can be used to describe and discuss how bibliometric studies with publication and citation indicators argue for counting methods. The first group focuses on arguments related to what an indicator measures, the next group on avoiding double counting of publications and/or citations......Due to the increasing number of authors per publication, a change in counting method for a publication or citation indicator will often change the result of the indicator. Therefore it is important to know why a specific counting method has been applied. I have analyzed arguments for counting...... methods in a sample of 13 recent bibliometric studies and compared the result with discussions of arguments for counting methods in three older studies. Based on the arguments in the studies I formed argument categories which were grouped based on the underlying logics of the arguments. It resulted...

  6. Publications in PubMed on Ebola and the 2014 outbreak [version 2; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Andrea Ballabeni

    2015-10-01

    Full Text Available In this research note we examine the biomedical publication output about Ebola in 2014. We show that the volume of publications has dramatically increased in the past year. In 2014 there have been over 888 publications with ‘ebola’ or ‘ebolavirus’ in the title, approximately 13 times the volume of publication of 2013. The rise reflects an impressive growth starting in the month of August, concomitant with or following the surge in infections, deaths and coverage in news and social media. Though non-research articles have been the major contributors to this growth, there has been a substantial increase in original research articles too, including many papers of basic science. The United States has been the country with the highest number of research articles, followed by Canada and the United Kingdom. We present a comprehensive set of charts and facts that, by describing the volumes and nature of publications in 2014, show how the scientific community has responded to the Ebola outbreak and how it might respond to future similar global threats and media events. This information will assist scholars and policymakers in their efforts to improve scientific research policies with the goal of maximizing both public health and knowledge advancement.

  7. The VIMOS Public Extragalactic Redshift Survey (VIPERS). Full spectroscopic data and auxiliary information release (PDR-2)

    CERN Document Server

    Scodeggio, M; Garilli, B; Granett, B R; Bolzonella, M; de la Torre, S; Abbas, U; Adami, C; Arnouts, S; Bottini, D; Cappi, A; Coupon, J; Cucciati, O; Davidzon, I; Franzetti, P; Fritz, A; Iovino, A; Krywult, J; Brun, V Le; Févre, O Le; Maccagni, D; Malek, K; Marchetti, A; Marulli, F; Polletta, M; Pollo, A; Tasca, L A M; Tojeiro, R; Vergani, D; Zanichelli, A; Bel, J; Branchini, E; De Lucia, G; Ilbert, O; McCracken, H J; Moutard, T; Peacock, J A; Zamorani, G; Burden, A; Fumana, M; Jullo, E; Marinoni, C; Mellier, Y; Moscardini, L; Percival, W J

    2016-01-01

    We present the full public data release (PDR-2) of the VIMOS Public Extragalactic Redshift Survey (VIPERS), performed at the ESO VLT. We release redshifts, spectra, CFHTLS magnitudes and ancillary information (as masks and weights) for a complete sample of 86,775 galaxies (plus 4,732 other objects, including stars and serendipitous galaxies); we also include their full photometrically-selected parent catalogue. The sample is magnitude limited to i_AB = 2 are shown to have a confidence level of 96% or larger and make up 88% of all measured galaxy redshifts (76,552 out of 86,775), constituting the VIPERS prime catalogue for statistical investigations. For this sample the rms redshift error, estimated using repeated measurements of about 3,000 galaxies, is found to be sigma_z = 0.00054(1+z). All data are available at http://vipers.inaf.it and on the ESO Archive.

  8. CALIFA, the Calar Alto Legacy Integral Field Area survey. III. Second public data release

    Science.gov (United States)

    García-Benito, R.; Zibetti, S.; Sánchez, S. F.; Husemann, B.; de Amorim, A. L.; Castillo-Morales, A.; Cid Fernandes, R.; Ellis, S. C.; Falcón-Barroso, J.; Galbany, L.; Gil de Paz, A.; González Delgado, R. M.; Lacerda, E. A. D.; López-Fernandez, R.; de Lorenzo-Cáceres, A.; Lyubenova, M.; Marino, R. A.; Mast, D.; Mendoza, M. A.; Pérez, E.; Vale Asari, N.; Aguerri, J. A. L.; Ascasibar, Y.; Bekerait*error*ė, S.; Bland-Hawthorn, J.; Barrera-Ballesteros, J. K.; Bomans, D. J.; Cano-Díaz, M.; Catalán-Torrecilla, C.; Cortijo, C.; Delgado-Inglada, G.; Demleitner, M.; Dettmar, R.-J.; Díaz, A. I.; Florido, E.; Gallazzi, A.; García-Lorenzo, B.; Gomes, J. M.; Holmes, L.; Iglesias-Páramo, J.; Jahnke, K.; Kalinova, V.; Kehrig, C.; Kennicutt, R. C.; López-Sánchez, Á. R.; Márquez, I.; Masegosa, J.; Meidt, S. E.; Mendez-Abreu, J.; Mollá, M.; Monreal-Ibero, A.; Morisset, C.; del Olmo, A.; Papaderos, P.; Pérez, I.; Quirrenbach, A.; Rosales-Ortega, F. F.; Roth, M. M.; Ruiz-Lara, T.; Sánchez-Blázquez, P.; Sánchez-Menguiano, L.; Singh, R.; Spekkens, K.; Stanishev, V.; Torres-Papaqui, J. P.; van de Ven, G.; Vilchez, J. M.; Walcher, C. J.; Wild, V.; Wisotzki, L.; Ziegler, B.; Alves, J.; Barrado, D.; Quintana, J. M.; Aceituno, J.

    2015-04-01

    This paper describes the Second Public Data Release (DR2) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. The data for 200 objects are made public, including the 100 galaxies of the First Public Data Release (DR1). Data were obtained with the integral-field spectrograph PMAS/PPak mounted on the 3.5 m telescope at the Calar Alto observatory. Two different spectral setups are available for each galaxy, (i) a low-resolution V500 setup covering the wavelength range 3745-7500 Å with a spectral resolution of 6.0 Å (FWHM); and (ii) a medium-resolution V1200 setup covering the wavelength range 3650-4840 Å with a spectral resolution of 2.3 Å (FWHM). The sample covers a redshift range between 0.005 and 0.03, with a wide range of properties in the color-magnitude diagram, stellar mass, ionization conditions, and morphological types. All the cubes in the data release were reduced with the latest pipeline, which includes improvedspectrophotometric calibration, spatial registration, and spatial resolution. The spectrophotometric calibration is better than 6% and the median spatial resolution is 2.̋4. In total, the second data release contains over 1.5 million spectra. Based on observations collected at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated jointly by the Max-Planck-Institut für Astronomie (MPIA) and the Instituto de Astrofísica de Andalucía (CSIC).The second data release is available at http://califa.caha.es/DR2

  9. Visibility of latin american scientific publications: the example of Bolivia (Portuguese original version

    Directory of Open Access Journals (Sweden)

    Silvia Cristina Pabón Escobar

    2006-06-01

    Full Text Available The discussion on the state of the art of scientific publications in Latin American countries generally restricts itself to its supposedly low visibility. This affirmation is generally conditioned to the exclusive use of large international databases, mainly of the USA and Europe, which include thousands of scientific publications that have marginalized a large part of the scientific literature produced in peripheral countries. Given this fact of low visibility, it became imperative for some Latin American countries, beginning in the 90s (20th Century, to develop their own mechanisms of projection of the results of their own scientific production. The experiences constitute an example for countries that, having significant scientific production, still do not have the means to facilitate access to local scientific publications. Although Bolivia still remains distant from these initiatives, a series of studies were identified that show the existence of a tradition of publication in scientific magazines and interest in their visibility, on a local and international level, which demands attention to the most adequate mechanisms in order to carry this out.

  10. CALIFA, the Calar Alto Legacy Integral Field Area survey. III. Second public data release

    CERN Document Server

    García-Benito, R; Sánchez, S F; Husemann, B; de Amorim, A L; Castillo-Morales, A; Fernandes, R Cid; Ellis, S C; Falcón-Barroso, J; Galbany, L; de Paz, A Gil; Delgado, R M González; Lacerda, E A D; López-Fernandez, R; de Lorenzo-Cáceres, A; Lyubenova, M; Marino, R A; Mast, D; Mendoza, M A; Pérez, E; Asari, N Vale; Aguerri, J A L; Ascasibar, Y; Bekeraitė, S; Bland-Hawthorn, J; Barrera-Ballesteros, J K; Cano-Díaz, M; Catalán-Torrecilla, C; Cortijo, C; Delgado-Inglada, G; Demleitner, M; Dettmar, R -J; Díaz, A I; Florido, E; Gallazzi, A; García-Lorenzo, B; Gomes, J M; Holmes, L; Iglesias-Páramo, J; Jahnke, K; Kalinova, V; Kehrig, C; Kennicutt, R C; López-Sánchez, Á R; Márquez, I; Masegosa, J; Meidt, S E; Mendez-Abreu, J; Mollá, M; Monreal-Ibero, A; Morisset, C; del Olmo, A; Papaderos, P; Pérez, I; Quirrenbach, A; Rosales-Ortega, F F; Roth, M M; Ruiz-Lara, T; Sánchez-Blázquez, P; Sánchez-Menguiano, L; Singh, R; Spekkens, K; Stanishev, V; Torres-Papaqui, J P; van de Ven, G; Vilchez, J M; Walcher, C J; Wild, V; Wisotzki, L; Ziegler, B; Aceituno, J

    2014-01-01

    This paper describes the Second Public Data Release (DR2) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. The data for 200 objects are made public, including the 100 galaxies of the First Public Data Release (DR1). Data were obtained with the integral-field spectrograph PMAS/PPak mounted on the 3.5 m telescope at the Calar Alto observatory. Two different spectral setups are available for each galaxy, (i) a low-resolution V500 setup covering the wavelength range 3745-7500 \\AA\\ with a spectral resolution of 6.0 \\AA\\ (FWHM), and (ii) a medium-resolution V1200 setup covering the wavelength range 3650-4840 \\AA\\ with a spectral resolution of 2.3 \\AA\\ (FWHM). The sample covers a redshift range between 0.005 and 0.03, with a wide range of properties in the Color-Magnitude diagram, stellar mass, ionization conditions, and morphological types. All released cubes were reduced with the latest pipeline, including improved spectrophotometric calibration, spatial registration and spatial resolution. The spectr...

  11. The Spanish Version of the Self-Statements during Public Speaking Scale: Validation in Adolescents

    OpenAIRE

    Rivero, Raul; Garcia-Lopez, LuisJoaquin; Hofmann, Stefan G.

    2010-01-01

    Contemporary theories of social anxiety emphasize the role of cognitive processes. Although social anxiety disorder is one of the most common mental health problems in adolescents, there are very few self-report instruments available to measure cognitive processes related to social anxiety in adolescents, let alone non-English instruments. The Self-Statements during Public Speaking Scale (SSPS; Hofmann & DiBartolo, 2000) is a brief self-report measure designed to assess self-statements relate...

  12. BITRU: Binary Version of the NTRU Public Key Cryptosystem via Binary Algebra

    Directory of Open Access Journals (Sweden)

    Nadia M.G. Alsaidi

    2016-11-01

    Full Text Available New terms such as closest vector problem (CVP and the shortest vector problem (SVP, which have been illustrated as NP-hard problem, emerged, leading to a new hope for designing public key cryptosystem based on certain lattice hardness. A new cryptosystem called NTRU is proven computationally efficient and it can be implemented with low cost. With these characteristics, NTRU possesses advantage over others system that rely on number-theoretical problem in a finite field (e.g. integer factorization problem or discrete logarithm problem. These advantages make NTRU a good choice for many applications. After the adaptation of NTRU, many attempts to generalize its algebraic structure have appeared. In this study, a new variant of the NTRU public key cryptosystem called BITRU is proposed. BITRU is based on a new algebraic structure used as an alternative to NTRU-mathematical structure called binary algebra. This commutative and associative. Establishing two public keys in the proposed system has distinguished it from NTRU and those similar to NTRU cryptosystems. This new structure helps to increase the security and complexity of BITRU. The clauses of BITRU, which include key generation, encryption, decryption, and decryption failure, are explained in details. Its suitability of the proposed system is proven and its security is demonstrated by comparing it with NTRU.

  13. What does the UK public want from academic science communication? [version 1; referees: 3 approved

    Directory of Open Access Journals (Sweden)

    James Redfern

    2016-06-01

    Full Text Available The overall aim of public academic science communication is to engage a non-scientist with a particular field of science and/or research topic, often driven by the expertise of the academic. An e-survey was designed to provide insight into respondent’s current and future engagement with science communication activities. Respondents provided a wide range of ideas and concerns as to the ‘common practice’ of academic science communication, and whilst they support some of these popular approaches (such as open-door events and science festivals, there are alternatives that may enable wider engagement. Suggestions of internet-based approaches and digital media were strongly encouraged, and although respondents found merits in methods such as science festivals, limitations such as geography, time and topic of interest were a barrier to engagement for some. Academics and scientists need to think carefully about how they plan their science communication activities and carry out evaluations, including considering the point of view of the public, as although defaulting to hands-on open door events at their university may seem like the expected standard, it may not be the best way to reach the intended audience.

  14. CALIFA, the Calar Alto Legacy Integral Field Area survey: IV. Third Public data release

    CERN Document Server

    Sánchez, S F; Zibetti, S; Walcher, C J; Husemann, B; Mendoza, M A; Galbany, L; Falcón-Barroso, J; Mast, D; Aceituno, J; Aguerri, J A L; Alves, J; Amorim, A L; Ascasibar, Y; Barrado-Navascues, D; Barrera-Ballesteros, J; Bekeraite, S; Bland-Hawthorn, J; Díaz, M Cano; Fernandes, R Cid; Cavichia, O; Cortijo, C; Dannerbauer, H; Demleitner, M; Díaz, A; Dettmar, R J; de Lorenzo-Cáceres, A; del Olmo, A; Gallazzi, A; García-Lorenzo, B; de Paz, A Gil; Delgado, R González; Holmes, L; Iglésias-Páramo, J; Kehrig, C; Kelz, A; Kennicutt, R C; Kleemann, B; Lacerda, E A D; Fernández, R López; Sánchez, A R López; Lyubenova, M; Marino, R; Márquez, I; Mendez-Abreu, J; Mollá, M; Minakata, R Ortega; Torres-Papaqui, J P; Pérez, E; Rosales-Ortega, F F; Roth, M M; Sánchez-Blázquez, P; Schilling, U; Spekkens, K; Asari, N Vale; Bosch, R C E van den; van de Ven, G; Vilchez, J M; Wild, V; Wisotzki, L; Yıldırım, A; Ziegler, B

    2016-01-01

    This paper describes the Third Public Data Release (DR3) of the Calar Alto Legacy Integral Field Area (CALIFA) survey. Science-grade quality data for 667 galaxies are made public, including the 200 galaxies of the Second Public Data Release (DR2). Data were obtained with the integral-field spectrograph PMAS/PPak mounted on the 3.5m telescope at the Calar Alto Observatory. Three different spectral setups are available, i) a low-resolution V500 setup covering the wavelength range 3749-7500 AA (4240-7140 AA unvignetted) with a spectral resolution of 6.0 AA (FWHM), for 646 galaxies, ii) a medium-resolution V1200 setup covering the wavelength range 3650-4840 AA (3650-4620 AA unvignetted) with a spectral resolution of 2.3 AA (FWHM), for 484 galaxies, and iii) the combination of the cubes from both setups (called COMBO), with a spectral resolution of 6.0 AA and a wavelength range between 3700-7500 AA (3700-7140 AA unvignetted), for 446 galaxies. The Main Sample, selected and observed according to the CALIFA survey s...

  15. Data Mining of the Public Version of the FDA Adverse Event Reporting System

    Science.gov (United States)

    Sakaeda, Toshiyuki; Tamon, Akiko; Kadoyama, Kaori; Okuno, Yasushi

    2013-01-01

    The US Food and Drug Administration (FDA) Adverse Event Reporting System (FAERS, formerly AERS) is a database that contains information on adverse event and medication error reports submitted to the FDA. Besides those from manufacturers, reports can be submitted from health care professionals and the public. The original system was started in 1969, but since the last major revision in 1997, reporting has markedly increased. Data mining algorithms have been developed for the quantitative detection of signals from such a large database, where a signal means a statistical association between a drug and an adverse event or a drug-associated adverse event, including the proportional reporting ratio (PRR), the reporting odds ratio (ROR), the information component (IC), and the empirical Bayes geometric mean (EBGM). A survey of our previous reports suggested that the ROR provided the highest number of signals, and the EBGM the lowest. Additionally, an analysis of warfarin-, aspirin- and clopidogrel-associated adverse events suggested that all EBGM-based signals were included in the PRR-based signals, and also in the IC- or ROR-based ones, and that the PRR- and IC-based signals were in the ROR-based ones. In this article, the latest information on this area is summarized for future pharmacoepidemiological studies and/or pharmacovigilance analyses. PMID:23794943

  16. SDSS-IV MaNGA: Data Products, Quality, and Initial Public Release

    Science.gov (United States)

    Law, David R.; Cherinka, Brian; MaNGA Team

    2016-01-01

    As a spectroscopic imaging survey, MaNGA presents a host of technical challenges ranging from spectrophotometic calibration to image reconstruction. I will present an overview of the MaNGA data reduction pipeline (DRP) and the algorithms used to process the MaNGA data. Additionally, I will describe the format and quality of the MaNGA data products, and the means by which the first year of survey data will be made publicly available in SDSS Data Release 13 (DR-13).

  17. Developing and validating a tablet version of an illness explanatory model interview for a public health survey in Pune, India.

    Directory of Open Access Journals (Sweden)

    Joseph G Giduthuri

    Full Text Available BACKGROUND: Mobile electronic devices are replacing paper-based instruments and questionnaires for epidemiological and public health research. The elimination of a data-entry step after an interview is a notable advantage over paper, saving investigator time, decreasing the time lags in managing and analyzing data, and potentially improving the data quality by removing the error-prone data-entry step. Research has not yet provided adequate evidence, however, to substantiate the claim of fewer errors for computerized interviews. METHODOLOGY: We developed an Android-based illness explanatory interview for influenza vaccine acceptance and tested the instrument in a field study in Pune, India, for feasibility and acceptability. Error rates for tablet and paper were compared with reference to the voice recording of the interview as gold standard to assess discrepancies. We also examined the preference of interviewers for the classical paper-based or the electronic version of the interview and compared the costs of research with both data collection devices. RESULTS: In 95 interviews with household respondents, total error rates with paper and tablet devices were nearly the same (2.01% and 1.99% respectively. Most interviewers indicated no preference for a particular device; but those with a preference opted for tablets. The initial investment in tablet-based interviews was higher compared to paper, while the recurring costs per interview were lower with the use of tablets. CONCLUSION: An Android-based tablet version of a complex interview was developed and successfully validated. Advantages were not compromised by increased errors, and field research assistants with a preference preferred the Android device. Use of tablets may be more costly than paper for small samples and less costly for large studies.

  18. Exploring Bioeconomy Growth through the Public Release of the Biomass Scenario Model

    Energy Technology Data Exchange (ETDEWEB)

    Newes, Emily K [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Biddy, Mary J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bush, Brian W [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Inman, Daniel J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Vimmerstedt, Laura J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Peterson, Steve [Lexidyne, LLC

    2017-08-02

    The Biomass Scenario Model (BSM) is an important tool for exploring vibrant future bioeconomy scenarios that leverage domestic resources. Developed by NREL and BETO, this model of the domestic biofuels supply chain has been used to explore success strategies for BETO's activities towards bioeconomy growth. The BSM offers a robust test bed for detailed exploration of effects of BETO activities within the complex context of resource availability; physical, technological, and economic constraints; behavior; and policy. The public release of the model in 2017 will allow broad engagement with the theme of the conference as model users can analyze bioeconomy growth, domestic biomass resource use, and associated effects. The BSM is a carefully validated, state-of-the-art, dynamic model of the biomass to biofuels supply chain. Using a system dynamics simulation modeling approach, the model tracks long-term deployment of biofuels given technology development and investment, considering land availability, the competing oil market, consumer demand, and government policies over time. Sample outputs include biofuels production, feedstock use, capital investment, incentives, and costs of feedstocks and fuels. BSM scenarios reveal technological, economic, and policy challenges, as well as opportunities for dynamic growth of the bioeconomy with strategic public and private investment at key points in the system. The model logic and results have been reviewed extensively, through collaborative analysis, expert reviews and external publications (https://www.zotero.org/groups/bsm_publications/).

  19. Preparations for the public release of high-level CMS data

    CERN Document Server

    McCauley, Thomas

    2014-01-01

    The CMS Collaboration is preparing for a public release up to a half of the reconstructed collision data collected in 2010, in accordance with its commitment to open access and data preservation. Efforts are at present focused on the usability of the data in education. The data will be accompanied by example applications tailored for different levels, including ready-to-use web-based applications for histogramming or visualising individual collision events, and a virtual machine image of the CMS software environment that is compatible with these data. The VM image will contain instructions for using the data with the online applications as well as examples of simple analyses. The novelty of this initiative is two-fold: in terms of open science, it lies in releasing the data in a format that is good for analysis; from an outreach perspective, it is to provide the possibility for people outside CMS to build educational applications using our public data. CMS will rely on services for data preservation and open ...

  20. The effects of a Dutch version of an Internet-based treatment program for fear of public speaking: a controlled study

    NARCIS (Netherlands)

    Gallego, M.J.; Emmelkamp, P.M.G.; van der Kooij, M.; Mees, H.

    2011-01-01

    The present research is a randomized controlled trial in which the effects of a Dutch version of «Talk to me», an Internet-based cognitive-behavioral treatment for fear of public speaking were investigated. Forty one participants with a formal diagnosis of social phobia were assigned at random to ei

  1. The effects of a Dutch version of an Internet-based treatment program for fear of public speaking: a controlled study

    NARCIS (Netherlands)

    Gallego, M.J.; Emmelkamp, P.M.G.; van der Kooij, M.; Mees, H.

    2011-01-01

    The present research is a randomized controlled trial in which the effects of a Dutch version of «Talk to me», an Internet-based cognitive-behavioral treatment for fear of public speaking were investigated. Forty one participants with a formal diagnosis of social phobia were assigned at random to

  2. Documentation to the NCES Common Core of Data Public Elementary/Secondary School Universe Survey: School Year 2011-12. Provisional Version 1a. NCES 2014-100

    Science.gov (United States)

    Keaton, Patrick

    2013-01-01

    The documentation for this provisional version 1a file of the National Center for Education Statistics' (NCES) Common Core of Data (CCD) Public Elementary/Secondary School Universe Survey for SY 2011-12, contains a brief description of the data collection, along with information required to understand and access the data file. The SY 2011-12…

  3. Reliability Growth Modeling and Optimal Release Policy Under Fuzzy Environment of an N-version Programming System Incorporating the Effect of Fault Removal Efficiency

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Failure of a safety critical system can lead to big losses. Very high software reliability is required for automating the working of systems such as aircraft controller and nuclear reactor controller software systems. Fault-tolerant softwares are used to increase the overall reliability of software systems. Fault tolerance is achieved using the fault-tolerant schemes such as fault recovery (recovery block scheme), fault masking (N-version programming (NVP)) or a combination of both (Hybrid scheme). These softwares incorporate the ability of system survival even on a failure. Many researchers in the field of software engineering have done excellent work to study the reliability of fault-tolerant systems. Most of them consider the stable system reliability. Few attempts have been made in reliability modeling to study the reliability growth for an NVP system. Recently, a model was proposed to analyze the reliability growth of an NVP system incorporating the effect of fault removal efficiency. In this model, a proportion of the number of failures is assumed to be a measure of fault generation while an appropriate measure of fault generation should be the proportion of faults removed. In this paper, we first propose a testing efficiency model incorporating the effect of imperfect fault debugging and error generation. Using this model, a software reliability growth model (SRGM) is developed to model the reliability growth of an NVP system. The proposed model is useful for practical applications and can provide the measures of debugging effectiveness and additional workload or skilled professional required. It is very important for a developer to determine the optimal release time of the software to improve its performance in terms of competition and cost. In this paper, we also formulate the optimal software release time problem for a 3VP system under fuzzy environment and discuss a the fuzzy optimization technique for solving the problem with a numerical illustration.

  4. Evaluation of Environmental Information Products for Search and Rescue Optimal Planning System (SAROPS) - Version for Public Release

    Science.gov (United States)

    2008-02-01

    MACOORA Mid-Atlantic Coastal Ocean Observing Regional Association mb Millibar MBARI Monterey Bay Aquarium Research Institute MCSST Multi-channel Sea...St. John’s River Operational Forecast System SkIO Skidaway Institute of Oceanography, University of Georgia , SLDMB Self-locating Datum Marker Buoy...Diego UGA University of Georgia UM University of Miami UMCES University of Maryland, Center for Environmental Studies UNC University of North Carolina

  5. E-Control: First Public Release of Remote Control Software for VLBI Telescopes

    Science.gov (United States)

    Neidhardt, Alexander; Ettl, Martin; Rottmann, Helge; Ploetz, Christian; Muehlbauer, Matthias; Hase, Hayo; Alef, Walter; Sobarzo, Sergio; Herrera, Cristian; Himwich, Ed

    2010-01-01

    Automating and remotely controlling observations are important for future operations in a Global Geodetic Observing System (GGOS). At the Geodetic Observatory Wettzell, in cooperation with the Max-Planck-Institute for Radio Astronomy in Bonn, a software extension to the existing NASA Field System has been developed for remote control. It uses the principle of a remotely accessible, autonomous process cell as a server extension for the Field System. The communication is realized for low transfer rates using Remote Procedure Calls (RPC). It uses generative programming with the interface software generator idl2rpc.pl developed at Wettzell. The user interacts with this system over a modern graphical user interface created with wxWidgets. For security reasons the communication is automatically tunneled through a Secure Shell (SSH) session to the telescope. There are already successful test observations with the telescopes at O Higgins, Concepcion, and Wettzell. At Wettzell the software is already used routinely for weekend observations. Therefore the first public release of the software is now available, which will also be useful for other telescopes.

  6. CALIFA, the Calar Alto Legacy Integral Field Area survey: II. First public data release

    CERN Document Server

    Husemann, B; Sánchez, S F; Barrado-Navascues, D; Bekeraitė, S; Bomans, D J; Castillo-Morales, A; Catalán-Torrecilla, C; Fernandes, R Cid; Falcón-Barroso, J; García-Benito, R; Delgado, R M González; Iglesias-Páramo, J; Johnson, B D; Kupko, D; López-Fernandez, R; Lyubenova, M; Marino, R A; Mast, D; Miskolczi, A; Monreal-Ibero, A; de Paz, A Gil; Pérez, E; Pérez, I; Rosales-Ortega, F F; Ruiz-Lara, T; Schilling, U; van de Ven, G; Walcher, J; Alves, J; de Amorim, A L; Backsmann, N; Barrera-Ballesteros, J K; Bland-Hawthorn, J; Dettmar, R -J; Demleitner, M; Díaz, A I; Enke, H; Florido, E; Flores, H; Galbany, L; Gallazzi, A; García-Lorenzo, B; Gomes, J M; Gruel, N; Haines, T; Holmes, L; Jungwiert, B; Kalinova, V; Kehrig, C; Kennicutt, R C; Klar, J; Lehnert, M D; Lóez-Sáchez, Á R; de Lorenzo-Cáceres, A; Mármol-Queraltó, E; Márquez, I; Mendez-Abreu, J; Mollá, M; del Olmo, A; Meidt, S E; Papaderos, P; Puschnig, J; Quirrenbach, A; Roth, M M; Sánchez-Blázquez, P; Spekkens, K; Singh, R; Stanishev, V; Trager, S C; Vilchez, J M; Wild, V; Wisotzki, L; Zibetti, S; Ziegler, B

    2012-01-01

    We present the first public data release of the CALIFA survey. It consists of science-grade optical datacubes for the first 100 of eventually 600 nearby (0.005

  7. Coverage of Team Science by Public Information Officers: Content Analysis of Press Releases about the National Science Foundation Science and Technology Centers

    Science.gov (United States)

    Graube, Marita; Clark, Fiona; Illman, Deborah L.

    2010-01-01

    This study examines the content of press releases from the National Science Foundation (NSF) Science and Technology Centers (STCs) to determine how public information officers (PIOs) presented the outcomes of centers to journalists and the public. A total of 68 press releases were analyzed for type of news covered, visibility of centers and their…

  8. Public Infrastructure for Monte Carlo Simulation: publicMC@BATAN

    CERN Document Server

    Waskita, A A; Akbar, Z; Handoko, L T; 10.1063/1.3462759

    2010-01-01

    The first cluster-based public computing for Monte Carlo simulation in Indonesia is introduced. The system has been developed to enable public to perform Monte Carlo simulation on a parallel computer through an integrated and user friendly dynamic web interface. The beta version, so called publicMC@BATAN, has been released and implemented for internal users at the National Nuclear Energy Agency (BATAN). In this paper the concept and architecture of publicMC@BATAN are presented.

  9. NESHAP Dose-Release Factor Isopleths for Five Source-to-Receptor Distances from the Center of Site and H-Area for all Compass Sectors at SRS using CAP88-PC Version 4.0

    Energy Technology Data Exchange (ETDEWEB)

    Trimor, P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-08-09

    The Environmental Protection Agency (EPA) requires the use of the computer model CAP88-PC to estimate the total effective doses (TED) for demonstrating compliance with 40 CFR 61, Subpart H (EPA 2006), the National Emission Standards for Hazardous Air Pollutants (NESHAP) regulations. As such, CAP88 Version 4.0 was used to calculate the receptor dose due to routine atmospheric releases at the Savannah River Site (SRS). For estimation, NESHAP dose-release factors (DRFs) have been supplied to Environmental Compliance and Area Closure Projects (EC&ACP) for many years. DRFs represent the dose to a maximum receptor exposed to 1 Ci of a specified radionuclide being released into the atmosphere. They are periodically updated to include changes in the CAP88 version, input parameter values, site meteorology, and location of the maximally exposed individual (MEI). This report presents the DRFs of tritium oxide released at two onsite locations, center-of-site (COS) and H-Area, at 0 ft. elevation to maximally exposed individuals (MEIs) located 1000, 3000, 6000, 9000, and 12000 meters from the release areas for 16 compass sectors. The analysis makes use of area-specific meteorological data (Viner 2014).

  10. Public participation and rural management of Brazilian waters: an alternative to the deficit model (Portuguese original version

    Directory of Open Access Journals (Sweden)

    Alessandro Luís Piolli

    2008-12-01

    Full Text Available The knowledge deficit model with regard to the public has been severely criticized in the sociology of the public perception of science. However, when dealing with public decisions regarding scientific matters, political and scientific institutions insist on defending the deficit model. The idea that only certified experts, or those with vast experience, should have the right to participate in decisions can bring about problems for the future of democracies. Through a type of "topography of ideas", in which some concepts from the social studies of science are used in order to think about these problems, and through the case study of public participation in the elaboration of the proposal of discounts in the fees charged for rural water use in Brazil, we will try to point out an alternative to the deficit model. This alternative includes a "minimum comprehension" of the scientific matters involved in the decision on the part of the participants, using criteria judged by the public itself.

  11. Korean version of the notification policy on sexual offenders: did it enhance public awareness of sexual crimes against minors?

    Science.gov (United States)

    Shin, Junseob; Lee, Young-Boon

    2005-08-01

    This study reviewed the public notification policy of sexual offenders against minors in South Korea as compared to community notification programs in the United States. The study then examined the policy's impact on increasing the general public's awareness of such sexual crimes. This is based on the assumption that heightening public awareness can be a starting point in combating such crimes. Results of the data, drawn from a sample of 1,409 Koreans across the nation, showed that the notification policy enhanced public awareness. Factors related to this increase in awareness were people's concern about or familiarity with the policy and people's experience in identifying the existence of known sexual offenders in their communities. Based on the results of this study, strategies for enhancing public awareness of sexual crimes on minors were formulated. The need to develop treatment programs for sexual offenders was likewise highlighted.

  12. ILO Publications in Chinese Version%国际劳工组织中文版图书及资料

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ Encyclopedia of Occupational Health and Safety (Fourth Edition) in Chinese and English Versions (第四版)是在国际劳工局大力指导和积极支持下,由世界60 多个国家,上千名职业安全与卫生专家学者参与讨论编撰完成的,由Jeanne Mager Stellman 主编.本书中文版于2000 年3 月由中国劳动社会保障出版社正式出版发行.

  13. All-Ages Lead Model (Aalm) Version 1.05 (External Draft Report)

    Science.gov (United States)

    The All-Ages Lead Model (AALM) Version 1.05, is an external review draft software and guidance manual. EPA released this software and associated documentation for public review and comment beginning September 27, 2005, until October 27, 2005. The public comments will be accepte...

  14. 32 CFR 705.6 - Releasing public information material to the media.

    Science.gov (United States)

    2010-07-01

    ... interest (and in the case of audiovisual material of regional interest) and for arranging for local release... command concerned. (B) An event of immediate and urgent news interest, such as a disasterous accident... reason for conducting a news conference. Special events, significant operations or serious accidents are...

  15. PESSTO : survey description and products from the first data release by the Public ESO Spectroscopic Survey of Transient Objects

    CERN Document Server

    Smartt, S J; Fraser, M; Inserra, C; Young, D R; Sullivan, M; Pastorello, A; Benetti, S; Gal-Yam, A; Knapic, C; Molinaro, M; Smareglia, R; Smith, K W; Taubenberger, S; Yaron, O; Anderson, J P; Ashall, C; Balland, C; Baltay, C; Barbarino, C; Bauer, F E; Baumont, S; Bersier, D; Blagorodnova, N; Bongard, S; Botticella, M T; Bufano, F; Bulla, M; Cappellaro, E; Campbell, H; Cellier-Holzem, F; Chen, T -W; Childress, M J; Clocchiatti, A; Contreras, C; Ora, M Dall; Danziger, J; de Jaeger, T; Della Valle, M; Dennefeld, M; Elias-Rosa, N; Elman, N; Feindt, U; Fleury, M; Gall, E; Gonzalez-Gaitan, S; Galbany, L; Greggio, L; Guillou, L L; Hachinger, S; Hadjiyska, E; Hage, P E; Hillebrandt, W; Hodgkin, S; Hsiao, E Y; James, P A; Jerkstrand, A; Kangas, T; Kankare, E; Kotak, R; Kromer, M; Kuncarayakti, H; Leloudas, G; Lundqvist, P; Hook, I M; Maguire, K; Manulis, I; Margheim, S J; Mattila, S; Maund, J R; Mazzali, P A; McCrum, M; McKinnon, R; Moreno-Raya, M E; Nicholl, M; Nugent, P; Pain, R; Phillips, M M; Pignata, G; Polshaw, J; Pumo, M L; Rabinowitz, D; Reilly, E; Romero-Canizales, C; Scalzo, R; Schmidt, B; Schulze, S; Sim, S; Sollerman, J; Taddia, F; Tartaglia, L; Terreran, G; Tomasella, L; Turatto, M; Walker, E; Walton, N A; Wyrzykowski, L; Yuan, F; Zampieri, L

    2014-01-01

    The Public European Southern Observatory Spectroscopic Survey of Transient Objects (PESSTO) began as a public spectroscopic survey in April 2012. We describe the data reduction strategy and data products which are publicly available through the ESO archive as the Spectroscopic Survey Data Release 1 (SSDR1). PESSTO uses the New Technology Telescope with EFOSC2 and SOFI to provide optical and NIR spectroscopy and imaging. We target supernovae and optical transients brighter than 20.5mag for classification. Science targets are then selected for follow-up based on the PESSTO science goal of extending knowledge of the extremes of the supernova population. The EFOSC2 spectra cover 3345-9995A (at resolutions of 13-18 Angs) and SOFI spectra cover 0.935-2.53 micron (resolutions 23-33 Angs) along with JHK imaging. This data release contains spectra from the first year (April 2012 - 2013), consisting of all 814 EFOSC2 spectra and 95 SOFI spectra (covering 298 distinct objects), in standard ESO Phase 3 format. We estimat...

  16. Open Online Courses in Public Health: experience from Peoples-uni [version 1; referees: 1 approved, 2 approved with reservations

    Directory of Open Access Journals (Sweden)

    Richard F. Heller

    2017-02-01

    Full Text Available Open Online Courses (OOCs are offered by Peoples-uni at http://ooc.peoples-uni.org to complement the courses run on a separate site for academic credit at http://courses.peoples-uni.org. They provide a wide range of online learning resources beyond those usually found in credit bearing Public Health courses. They are self-paced, and students can enrol themselves at any time and utilise Open Educational Resources free of copyright restrictions.  In the two years that courses have been running, 1174 students from 100 countries have registered and among the 1597 enrollments in 15 courses, 15% gained a certificate of completion. Easily accessible and appealing to a wide geographical and professional audience, OOCs have the potential to play a part in establishing global Public Health capacity building programmes.

  17. Open Online Courses in Public Health: experience from Peoples-uni [version 2; referees: 1 approved, 2 approved with reservations

    Directory of Open Access Journals (Sweden)

    Richard F. Heller

    2017-04-01

    Full Text Available Open Online Courses (OOCs are offered by Peoples-uni at http://ooc.peoples-uni.org to complement the courses run on a separate site for academic credit at http://courses.peoples-uni.org. They provide a wide range of online learning resources beyond those usually found in credit bearing Public Health courses. They are self-paced, and students can enrol themselves at any time and utilise Open Educational Resources free of copyright restrictions.  In the two years that courses have been running, 1174 students from 100 countries have registered and among the 1597 enrolments in 14 courses, 15% gained a certificate of completion. Easily accessible and appealing to a wide geographical and professional audience, OOCs have the potential to play a part in establishing global Public Health capacity building programmes.

  18. Validity and reliability of Turkish version of "Hospital Survey on Patient Safety Culture" and perception of patient safety in public hospitals in Turkey

    Directory of Open Access Journals (Sweden)

    Filiz Emel

    2010-01-01

    Full Text Available Abstract Background The Hospital Survey on Patient Safety Culture (HSOPS is used to assess safety culture in many countries. Accordingly, the questionnaire has been translated into Turkish for the study of patient safety culture in Turkish hospitals. The aim of this study is threefold: to determine the validity and reliability of the translated form of HSOPS, to evaluate physicians' and nurses' perceptions of patient safety in Turkish public hospitals, and to compare finding with U.S. hospital settings. Methods Physicians and nurses working in all public hospitals in Konya, a large city in Turkey, were asked to complete a self-administrated patient safety culture survey (n = 309. Data collection was carried out using the Turkish version of HSOPS, developed by Agency for Healthcare Research and Quality (AHRQ. Data were summarized as percentages, means, and SD values. Factor analysis, correlation coefficient, Cronbach's alpha, ANOVA, and t tests were employed in statistical analyses. Items on patient safety were categorized into 10 factors. Factor loadings and internal consistencies of dimension items were high. Results Most of the scores related to dimensions, and the overall patient safety score (44% were lower than the benchmark score. "Teamwork within hospital units" received the highest score (70%, and the lowest score belonged to the "frequency of events reported" (15%. The study revealed that more than three quarters of the physicians and nurses were not reporting errors. Conclusion The Turkish version of HSOPS was found to be valid and reliable in determining patient safety culture. This tool will be helpful in tracking improvements and in heightening awareness on patient safety culture in Turkey.

  19. Key aspects of a Flemish system to safeguard public health interests in case of chemical release incidents.

    Science.gov (United States)

    Smolders, Roel; Colles, Ann; Cornelis, Christa; Van Holderbeke, Mirja; Chovanova, Hana; Wildemeersch, Dirk; Mampaey, Maja; Van Campenhout, Karen

    2014-12-15

    Although well-established protocols are available for emergency services and first-responders in case of chemical release incidents, a well-developed system to monitor and safeguard public health was, until recently, lacking in Flanders. We therefore developed a decision support system (DSS) to aid public health officials in identifying the appropriate actions in case of incidents. Although the DSS includes human biomonitoring as one of its key instruments, it also goes well beyond this instrument alone. Also other, complementary, approaches that focus more on effect assessment using in vitro toxicity testing, indirect exposures through the food chain, and parallel means of data collection (e.g. through ecosurveillance or public consultation), are integrated in the Flemish approach. Even though the DSS is set up to provide a flexible and structured decision tree, the value of expert opinion is deemed essential to account for the many uncertainties associated with the early phases of technological incidents. When the DSS and the associated instruments will be fully operational, it will provide a valuable addition to the already available protocols, and will specifically safeguard public health interests.

  20. ACUTRI: a computer code for assessing doses to the general public due to acute tritium releases

    Energy Technology Data Exchange (ETDEWEB)

    Yokoyama, Sumi; Noguchi, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Ryufuku, Susumu; Sasaki, Toshihisa; Kurosawa, Naohiro [Visible Information Center, Inc., Tokai, Ibaraki (Japan)

    2002-11-01

    Tritium, which is used as a fuel of a D-T burning fusion reactor, is the most important radionuclide for the safety assessment of a nuclear fusion experimental reactor such as ITER. Thus, a computer code, ACUTRI, which calculates the radiological impact of tritium released accidentally to the atmosphere, has been developed, aiming to be of use in a discussion of licensing of a fusion experimental reactor and an environmental safety evaluation method in Japan. ACUTRI calculates an individual tritium dose based on transfer models specific to tritium in the environment and ICRP dose models. In this calculation it is also possible to analyze statistically on meteorology in the same way as a conventional dose assessment method according to the meteorological guide of the Nuclear Safety Commission of Japan. A Gaussian plume model is used for calculating the atmospheric dispersion of tritium gas (HT) and/or tritiated water (HTO). The environmental pathway model in ACUTRI considers the following internal exposures: inhalation from a primary plume (HT and/or HTO) released from the facilities and inhalation from a secondary plume (HTO) reemitted from the ground following deposition of HT and HTO. This report describes an outline of the ACUTRI code, a user guide and the results of test calculation. (author)

  1. Reference computations of public dose and cancer risk from airborne releases of uranium and Class W plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, V.L.

    1995-06-06

    This report presents ``reference`` computations that can be used by safety analysts in the evaluations of the consequences of postulated atmospheric releases of radionuclides from the Rocky Flats Environmental Technology Site. These computations deal specifically with doses and health risks to the public. The radionuclides considered are Class W Plutonium, all classes of Enriched Uranium, and all classes of Depleted Uranium. (The other class of plutonium, Y, was treated in an earlier report.) In each case, one gram of the respirable material is assumed to be released at ground leveL both with and without fire. The resulting doses and health risks can be scaled to whatever amount of release is appropriate for a postulated accident being investigated. The report begins with a summary of the organ-specific stochastic risk factors appropriate for alpha radiation, which poses the main health risk of plutonium and uranium. This is followed by a summary of the atmospheric dispersion factors for unfavorable and typical weather conditions for the calculation of consequences to both the Maximum Offsite Individual and the general population within 80 km (50 miles) of the site.

  2. Escitalopram prolonged fear induced by simulated public speaking and released hypothalamic-pituitary-adrenal axis activation.

    Science.gov (United States)

    Garcia-Leal, C; Del-Ben, C M; Leal, F M; Graeff, F G; Guimarães, F S

    2010-05-01

    Simulated public speaking (SPS) test is sensitive to drugs that interfere with serotonin-mediated neurotransmission and is supposed to recruit neural systems involved in panic disorder. The study was aimed at evaluating the effects of escitalopram, the most selective serotonin-selective reuptake inhibitor available, in SPS. Healthy males received, in a double-blind, randomized design, placebo (n = 12), 10 (n = 17) or 20 (n = 14) mg of escitalopram 2 hours before the test. Behavioural, autonomic and neuroendocrine measures were assessed. Both doses of escitalopram did not produce any effect before or during the speech but prolonged the fear induced by SPS. The test itself did not significantly change cortisol and prolactin levels but under the higher dose of escitalopram, cortisol and prolactin increased immediately after SPS. This fear-enhancing effect of escitalopram agrees with previously reported results with less selective serotonin reuptake inhibitors and the receptor antagonist ritanserin, indicating that serotonin inhibits the fear of speaking in public.

  3. Proceedings of the International Academy of Ecology and Environmental Sciences (http://www.iaees.org/publications/journals/piaees/online-version.asp

    Directory of Open Access Journals (Sweden)

    piaees@iaees.org

    Full Text Available Proceedings of the International Academy of Ecology and Environmental Sciences ISSN 2220-8860 URL: http://www.iaees.org/publications/journals/piaees/online-version.asp RSS: http://www.iaees.org/publications/journals/piaees/rss.xml E-mail: piaees@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope PROCEEDINGS OF THE INTERNATIONAL ACADEMY OF ECOLOGY AND ENVIRONMENTAL SCIENCES (ISSN 2220-8860; CODEN PIAEBW is an open access, peer-reviewed international journal that considers scientific articles in all different areas of ecology and environmental sciences. It is the flagship journal of the International Academy of Ecology and Environmental Sciences. It dedicates to the latest advances in ecology and environmental sciences. The goal of this journal is to keep a record of the state-of-the-art research and promote the research work in these fast moving areas. The topics to be covered by this journal include, but are not limited to theory, methodology, technology, innovation, activity, and project in the following areas: •Animal ecology, plant/microbe ecology, wetland ecology, farmland ecology, forest/grassland ecology, marine ecology, pollution ecology, etc. •Biological conservation & preservation, ecosystem restoration, environmental policy, environmental toxicology, environmental pollution and control, natural resource, bioenergy research, environmental technology, waste management, environmental economics, environmental management & planning, environmental education, environmental engineering, global climate change, oceanography, etc. Authors can submit their works to the email box of this journal, piaees@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are

  4. ACUTRI a computer code for assessing doses to the general public due to acute tritium releases

    CERN Document Server

    Yokoyama, S; Noguchi, H; Ryufuku, S; Sasaki, T

    2002-01-01

    Tritium, which is used as a fuel of a D-T burning fusion reactor, is the most important radionuclide for the safety assessment of a nuclear fusion experimental reactor such as ITER. Thus, a computer code, ACUTRI, which calculates the radiological impact of tritium released accidentally to the atmosphere, has been developed, aiming to be of use in a discussion of licensing of a fusion experimental reactor and an environmental safety evaluation method in Japan. ACUTRI calculates an individual tritium dose based on transfer models specific to tritium in the environment and ICRP dose models. In this calculation it is also possible to analyze statistically on meteorology in the same way as a conventional dose assessment method according to the meteorological guide of the Nuclear Safety Commission of Japan. A Gaussian plume model is used for calculating the atmospheric dispersion of tritium gas (HT) and/or tritiated water (HTO). The environmental pathway model in ACUTRI considers the following internal exposures: i...

  5. The need for better public health decisions on chemicals released into our environment.

    Science.gov (United States)

    Woodruff, Tracey J; Burke, Thomas A; Zeise, Lauren

    2011-05-01

    Protecting the health of the public-particularly the most vulnerable groups, such as children-requires rethinking current approaches to reducing environmental risks. We review the evolving understanding of the relationship between exposure to chemicals in the environment and disease, as well as the current state of managing those chemicals. We present recommendations to improve current approaches, including changing the burden of proof so that chemicals are not presumed safe in the absence of scientific data. We also propose modernizing approaches to assessing health risks.

  6. Postural changes associated with public speech tests lead to mild and selective activation of stress hormone release.

    Science.gov (United States)

    Mlynarik, M; Makatsori, A; Dicko, I; Hinghofer-Szalkay, H G; Jezova, D

    2007-03-01

    We tested whether simulation of postural changes, which occur during public speech test procedures, activates cardiovascular system and stress hormone release that could interfere with the effect of psychosocial stress load. Young healthy male volunteers (n=8) underwent procedure imitating exactly all postural changes present in the psychosocial stress model based on public speech used in this laboratory (namely changes from sitting to standing and repeated sitting). Postural changes were associated with increases in heart rate, blood pressure, plasma concentrations of noradrenaline and aldosterone and elevation in plasma renin activity. In contrast to cardiovascular parameters, adrenocorticotropic hormone, cortisol and adrenaline, the main characteristics of hormonal response during mental stress, were not significantly influenced. The overall magnitude of all observed alterations was much smaller than that seen following mental stress procedures in our previous studies. This study provides evidence that changes in body posture during public speech test procedure influence hemodynamics and endocrine responses in a mild manner. Though this influence may represent a source of unspecific variance, substantial confounding effects on responses to the psychosocial component of the procedure are unlikely. In any case, models combining mental stressors and changes in body posture must be interpreted as complex stress stimuli.

  7. Announcement: Release of National Association of State Public Health Veterinarians' 2016 Compendium of Animal Rabies Prevention and Control.

    Science.gov (United States)

    2017-02-10

    The 2016 Compendium of Animal Rabies Prevention and Control was released in the March 1, 2016 issue of the Journal of the American Veterinary Medical Association (1). The Compendium's national recommendations for the prevention and control of animal rabies are intended to serve as a basis for an effective rabies control program in the United States. These recommendations facilitate standardization of control procedures across jurisdictions and are reviewed annually and updated as necessary. This announcement of the recommendations facilitates their adoption by increasing awareness among public health agencies and practitioners and makes more readily available a link to statutes and regulations in certain jurisdictions that refer directly to the Compendium language published in MMWR.

  8. Reference computations of public dose and cancer risk from airborne releases of plutonium. Nuclear safety technical report

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, V.L.

    1993-12-23

    This report presents results of computations of doses and the associated health risks of postulated accidental atmospheric releases from the Rocky Flats Plant (RFP) of one gram of weapons-grade plutonium in a form that is respirable. These computations are intended to be reference computations that can be used to evaluate a variety of accident scenarios by scaling the dose and health risk results presented here according to the amount of plutonium postulated to be released, instead of repeating the computations for each scenario. The MACCS2 code has been used as the basis of these computations. The basis and capabilities of MACCS2 are summarized, the parameters used in the evaluations are discussed, and results are presented for the doses and health risks to the public, both the Maximum Offsite Individual (a maximally exposed individual at or beyond the plant boundaries) and the population within 50 miles of RFP. A number of different weather scenarios are evaluated, including constant weather conditions and observed weather for 1990, 1991, and 1992. The isotopic mix of weapons-grade plutonium will change as it ages, the {sup 241}Pu decaying into {sup 241}Am. The {sup 241}Am reaches a peak concentration after about 72 years. The doses to the bone surface, liver, and whole body will increase slightly but the dose to the lungs will decrease slightly. The overall cancer risk will show almost no change over this period. This change in cancer risk is much smaller than the year-to-year variations in cancer risk due to weather. Finally, x/Q values are also presented for other applications, such as for hazardous chemical releases. These include the x/Q values for the MOI, for a collocated worker at 100 meters downwind of an accident site, and the x/Q value integrated over the population out to 50 miles.

  9. Caught you: threats to confidentiality due to the public release of large-scale genetic data sets.

    Science.gov (United States)

    Wjst, Matthias

    2010-12-29

    Large-scale genetic data sets are frequently shared with other research groups and even released on the Internet to allow for secondary analysis. Study participants are usually not informed about such data sharing because data sets are assumed to be anonymous after stripping off personal identifiers. The assumption of anonymity of genetic data sets, however, is tenuous because genetic data are intrinsically self-identifying. Two types of re-identification are possible: the "Netflix" type and the "profiling" type. The "Netflix" type needs another small genetic data set, usually with less than 100 SNPs but including a personal identifier. This second data set might originate from another clinical examination, a study of leftover samples or forensic testing. When merged to the primary, unidentified set it will re-identify all samples of that individual. Even with no second data set at hand, a "profiling" strategy can be developed to extract as much information as possible from a sample collection. Starting with the identification of ethnic subgroups along with predictions of body characteristics and diseases, the asthma kids case as a real-life example is used to illustrate that approach. Depending on the degree of supplemental information, there is a good chance that at least a few individuals can be identified from an anonymized data set. Any re-identification, however, may potentially harm study participants because it will release individual genetic disease risks to the public.

  10. Caught you: threats to confidentiality due to the public release of large-scale genetic data sets

    Directory of Open Access Journals (Sweden)

    Wjst Matthias

    2010-12-01

    Full Text Available Abstract Background Large-scale genetic data sets are frequently shared with other research groups and even released on the Internet to allow for secondary analysis. Study participants are usually not informed about such data sharing because data sets are assumed to be anonymous after stripping off personal identifiers. Discussion The assumption of anonymity of genetic data sets, however, is tenuous because genetic data are intrinsically self-identifying. Two types of re-identification are possible: the "Netflix" type and the "profiling" type. The "Netflix" type needs another small genetic data set, usually with less than 100 SNPs but including a personal identifier. This second data set might originate from another clinical examination, a study of leftover samples or forensic testing. When merged to the primary, unidentified set it will re-identify all samples of that individual. Even with no second data set at hand, a "profiling" strategy can be developed to extract as much information as possible from a sample collection. Starting with the identification of ethnic subgroups along with predictions of body characteristics and diseases, the asthma kids case as a real-life example is used to illustrate that approach. Summary Depending on the degree of supplemental information, there is a good chance that at least a few individuals can be identified from an anonymized data set. Any re-identification, however, may potentially harm study participants because it will release individual genetic disease risks to the public.

  11. USGS Environmental health science strategy: providing environmental health science for a changing world: public review release

    Science.gov (United States)

    Bright, Patricia R.; Buxton, Herbert T.; Balistrieri, Laurie S.; Barber, Larry B.; Chapelle, Francis H.; Cross, Paul C.; Krabbenhoft, David P.; Plumlee, Geoffrey S.; Sleeman, Jonathan M.; Tillitt, Donald E.; Toccalino, Patricia L.; Winton, James R.

    2012-01-01

    America has an abundance of natural resources. We have bountiful clean water, fertile soil, and unrivaled national parks, wildlife refuges, and public lands. These resources enrich our lives and preserve our health and wellbeing. These resources have been maintained because of our history of respect for their value and an enduring commitment to their vigilant protection. Awareness of the social, economic, and personal value of the health of our environment is increasing. The emergence of environmentally driven diseases caused by environmental exposure to contaminants and pathogens is a growing concern worldwide. New health threats and patterns of established threats are affected by both natural and anthropogenic changes to the environment. Human activities are key drivers of emerging (new and re-emerging) health threats. Societal demands for land and natural resources, a better quality of life, improved economic prosperity, and the environmental impacts associated with these demands will continue to increase. Natural earth processes, climate trends, and related climatic events will add to the environmental impact of human activities. These environmental drivers will influence exposure to disease agents, including viral, bacterial, prion, and fungal pathogens, parasites, natural earth materials, toxins and other biogenic compounds, and synthetic chemicals and substances. The U.S. Geological Survey (USGS) defines environmental health science broadly as the interdisciplinary study of relations among the quality of the physical environment, the health of the living environment, and human health. The interactions among these three spheres are driven by human activities, ecological processes, and natural earth processes; the interactions affect exposure to contaminants and pathogens and the severity of environmentally driven diseases in animals and people. This definition provides USGS with a framework for synthesizing natural science information from across the Bureau

  12. Development of Public Training System for Emergency Exercise Using Virtual Reality Technology Based on Radioactive Release Accident

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Byung Il; Park, Seong Jun; Lee, Dewhey; Song, Sub Lee; Park, Younwon [BEES Inc., Daejeon (Korea, Republic of)

    2016-10-15

    An exercise is normally conducted for a day or two days depending on the scale of the exercise. What we have experienced up to date there are several limitations in the radiological emergency exercises such as low public acceptance, poor enthusiasm in the exercise participation, not very attracting exercise scenarios, low efficiency in conducting an exercise, and so on. In order to overcome the limitations of the present exercising system, we would like to develop a radiological emergency exercise system using VR (virtual reality) technology based on a radioactive release accident. In this paper, we just introduce some basic development methods and event tree based scenario as a beginning stage. After the accident in Fukushima Daiichi NPP, the importance of emergency exercise especially for the public is far more emphasized around the world more and more. However, the human labor focused radiological emergency exercise up to now has many limitations. After developing this system properly and by using it, we could even expect to estimate the weak points of the emergency arrangements and strategy we have.

  13. The First Public Release of South Pole Telescope Data: Maps of a 95-square-degree Field from 2008 Observations

    CERN Document Server

    Schaffer, K K; Aird, K A; Benson, B A; Bleem, L E; Carlstrom, J E; Chang, C L; Cho, H M; Crites, A T; de Haan, T; Dobbs, M A; George, E M; Halverson, N W; Holder, G P; Holzapfel, W L; Hoover, S; Hrubes, J D; Joy, M; Keisler, R; Knox, L; Lee, A T; Leitch, E M; Lueker, M; Luong-Van, D; McMahon, J J; Mehl, J; Meyer, S S; Mohr, J J; Montroy, T E; Padin, S; Plagge, T; Pryke, C; Reichardt, C L; Ruhl, J E; Shirokoff, E; Spieler, H G; Stalder, B; Staniszewski, Z; Stark, A A; Story, K; Vanderlinde, K; Vieira, J D; Williamson, R

    2011-01-01

    The South Pole Telescope (SPT) has nearly completed a 2500-square-degree survey of the southern sky in three frequency bands. Here we present the first public release of SPT maps and associated data products. We present arcminute-resolution maps at 150 GHz and 220 GHz of an approximately 95-square-degree field centered at R.A. 82.7 degrees, decl. -55 degrees. The field was observed to a depth of approximately 17 micro-K arcmin at 150 GHz and 41 micro-K arcmin at 220 GHz during the 2008 austral winter season. Two variations on map filtering and map projection are presented, one tailored for producing catalogs of galaxy clusters detected through their Sunyaev-Zel'dovich effect signature and one tailored for producing catalogs of emissive sources. We describe the data processing pipeline, and we present instrument response functions, filter transfer functions, and map noise properties. All data products described in this paper are available for download at http://pole.uchicago.edu/public/data/maps/ra5h30dec-55 a...

  14. USGS Environmental health science strategy: providing environmental health science for a changing world: public review release

    Science.gov (United States)

    Bright, Patricia R.; Buxton, Herbert T.; Balistrieri, Laurie S.; Barber, Larry B.; Chapelle, Francis H.; Cross, Paul C.; Krabbenhoft, David P.; Plumlee, Geoffrey S.; Sleeman, Jonathan M.; Tillitt, Donald E.; Toccalino, Patricia L.; Winton, James R.

    2012-01-01

    America has an abundance of natural resources. We have bountiful clean water, fertile soil, and unrivaled national parks, wildlife refuges, and public lands. These resources enrich our lives and preserve our health and wellbeing. These resources have been maintained because of our history of respect for their value and an enduring commitment to their vigilant protection. Awareness of the social, economic, and personal value of the health of our environment is increasing. The emergence of environmentally driven diseases caused by environmental exposure to contaminants and pathogens is a growing concern worldwide. New health threats and patterns of established threats are affected by both natural and anthropogenic changes to the environment. Human activities are key drivers of emerging (new and re-emerging) health threats. Societal demands for land and natural resources, a better quality of life, improved economic prosperity, and the environmental impacts associated with these demands will continue to increase. Natural earth processes, climate trends, and related climatic events will add to the environmental impact of human activities. These environmental drivers will influence exposure to disease agents, including viral, bacterial, prion, and fungal pathogens, parasites, natural earth materials, toxins and other biogenic compounds, and synthetic chemicals and substances. The U.S. Geological Survey (USGS) defines environmental health science broadly as the interdisciplinary study of relations among the quality of the physical environment, the health of the living environment, and human health. The interactions among these three spheres are driven by human activities, ecological processes, and natural earth processes; the interactions affect exposure to contaminants and pathogens and the severity of environmentally driven diseases in animals and people. This definition provides USGS with a framework for synthesizing natural science information from across the Bureau

  15. Preface to the publication of the Chinese Version of the WHO Guidelines for Hearing Aids and Services for Developing Countries (2nd Edition) in the January 2005 issue of the Journal of Audiology and Speech Pathology

    Institute of Scientific and Technical Information of China (English)

    Hearing Aids Working Group

    2005-01-01

    @@ It is a great pleasure to be given this opportunity to write a preface for the publication of the first Chinese version of the World Health Organization (WHO) Guidelines for Hearing Aids and Services for Developing Countries (2nd Edition) in this issue of the Journal of Audiology and Speech Pathology.

  16. Documentation for the NCES Common Core of Data National Public Education Financial Survey (NPEFS), School Year 2008-09 (Fiscal Year 2009). Revised File Version 1b. NCES 2011-330rev

    Science.gov (United States)

    Cornman, Stephen Q.; Zhou, Lei; Nakamoto, Nanae

    2012-01-01

    This documentation is for the revised file (Version 1b) of the National Center for Education Statistics' (NCES) Common Core of Data (CCD) National Public Education Financial Survey (NPEFS) for school year 2008-2009, fiscal year 2009 (FY 09). It contains a brief description of the data collection along with information required to understand and…

  17. Assessment of radionuclide databases in CAP88 mainframe version 1.0 and Windows-based version 3.0.

    Science.gov (United States)

    LaBone, Elizabeth D; Farfán, Eduardo B; Lee, Patricia L; Jannik, G Timothy; Donnelly, Elizabeth H; Foley, Trevor Q

    2009-09-01

    In this study the radionuclide databases for two versions of the Clean Air Act Assessment Package-1988 (CAP88) computer model were assessed in detail. CAP88 estimates radiation dose and the risk of health effects to human populations from radionuclide emissions to air. This program is used by several U.S. Department of Energy (DOE) facilities to comply with National Emission Standards for Hazardous Air Pollutants regulations. CAP88 Mainframe, referred to as version 1.0 on the U.S. Environmental Protection Agency Web site (http://www.epa.gov/radiation/assessment/CAP88/), was the very first CAP88 version released in 1988. Some DOE facilities including the Savannah River Site still employ this version (1.0) while others use the more user-friendly personal computer Windows-based version 3.0 released in December 2007. Version 1.0 uses the program RADRISK based on International Commission on Radiological Protection Publication 30 as its radionuclide database. Version 3.0 uses half-life, dose, and risk factor values based on Federal Guidance Report 13. Differences in these values could cause different results for the same input exposure data (same scenario), depending on which version of CAP88 is used. Consequently, the differences between the two versions are being assessed in detail at Savannah River National Laboratory. The version 1.0 and 3.0 database files contain 496 and 838 radionuclides, respectively, and though one would expect the newer version to include all the 496 radionuclides, 35 radionuclides are listed in version 1.0 that are not included in version 3.0. The majority of these has either extremely short or long half-lives or is no longer in production; however, some of the short-lived radionuclides might produce progeny of great interest at DOE sites. In addition, 122 radionuclides were found to have different half-lives in the two versions, with 21 over 3 percent different and 12 over 10 percent different.

  18. ASSESSMENT OF RADIONUCLIDES DATABASES IN CAP88 MAINFRAME VERSION 1.0 AND WINDOWS-BASED VERSION 3.0

    Energy Technology Data Exchange (ETDEWEB)

    Farfan, E.; Lee, P.; Jannik, T.; Donnelly, E.

    2008-09-16

    In this study the radionuclide databases for two versions of the Clean Air Act Assessment Package-1988 (CAP88) computer model were assessed in detail. CAP88 estimates radiation dose and the risk of health effects to human populations from radionuclide emissions to air. This program is used by several Department of Energy (DOE) facilities to comply with National Emission Standards for Hazardous Air Pollutants (NESHAP) regulations. CAP88 Mainframe, referred to as Version 1.0 on the Environmental Protection Agency (EPA) website (http://www.epa.gov/radiation/assessment/CAP88/), was the very first CAP88 version released in 1988. Some DOE facilities including the Savannah River Site still employ this version (1.0) while others use the more user-friendly personal computer Windows-based Version 3.0 released in December 2007. Version 1.0 uses the program RADRISK based on International Commission on Radiological Protection (ICRP) Publication 30 as its radionuclide database. Version 3.0 uses half-life, dose and risk factor values based on Federal Guidance Report 13. Differences in these values could cause different results for the same input exposure data (same scenario), depending on which version of CAP88 is used. Consequently, the differences between the two versions are being assessed in detail at Savannah River National Laboratory. The version 1.0 and 3.0 database files contain 496 and 838 radionuclides, respectively, and though one would expect the newer version to include all the 496 radionuclides, thirty-five radionuclides are listed in version 1.0 that are not included in version 3.0. The majority of these has either extremely short or long half-lives or is no longer in production; however, some of the short-lived radionuclides might produce progeny of great interest at DOE sites. In addition, one hundred and twenty-two radionuclides were found to have different half-lives in the two versions, with 21 over 3 percent different and 12 over 10 percent different.

  19. Safe Surgery Trainer Project Management Plan (PMP), Version 1.0

    Science.gov (United States)

    2014-05-30

    Methodology including SCRUM (see http://en.wikipedia.org/wiki/Scrum_(management) for more info). Although this Safe Surgery Trainer - PMP Version 1.0 5...3.5  High Level Task Identification and Scheduling Methodology ......................................................................... 8  4...30/2014 Distribution Statement – Approved for Public Release, Distribution is Unlimited. 8 methodology does not specifically describe a life cycle

  20. AERONET Version 3 processing

    Science.gov (United States)

    Holben, B. N.; Slutsker, I.; Giles, D. M.; Eck, T. F.; Smirnov, A.; Sinyuk, A.; Schafer, J.; Rodriguez, J.

    2014-12-01

    The Aerosol Robotic Network (AERONET) database has evolved in measurement accuracy, data quality products, availability to the scientific community over the course of 21 years with the support of NASA, PHOTONS and all federated partners. This evolution is periodically manifested as a new data version release by carefully reprocessing the entire database with the most current algorithms that fundamentally change the database and ultimately the data products used by the community. The newest processing, Version 3, will be released in 2015 after the entire database is reprocessed and real-time data processing becomes operational. All V 3 algorithms have been developed, individually vetted and represent four main categories: aerosol optical depth (AOD) processing, inversion processing, database management and new products. The primary trigger for release of V 3 lies with cloud screening of the direct sun observations and computation of AOD that will fundamentally change all data available for analysis and all subsequent retrieval products. This presentation will illustrate the innovative approach used for cloud screening and assesses the elements of V3 AOD relative to the current version. We will also present the advances in the inversion product processing with emphasis on the random and systematic uncertainty estimates. This processing will be applied to the new hybrid measurement scenario intended to provide inversion retrievals for all solar zenith angles. We will introduce automatic quality assurance criteria that will allow near real time quality assured aerosol products necessary for real time satellite and model validation and assimilation. Last we will introduce the new management structure that will improve access to the data database. The current version 2 will be supported for at least two years after the initial release of V3 to maintain continuity for on going investigations.

  1. Cielo Computational Environment Usage Model With Mappings to ACE Requirements for the General Availability User Environment Capabilities Release Version 1.1

    Energy Technology Data Exchange (ETDEWEB)

    Vigil,Benny Manuel [Los Alamos National Laboratory; Ballance, Robert [SNL; Haskell, Karen [SNL

    2012-08-09

    Cielo is a massively parallel supercomputer funded by the DOE/NNSA Advanced Simulation and Computing (ASC) program, and operated by the Alliance for Computing at Extreme Scale (ACES), a partnership between Los Alamos National Laboratory (LANL) and Sandia National Laboratories (SNL). The primary Cielo compute platform is physically located at Los Alamos National Laboratory. This Cielo Computational Environment Usage Model documents the capabilities and the environment to be provided for the Q1 FY12 Level 2 Cielo Capability Computing (CCC) Platform Production Readiness Milestone. This document describes specific capabilities, tools, and procedures to support both local and remote users. The model is focused on the needs of the ASC user working in the secure computing environments at Lawrence Livermore National Laboratory (LLNL), Los Alamos National Laboratory, or Sandia National Laboratories, but also addresses the needs of users working in the unclassified environment. The Cielo Computational Environment Usage Model maps the provided capabilities to the tri-Lab ASC Computing Environment (ACE) Version 8.0 requirements. The ACE requirements reflect the high performance computing requirements for the Production Readiness Milestone user environment capabilities of the ASC community. A description of ACE requirements met, and those requirements that are not met, are included in each section of this document. The Cielo Computing Environment, along with the ACE mappings, has been issued and reviewed throughout the tri-Lab community.

  2. Update on NHANES Dietary Data: Focus on Collection, Release, Analytical Considerations, and Uses to Inform Public Policy.

    Science.gov (United States)

    Ahluwalia, Namanjeet; Dwyer, Johanna; Terry, Ana; Moshfegh, Alanna; Johnson, Clifford

    2016-01-01

    NHANES is the cornerstone for national nutrition monitoring to inform nutrition and health policy. Nutritional assessment in NHANES is described with a focus on dietary data collection, analysis, and uses in nutrition monitoring. NHANES has been collecting thorough data on diet, nutritional status, and chronic disease in cross-sectional surveys with nationally representative samples since the early 1970s. Continuous data collection began in 1999 with public data release in 2-y cycles on ∼10,000 participants. In 2002, the Continuing Survey of Food Intakes by Individuals and the NHANES dietary component were merged, forming a consolidated dietary data collection known as What We Eat in America; since then, 24-h recalls have been collected on 2 d using the USDA's Automated Multiple-Pass Method. Detailed and targeted food-frequency questionnaires have been collected in some NHANES cycles. Dietary supplement use data have been collected (in detail since 2007) so that total nutrient intakes can be described for the population. The continuous NHANES can adapt its content to address emerging public health needs and reflect federal priorities. Changes in data collection methods are made after expert input and validation/crossover studies. NHANES dietary data are used to describe intake of foods, nutrients, food groups, and dietary patterns by the US population and large sociodemographic groups to plan and evaluate nutrition programs and policies. Usual dietary intake distributions can be estimated after adjusting for day-to-day variation. NHANES remains open and flexible to incorporate improvements while maintaining data quality and providing timely data to track the nation's nutrition and health status. In summary, NHANES collects dietary data in the context of its broad, multipurpose goals; the strengths and limitations of these data are also discussed in this review.

  3. Large-Scale Release of Campylobacter Draft Genomes: Resources for Food Safety and Public Health from the 100K Pathogen Genome Project

    Science.gov (United States)

    Huang, Bihua C.; Storey, Dylan B.; Kong, Nguyet; Chen, Poyin; Arabyan, Narine; Gilpin, Brent; Mason, Carl; Townsend, Andrea K.; Smith, Woutrina A.; Byrne, Barbara A.; Taff, Conor C.

    2017-01-01

    ABSTRACT Campylobacter is a food-associated bacterium and a leading cause of foodborne illness worldwide, being associated with poultry in the food supply. This is the initial public release of 202 Campylobacter genome sequences as part of the 100K Pathogen Genome Project. These isolates represent global genomic diversity in the Campylobacter genus. PMID:28057746

  4. brulilo, Version 0.x

    Energy Technology Data Exchange (ETDEWEB)

    2015-04-16

    effectively remove some of the stiffness and allow for efficient explicit integration techniques to be used. The original intent of brulilo was to implement these stiffness-alleviating techniques with explicit integrators and compare the performance to traditional implicit integrations of the full stiff system. This is still underway, as the code is very much in an alpha-release state. Furthermore, explicit integrators are often much easier to parallelize than their implicit counterparts. brulilo will implement parallelization of these techniques, leveraging both the Python implementation of MPI, mpi4py, as well as highly parallelized versions targeted at GPUs with PyOpenCL and/or PyCUDA.

  5. Herwig 7.0 / Herwig++ 3.0 Release Note

    CERN Document Server

    Bellm, Johannes; Grellscheid, David; Plätzer, Simon; Rauch, Michael; Reuschle, Christian; Richardson, Peter; Schichtel, Peter; Seymour, Michael H; Siódmok, Andrzej; Wilcock, Alexandra; Fischer, Nadine; Harrendorf, Marco A; Nail, Graeme; Papaefstathiou, Andreas; Rauch, Daniel

    2016-01-01

    A major new release of the Monte Carlo event generator Herwig++ (version 3.0) is now available. This release marks the end of distinguishing Herwig++ and HERWIG development and therefore constitutes the first major release of version 7 of the Herwig event generator family. The new version features a number of significant improvements to the event simulation, including: built-in NLO hard process calculation for all Standard Model processes, with matching to both angular-ordered and dipole shower modules via both subtractive (MC@NLO-type) and multiplicative (Powheg-type) algorithms; QED radiation and spin correlations in the angular ordered shower; a consistent treatment of perturbative uncertainties within the hard process and parton showering. Several of the new features will be covered in detail in accompanying publications, and an update of the manual will follow in due course.

  6. Herwig 7.0/Herwig++ 3.0 release note

    Energy Technology Data Exchange (ETDEWEB)

    Bellm, Johannes [Karlsruhe Institute of Technology, Institute for Theoretical Physics, Karlsruhe (Germany); Durham University, IPPP, Department of Physics, Durham (United Kingdom); Gieseke, Stefan; Rauch, Michael; Fischer, Nadine; Rauch, Daniel [Karlsruhe Institute of Technology, Institute for Theoretical Physics, Karlsruhe (Germany); Grellscheid, David; Schichtel, Peter; Wilcock, Alexandra [Durham University, IPPP, Department of Physics, Durham (United Kingdom); Plaetzer, Simon [Durham University, IPPP, Department of Physics, Durham (United Kingdom); University of Manchester, Particle Physics Group, School of Physics and Astronomy, Manchester (United Kingdom); Reuschle, Christian [Karlsruhe Institute of Technology, Institute for Theoretical Physics, Karlsruhe (Germany); Florida State University, HEP Theory Group, Department of Physics, Tallahassee (United States); Richardson, Peter [Durham University, IPPP, Department of Physics, Durham (United Kingdom); CERN Theoretical Physics Department, Geneva (Switzerland); Seymour, Michael H.; Nail, Graeme [University of Manchester, Particle Physics Group, School of Physics and Astronomy, Manchester (United Kingdom); Siodmok, Andrzej [CERN Theoretical Physics Department, Geneva (Switzerland); Polish Academy of Sciences, The Henryk Niewodniczanski Institute of Nuclear Physics in Cracow, Cracow (Poland); Harrendorf, Marco A. [Karlsruhe Institute of Technology, Institut fuer Experimentelle Kernphysik, Karlsruhe (Germany); Papaefstathiou, Andreas [CERN Theoretical Physics Department, Geneva (Switzerland)

    2016-04-15

    A major new release of the Monte Carlo event generator Herwig++ (version 3.0) is now available. This release marks the end of distinguishing Herwig++ and HERWIG development and therefore constitutes the first major release of version 7 of the Herwig event generator family. The new version features a number of significant improvements to the event simulation, including: built-in NLO hard process calculation for virtually all Standard Model processes, with matching to both angular-ordered and dipole shower modules via both subtractive (MC rate at NLO-type) and multiplicative (Powheg-type) algorithms; QED radiation and spin correlations in the angular-ordered shower; a consistent treatment of perturbative uncertainties within the hard process and parton showering. Several of the new features will be covered in detail in accompanying publications, and an update of the manual will follow in due course. (orig.)

  7. Findings from a novel approach to publication guideline revision: user road testing of a draft version of SQUIRE 2.0.

    Science.gov (United States)

    Davies, Louise; Donnelly, Kyla Z; Goodman, Daisy J; Ogrinc, Greg

    2016-04-01

    The Standards for Quality Improvement Reporting Excellence (SQUIRE) Guideline was published in 2008 (SQUIRE 1.0) and was the first publication guideline specifically designed to advance the science of healthcare improvement. Advances in the discipline of improvement prompted us to revise it. We adopted a novel approach to the revision by asking end-users to 'road test' a draft version of SQUIRE 2.0. The aim was to determine whether they understood and implemented the guidelines as intended by the developers. Forty-four participants were assigned a manuscript section (ie, introduction, methods, results, discussion) and asked to use the draft Guidelines to guide their writing process. They indicated the text that corresponded to each SQUIRE item used and submitted it along with a confidential survey. The survey examined usability of the Guidelines using Likert-scaled questions and participants' interpretation of key concepts in SQUIRE using open-ended questions. On the submitted text, we evaluated concordance between participants' item usage/interpretation and the developers' intended application. For the survey, the Likert-scaled responses were summarised using descriptive statistics and the open-ended questions were analysed by content analysis. Consistent with the SQUIRE Guidelines' recommendation that not every item be included, less than one-third (n=14) of participants applied every item in their section in full. Of the 85 instances when an item was partially used or was omitted, only 7 (8.2%) of these instances were due to participants not understanding the item. Usage of Guideline items was highest for items most similar to standard scientific reporting (ie, 'Specific aim of the improvement' (introduction), 'Description of the improvement' (methods) and 'Implications for further studies' (discussion)) and lowest (SQUIRE 2.0 revealed which items have poor concordance between developer intent and author usage, which will inform final editing of the Guideline

  8. [Twenty-year History and Future Challenges in Transparency Enhancement of Review Process for Approval: Focus on Public Release of Review Reports regarding New Drugs and Medical Devices].

    Science.gov (United States)

    Morimoto, Kazushige; Kawasaki, Satoko; Yoshida, Yasunori

    2015-01-01

    For 20 years, the Ministry of Health, Labour and Welfare (MHLW, formerly Ministry of Health and Welfare (MHW)) has been trying to increase transparency of the review process for approving reports in order to promote the rational use of newly approved drugs and medical devices. The first Summary Basis of Approval (SBA) was published by MHW in 1994. In 1999, evaluation reports were prepared by MHW and the Pharmaceuticals and Medical Devices Evaluation Center to make them available to the public. In 2005, a notice from the Chief Executive of the Pharmaceuticals and Medical Devices Agency (PMDA) made procedures for public release of information on reviewing applications for new drugs. In 2006, 90 review reports of newly approved drugs and eight medical devices were revealed on PMDA websites. The dissemination of information by the United States Food and Drug Administration (FDA) and that of the European Medicines Agency (EMA) were studied and compared with that of the MHLW and PMDA. While common technical documents (CTD) for new drugs and summary technical documents (STED) for new medical devices have been released by PMDA, such documents are not released by the FDA and EMA. The European Public Assessment Report (EAPR) summary for the public is an interesting questionnaire approach that uses the "What," "How" and "Why" format. Finally, future proposals for the next decade are also outlined.

  9. The comparison of CAP88-PC version 2.0 versus CAP88-PC version 1.0

    Energy Technology Data Exchange (ETDEWEB)

    Yakubovich, B.A.; Klee, K.O.; Palmer, C.R.; Spotts, P.B.

    1997-12-01

    40 CFR Part 61 (Subpart H of the NESHAP) requires DOE facilities to use approved sampling procedures, computer models, or other approved procedures when calculating Effective Dose Equivalent (EDE) values to members of the public. Currently version 1.0 of the approved computer model CAP88-PC is used to calculate EDE values. The DOE has upgraded the CAP88-PC software to version 2.0. This version provides simplified data entry, better printing characteristics, the use of a mouse, and other features. The DOE has developed and released version 2.0 for testing and comment. This new software is a WINDOWS based application that offers a new graphical user interface with new utilities for preparing and managing population and weather data, and several new decay chains. The program also allows the user to view results before printing. This document describes a test that confirmed CAP88-PC version 2.0 generates results comparable to the original version of the CAP88-PC program.

  10. Risk factors for acute chemical releases with public health consequences: Hazardous Substances Emergency Events Surveillance in the U.S., 1996–2001

    Directory of Open Access Journals (Sweden)

    Kaye Wendy E

    2004-10-01

    Full Text Available Abstract Background Releases of hazardous materials can cause substantial morbidity and mortality. To reduce and prevent the public health consequences (victims or evacuations from uncontrolled or illegally released hazardous substances, a more comprehensive analysis is needed to determine risk factors for hazardous materials incidents. Methods Hazardous Substances Emergency Events Surveillance (HSEES data from 1996 through 2001 were analyzed using bivariate and multiple logistic regression. Fixed-facility and transportation-related events were analyzed separately. Results For fixed-facility events, 2,327 (8% resulted in at least one victim and 2,844 (10% involved ordered evacuations. For transportation-related events, 759 (8% resulted in at least one victim, and 405 (4% caused evacuation orders. Fire and/or explosion were the strongest risk factors for events involving either victims or evacuations. Stratified analysis of fixed-facility events involving victims showed a strong association for acid releases in the agriculture, forestry, and fisheries industry. Chlorine releases in fixed-facility events resulted in victims and evacuations in more industry categories than any other substance. Conclusions Outreach efforts should focus on preventing and preparing for fires and explosions, acid releases in the agricultural industry, and chlorine releases in fixed facilities.

  11. PVWatts Version 5 Manual

    Energy Technology Data Exchange (ETDEWEB)

    Dobos, A. P.

    2014-09-01

    The NREL PVWatts calculator is a web application developed by the National Renewable Energy Laboratory (NREL) that estimates the electricity production of a grid-connected photovoltaic system based on a few simple inputs. PVWatts combines a number of sub-models to predict overall system performance, and makes includes several built-in parameters that are hidden from the user. This technical reference describes the sub-models, documents assumptions and hidden parameters, and explains the sequence of calculations that yield the final system performance estimate. This reference is applicable to the significantly revised version of PVWatts released by NREL in 2014.

  12. Public Release of Estimated Impact-Based Earthquake Alerts - An Update to the U.S. Geological Survey PAGER System

    Science.gov (United States)

    Wald, D. J.; Jaiswal, K. S.; Marano, K.; Hearne, M.; Earle, P. S.; So, E.; Garcia, D.; Hayes, G. P.; Mathias, S.; Applegate, D.; Bausch, D.

    2010-12-01

    The U.S. Geological Survey (USGS) has begun publicly releasing earthquake alerts for significant earthquakes around the globe based on estimates of potential casualties and economic losses. These estimates should significantly enhance the utility of the USGS Prompt Assessment of Global Earthquakes for Response (PAGER) system that has been providing estimated ShakeMaps and computing population exposures to specific shaking intensities since 2007. Quantifying earthquake impacts and communicating loss estimates (and their uncertainties) to the public has been the culmination of several important new and evolving components of the system. First, the operational PAGER system now relies on empirically-based loss models that account for estimated shaking hazard, population exposure, and employ country-specific fatality and economic loss functions derived using analyses of losses due to recent and past earthquakes. In some countries, our empirical loss models are informed in part by PAGER’s semi-empirical and analytical loss models, and building exposure and vulnerability data sets, all of which are being developed in parallel to the empirical approach. Second, human and economic loss information is now portrayed as a supplement to existing intensity/exposure content on both PAGER summary alert (available via cell phone/email) messages and web pages. Loss calculations also include estimates of the economic impact with respect to the country’s gross domestic product. Third, in order to facilitate rapid and appropriate earthquake responses based on our probable loss estimates, in early 2010 we proposed a four-level Earthquake Impact Scale (EIS). Instead of simply issuing median estimates for losses—which can be easily misunderstood and misused—this scale provides ranges of losses from which potential responders can gauge expected overall impact from strong shaking. EIS is based on two complementary criteria: the estimated cost of damage, which is most suitable for U

  13. 77 FR 30047 - Notice of Opportunity for Public Comment on Surplus Property Release at Michael J Smith Field...

    Science.gov (United States)

    2012-05-21

    ... Michael J Smith Field, Beaufort, NC AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice... approximately 7.5 acres of airport property, located at the Michael J Smith Field, be used for aeronautical... Authority to release approximately 7.5 acres of airport property at the Michael J Smith Field. The...

  14. Efficient Management of Biomedical Ontology Versions

    Science.gov (United States)

    Kirsten, Toralf; Hartung, Michael; Groß, Anika; Rahm, Erhard

    Ontologies have become very popular in life sciences and other domains. They mostly undergo continuous changes and new ontology versions are frequently released. However, current analysis studies do not consider the ontology changes reflected in different versions but typically limit themselves to a specific ontology version which may quickly become obsolete. To allow applications easy access to different ontology versions we propose a central and uniform management of the versions of different biomedical ontologies. The proposed database approach takes concept and structural changes of succeeding ontology versions into account thereby supporting different kinds of change analysis. Furthermore, it is very space-efficient by avoiding redundant storage of ontology components which remain unchanged in different versions. We evaluate the storage requirements and query performance of the proposed approach for the Gene Ontology.

  15. Assessment of Version 4 of the SMAP Passive Soil Moisture Standard Product

    Science.gov (United States)

    O'neill, P. O.; Chan, S.; Bindlish, R.; Jackson, T.; Colliander, A.; Dunbar, R.; Chen, F.; Piepmeier, Jeffrey R.; Yueh, S.; Entekhabi, D.; hide

    2017-01-01

    NASAs Soil Moisture Active Passive (SMAP) mission launched on January 31, 2015 into a sun-synchronous 6 am6 pm orbit with an objective to produce global mapping of high-resolution soil moisture and freeze-thaw state every 2-3 days. The SMAP radiometer began acquiring routine science data on March 31, 2015 and continues to operate nominally. SMAPs radiometer-derived standard soil moisture product (L2SMP) provides soil moisture estimates posted on a 36-km fixed Earth grid using brightness temperature observations and ancillary data. A beta quality version of L2SMP was released to the public in October, 2015, Version 3 validated L2SMP soil moisture data were released in May, 2016, and Version 4 L2SMP data were released in December, 2016. Version 4 data are processed using the same soil moisture retrieval algorithms as previous versions, but now include retrieved soil moisture from both the 6 am descending orbits and the 6 pm ascending orbits. Validation of 19 months of the standard L2SMP product was done for both AM and PM retrievals using in situ measurements from global core calval sites. Accuracy of the soil moisture retrievals averaged over the core sites showed that SMAP accuracy requirements are being met.

  16. The Radiological Impact of 210Pb and 210Po Released from the Iron- and Steel-Making Plant ILVA in Taranto (Italy on the Environment and the Public

    Directory of Open Access Journals (Sweden)

    Guogang Jia

    2013-01-01

    Full Text Available Lead-210 and 210Po are naturally occurring radionuclides. Due to volatile characteristic of lead and polonium, environmental pollution of 210Pb and 210Po released from the coal power plant, steel-making industry and refractory material industry has been an exposure problem for the members of public. In this paper studies on the activity concentrations of 210Po and 210Pb in the raw materials, dust particles, surficial soils and atmospheric particulate samples collected in the area of the Iron- and Steel-Making Plant ILVA Taranto (Italy were made. These data have been used to evaluate the source-term, distributions, inventories, mass balance, biological availability, ecological migration processes and public exposure risk of 210Pb and 210Po in the concerned environment.

  17. Genome-wide genotyping in Parkinson's disease and neurologically normal controls: first stage analysis and public release of data.

    Science.gov (United States)

    Fung, Hon-Chung; Scholz, Sonja; Matarin, Mar; Simón-Sánchez, Javier; Hernandez, Dena; Britton, Angela; Gibbs, J Raphael; Langefeld, Carl; Stiegert, Matt L; Schymick, Jennifer; Okun, Michael S; Mandel, Ronald J; Fernandez, Hubert H; Foote, Kelly D; Rodríguez, Ramón L; Peckham, Elizabeth; De Vrieze, Fabienne Wavrant; Gwinn-Hardy, Katrina; Hardy, John A; Singleton, Andrew

    2006-11-01

    Several genes underlying rare monogenic forms of Parkinson's disease have been identified over the past decade. Despite evidence for a role for genetics in sporadic Parkinson's disease, few common genetic variants have been unequivocally linked to this disorder. We sought to identify any common genetic variability exerting a large effect in risk for Parkinson's disease in a population cohort and to produce publicly available genome-wide genotype data that can be openly mined by interested researchers and readily augmented by genotyping of additional repository subjects. We did genome-wide, single-nucleotide-polymorphism (SNP) genotyping of publicly available samples from a cohort of Parkinson's disease patients (n=267) and neurologically normal controls (n=270). More than 408,000 unique SNPs were used from the Illumina Infinium I and HumanHap300 assays. We have produced around 220 million genotypes in 537 participants. This raw genotype data has been and as such is the first publicly accessible high-density SNP data outside of the International HapMap Project. We also provide here the results of genotype and allele association tests. We generated publicly available genotype data for Parkinson's disease patients and controls so that these data can be mined and augmented by other researchers to identify common genetic variability that results in minor and moderate risk for disease.

  18. Integration of ROOT Notebooks as a Web-based ATLAS Analysis tool for public data releases and outreach

    CERN Document Server

    Banda, Tea; CERN. Geneva. EP Department

    2016-01-01

    The project consists in the initial development of ROOT notebooks for a Z boson analysis in C++ programming language that will allow students and researches to perform fast and very useful data analysis, using ATLAS public data and Monte- Carlo simulations. Several tools are considered: ROOT Data Analysis Frame- work, Jupyter Notebook Technology and CERN-ROOT computing service so-called SWAN.

  19. A citation-based, author- and age-normalized, logarithmic index for evaluation of individual researchers independently of publication counts [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Aleksey V. Belikov

    2015-09-01

    Full Text Available The use of citation metrics for evaluation of individual researchers has dramatically increased over the last decade. However, currently existing indices either are based on misleading premises or are cumbersome to implement. This leads to poor assessment of researchers and creates dangerous trends in science, such as overproduction of low quality articles. Here we propose an index (namely, the L-index that does not depend on the number of publications, accounts for different co-author contributions and age of publications, and scales from 0.0 to 9.9. Moreover, it can be calculated with the help of freely available software.

  20. Slow-release carbohydrates: growing evidence on metabolic responses and public health interest. Summary of the symposium held at the 12th European Nutrition Conference (FENS 2015).

    Science.gov (United States)

    Vinoy, Sophie; Laville, Martine; Feskens, Edith J M

    2016-01-01

    To draw attention to the necessity of considering differences in the digestibility of carbohydrates, and more specifically of starch, a symposium was held at the 12th European Nutrition Conference (FENS), which took place in Berlin from October 20 to 23, 2015. The purpose of this session was to present the consolidated knowledge and recent advances regarding the relationship between slow-release carbohydrates, metabolic responses, and public health issues. Three main topics were presented: 1) the definition of, sources of, and recognised interest in the glycaemic response to slowly digestible starch (SDS); 2) clinical evidence regarding the physiological effects of slow-release carbohydrates from cereal foods; and 3) interest in reducing the postprandial glycaemic response to help prevent metabolic diseases. Foods with the highest SDS content induce the lowest glycaemic responses, as the starch is protected from gelatinisation during processing. In humans, high-SDS food consumption induces slower glucose release, lower postprandial insulinaemia, and stimulation of gut hormones. Moreover, postprandial hyperglycaemia is an independent risk factor for type two diabetes mellitus (T2DM) and cardiovascular disease (CVD). Therefore, given the plausible aetiologic mechanisms, we argue that postprandial glucose levels are relevant for health and disease and represent a meaningful target for intervention, for example, through dietary factors. This symposium was organised by Mondelez International R&D.

  1. THE FIRST PUBLIC RELEASE OF SOUTH POLE TELESCOPE DATA: MAPS OF A 95 deg{sup 2} FIELD FROM 2008 OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Schaffer, K. K.; Crawford, T. M.; Benson, B. A.; Bleem, L. E.; Carlstrom, J. E.; Chang, C. L.; Crites, A. T.; Hoover, S.; Keisler, R. [Kavli Institute for Cosmological Physics, University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Aird, K. A.; Hrubes, J. D. [University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Cho, H. M. [NIST Quantum Devices Group, 325 Broadway Mailcode 817.03, Boulder, CO 80305 (United States); De Haan, T.; Dobbs, M. A.; Holder, G. P. [Department of Physics, McGill University, 3600 Rue University, Montreal, Quebec H3A 2T8 (Canada); George, E. M.; Holzapfel, W. L. [Department of Physics, University of California, Berkeley, CA 94720 (United States); Halverson, N. W. [Department of Astrophysical and Planetary Sciences and Department of Physics, University of Colorado, Boulder, CO 80309 (United States); Joy, M. [Department of Space Science, VP62, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Knox, L., E-mail: kschaf2@saic.edu [Department of Physics, University of California, One Shields Avenue, Davis, CA 95616 (United States); and others

    2011-12-10

    The South Pole Telescope (SPT) has nearly completed a 2500 deg{sup 2} survey of the southern sky in three frequency bands. Here, we present the first public release of SPT maps and associated data products. We present arcminute-resolution maps at 150 GHz and 220 GHz of an approximately 95 deg{sup 2} field centered at R.A. 82.{sup 0}7, decl. -55 Degree-Sign . The field was observed to a depth of approximately 17 {mu}K arcmin at 150 GHz and 41 {mu}K arcmin at 220 GHz during the 2008 austral winter season. Two variations on map filtering and map projection are presented, one tailored for producing catalogs of galaxy clusters detected through their Sunyaev-Zel'dovich effect signature and one tailored for producing catalogs of emissive sources. We describe the data processing pipeline, and we present instrument response functions, filter transfer functions, and map noise properties. All data products described in this paper are available for download at http://pole.uchicago.edu/public/data/maps/ra5h30dec-55 and from the NASA Legacy Archive for Microwave Background Data Analysis server. This is the first step in the eventual release of data from the full 2500 deg{sup 2} SPT survey.

  2. Integration of ROOT Notebooks as a Web-based ATLAS Analysis tool for Public Data Releases and Outreach

    CERN Document Server

    Abah, Anthony

    2016-01-01

    The project worked on the development of a physics analysis and its software under ROOT framework and Jupyter notebooks for the the ATLAS Outreach and the Naples teams. This analysis is created in the context of the release of data and Monte Carlo samples by the ATLAS collaboration. The project focuses on the enhancement of the recent opendata.atlas.cern web platform to be used as educational resources for university students and new researches. The generated analysis structure and tutorials will be used to extend the participation of students from other locations around the World. We conclude the project with the creation of a complete notebook representing the so-called W analysis in C + + language for the mentioned platform.

  3. GENII Version 2 Users’ Guide

    Energy Technology Data Exchange (ETDEWEB)

    Napier, Bruce A.

    2004-03-08

    The GENII Version 2 computer code was developed for the Environmental Protection Agency (EPA) at Pacific Northwest National Laboratory (PNNL) to incorporate the internal dosimetry models recommended by the International Commission on Radiological Protection (ICRP) and the radiological risk estimating procedures of Federal Guidance Report 13 into updated versions of existing environmental pathway analysis models. The resulting environmental dosimetry computer codes are compiled in the GENII Environmental Dosimetry System. The GENII system was developed to provide a state-of-the-art, technically peer-reviewed, documented set of programs for calculating radiation dose and risk from radionuclides released to the environment. The codes were designed with the flexibility to accommodate input parameters for a wide variety of generic sites. Operation of a new version of the codes, GENII Version 2, is described in this report. Two versions of the GENII Version 2 code system are available, a full-featured version and a version specifically designed for demonstrating compliance with the dose limits specified in 40 CFR 61.93(a), the National Emission Standards for Hazardous Air Pollutants (NESHAPS) for radionuclides. The only differences lie in the limitation of the capabilities of the user to change specific parameters in the NESHAPS version. This report describes the data entry, accomplished via interactive, menu-driven user interfaces. Default exposure and consumption parameters are provided for both the average (population) and maximum individual; however, these may be modified by the user. Source term information may be entered as radionuclide release quantities for transport scenarios, or as basic radionuclide concentrations in environmental media (air, water, soil). For input of basic or derived concentrations, decay of parent radionuclides and ingrowth of radioactive decay products prior to the start of the exposure scenario may be considered. A single code run can

  4. Validity and reliability of Turkish version of "Hospital Survey on Patient Safety Culture" and perception of patient safety in public hospitals in Turkey

    OpenAIRE

    Filiz Emel; Bodur Said

    2010-01-01

    Abstract Background The Hospital Survey on Patient Safety Culture (HSOPS) is used to assess safety culture in many countries. Accordingly, the questionnaire has been translated into Turkish for the study of patient safety culture in Turkish hospitals. The aim of this study is threefold: to determine the validity and reliability of the translated form of HSOPS, to evaluate physicians' and nurses' perceptions of patient safety in Turkish public hospitals, and to compare finding with U.S. hospit...

  5. CERT (registered trademark) Resilience Management Model (CERT (registered trademark)-RMM) V1.1: NIST Special Publication Crosswalk Version 2

    Science.gov (United States)

    2014-06-01

    Resource Management 10 HRM – Human Resource Management 11 ID – Identity...Publication (Control Numbers for 800-53 Rev. 4) HRM – Human Resource Management HRM:SG1 Establish Resource Needs HRM:SG1.SP1 Establish Baseline...EXD:SG4.SP2 Correct External Entity Performance 53R4 SA-3, SA-12 FRM – Financial Resource Management FRM:SG1 Establish Financial Commitment

  6. UTM TCL 2.0 Software Version Description (SVD) Document

    Science.gov (United States)

    Mcguirk, Patrick

    2017-01-01

    This is the Unmanned Aircraft Systems (UAS) Traffic Management (UTM) Technical Capability Level(TCL) 2.0 Software Version Description (SVD) document. This UTM TCL 2.0 SVD describes the following four topics: 1. Software Release Contents: A listing of the files comprising this release 2. Installation Instructions: How to install the release and get it running 3. Changes Since Previous Release: General updates since the previous UTM release 4. Known Issues: Known issues and limitations in this release

  7. Version Description and Installation Guide Kernel Version 3.0

    Science.gov (United States)

    1989-12-01

    approved for publication. FOR THE COMMANDER Karl H. Shingler SEI Joint Program Office This work is sponsored by the U.S. Department of Defense. Copyright...8217version’ * $ append/new-version tcl .lis,tc2. lise ,t3 .lis,tc4.lis - [dark -cm. dcc. vdiq]contents -of -’version’ $ delete tcl.lis;,tc2.lis;,tc3.lis...INOIVIOUAL 22b. TELEPHONE NUMBER 22c. OFFICE SYMBOL KARL H. SHINGLER (include A’a Code) 1, 412 268-7630 SEI JPO 00 FORM 1473.83 APR EITION OF JAN 73 IS OBSOLETE. I i SECURITY CLASSIFICATION OF THIS PAGE

  8. Understanding the nature of health: New perspectives for medicine and public health. Improved wellbeing at lower costs [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Johannes Bircher

    2016-02-01

    Full Text Available Background: Current dilemmas of health care systems call for a new look at the nature of health. This is offered by the Meikirch model. We explore its hypothetical benefit for the future of medicine and public health. Meikirch model: It states: “Health is a dynamic state of wellbeing emergent from conducive interactions between individuals’ potentials, life’s demands, and social and environmental determinants.” “Throughout the life course health results when an individuals’ biologically given potential (BGP and his or her personally acquired potential (PAP, interacting with social and environmental determinants, satisfactorily respond to the demands of life.” Methods: We explored the Meikirch model’s possible applications for personal and public health care. Results: The PAP of each individual is the most modifiable component of the model. It responds to constructive social interactions and to personal growth. If an individual’s PAP is nurtured to develop further, it likely will contribute much more to health than without fostering. It may also compensate for losses of the BGP. An ensuing new culture of health may markedly improve health in the society. The rising costs of health care presumably are due in part to the tragedy of the commons and to moral hazard. Health as a complex adaptive system offers new possibilities for patient care, particularly for general practitioners. Discussion: Analysis of health systems by the Meikirch model reveals that in many areas more can be done to improve people’s health and to reduce health care costs than is done today. The Meikirch model appears promising for individual and public health in low and high income countries. Emphasizing health instead of disease the Meikirch model reinforces article 12 of the International Covenant on Economic, Social and Cultural Rights of the United Nations – that abandons the WHO definition - and thereby may contribute to its reinterpretation.

  9. Hypothesis: Is frequent, commercial jet travel by the general public a risk factor for developing cutaneous melanoma? [version 1; referees: 2 approved, 1 approved with reservations

    Directory of Open Access Journals (Sweden)

    Harvey Arbesman

    2015-08-01

    Full Text Available Melanoma incidence has been increasing worldwide over the past 50 years and various risk factors have been identified. Interestingly, multiple studies have shown a multifold increased risk of developing melanoma in jet pilots and airline crew. There has also been a dramatic increase in the availability and frequency of jet travel by the general population during this time period.. Therefore, it is hypothesized that frequent commercial jet travel may represent an additional risk factor for the development of cutaneous melanoma in susceptible individuals of the general public.

  10. A review of public concerns and reactions about food safety following a release of food contaminants (radioactive or otherwise)

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, B. [Department of Radiation Biology, St. Bartholomews and the Royal London School of Medicine, London (United Kingdom)

    1999-07-01

    This study was carried out, by questionnaire and personal interview, to assess the extent of the public's knowledge of the procedures employed by MAFF, and other agencies following a food contamination incident involving radioactive contamination. It was also designed to gauge the public's perception of relative risk from routine discharges into the environment and other agents. The study populations were located in 5 locations - 3 near nuclear facilities, and 2 control groups (1 close to a potential chemical polluting plant). The study was not intended to be rigorous (in terms of sex, age and socio-economic group) in random selection of subjects for interview but it was judged that a fairly representative selection of views was obtained from about 50 people at each location. Overall, and importantly, although about 60% claimed that some their diet was locally grown, most people even in these rural areas purchased nearly all of their food and milk in supermarkets. It was difficult to get the interviewees to take the concept of a large incident involving food bans seriously but they seemed to expect the local authority and the police to be prominent in announcing the news. They did not seem to have much confidence in the broadcast media but, when prompted, thought that a MAFF 'hot-line' would be of greatest use in obtaining on-going information. House to house leaf letting was also mentioned as an effective means of disseminating information. Every-one seemed to want more clear information about food contamination in advance of it becoming a real problem - although how they would react to this information was not clear. All groups were fairly conservative when asked about personal risk but became more extreme over risks to society as a whole, particularly in relation to transport and the environment. Overall, as expected, the public perception of relative risk was somewhat divorced from reality. Because of their geographical location and

  11. Can free open access resources strengthen knowledge-based emerging public health priorities, policies and programs in Africa? [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Ernest Tambo

    2016-05-01

    Full Text Available Tackling emerging epidemics and infectious diseases burden in Africa requires increasing unrestricted open access and free use or reuse of regional and global policies reforms as well as timely communication capabilities and strategies. Promoting, scaling up data and information sharing between African researchers and international partners are of vital importance in accelerating open access at no cost. Free Open Access (FOA health data and information acceptability, uptake tactics and sustainable mechanisms are urgently needed. These are critical in establishing real time and effective knowledge or evidence-based translation, proven and validated approaches, strategies and tools to strengthen and revamp health systems.  As such, early and timely access to needed emerging public health information is meant to be instrumental and valuable for policy-makers, implementers, care providers, researchers, health-related institutions and stakeholders including populations when guiding health financing, and planning contextual programs.

  12. The Citadel of Alessandria: Values and strategies involved in the process of releasing from the public ownership

    Directory of Open Access Journals (Sweden)

    Cristina Coscia

    2015-06-01

    Full Text Available The issues concerning the valorization of assets state property, their management and financial rebalancing through a careful policy of disposals and growth of profitability. These dynamics, through the grant or lease to third parties, have been expanding and pay increasing attention to issues of public finance. A radical change of perspective has started in the evaluation of the role of asset management in the field of local authorities. The heritage is no longer considered static, but dynamic; it is gained as a strategic asset in the overall financial management. Local governments make use of this to ensure their service delivery goals and to maximize the well-being of the community. The asset of Defense Ministry transferred to the State Property Office, offers important opportunities for development: not only properties to insert in the real estate market for monetary returns profits to help the Local Governments finance (strategy that did not lead to the desired results, but also opportunities to initiate processes of valorization affecting the industrial area and the surrounding geographical area. In this sense, the case of the Citadel of Alessandria becomes a paradigmatic work to simulate technical decision making application to simulate applications (SWOT, Analytic Hierarchy Process, Analytic Network Process, etc.. Regarding the process and tools that can act as support in delineating the most compatible functional scenario.

  13. Solar Access to Public Capital (SAPC) Working Group: Best Practices in PV System Installation; Version 1.0, March 2015; Period of Performance, October 2014 - September 2015

    Energy Technology Data Exchange (ETDEWEB)

    Doyle, C. [IBTS and Dividend Solar, Austin, TX (United States). Dividend Solar; Truitt, A. [Acuity Power Group, Denver, CO (United States); Inda, D. [Clean Power Finance, San Francisco, CA (United States); Lawrence, R. [North American Board of Certified Energy Practitioners, Clifton Park, NY (United States); Lockhart, R. [Acuity Power Group, Wellesley Hills, MA (United States); Golden, M. [Efficiency.org and IBTS, Sausalito, CA (United States)

    2015-03-01

    The following Photovoltaics Installation Best Practices Guide is one of several work products developed by the Solar Access to Public Capital (SAPC) working group, which works to open capital market investment. SAPC membership includes over 450 leading solar developers, financiers and capital managers, law firms, rating agencies, accounting and engineering firms, and other stakeholders engaged in solar asset deployment. SAPC activities are directed toward foundational elements necessary to pool project cash flows into tradable securities: standardization of power purchase and lease contracts for residential and commercial end customers; development of performance and credit data sets to facilitate investor due diligence activities; comprehension of risk perceived by rating agencies; and the development of best practice guides for PV system installation and operations and maintenance (O&M) in order to encourage high-quality system deployment and operation that may improve lifetime project performance and energy production. This PV Installation Best Practices Guide was developed through the SAPC Installation Best Practices subcommittee, a subgroup of SAPC comprised of a wide array of solar industry leaders in numerous fields of practice. The guide was developed over roughly one year and eight months of direct engagement by the subcommittee and two working group comment periods.

  14. The internet trade of counterfeit spirits in Russia – an emerging problem undermining alcohol, public health and youth protection policies? [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Maria Neufeld

    2017-04-01

    Full Text Available Counterfeit alcohol belongs to the category of unrecorded alcohol not reflected in official statistics. The internet trade of alcoholic beverages has been prohibited by the Russian Federation since 2007, but various sellers still offer counterfeit spirits (i.e., forged brand spirits over the internet to Russian consumers, mostly in a non-deceptive fashion at prices up to 15 times lower than in regular sale. The public health issues arising from this unregulated trade include potential harm to underage drinkers, hazards due to toxic ingredients such as methanol, but most importantly alcohol harms due to potentially increased drinking volumes due to low prices and high availability on the internet. The internet sale also undermines existing alcohol policies such as restrictions of sale locations, sale times and minimum pricing. The need to enforce measures against counterfeiting of spirits, but specifically their internet trade should be implemented as key elements of alcohol policies to reduce unrecorded alcohol consumption, which is currently about 33 % of total consumption in Russia.

  15. User guide for MODPATH Version 7—A particle-tracking model for MODFLOW

    Science.gov (United States)

    Pollock, David W.

    2016-09-26

    MODPATH is a particle-tracking post-processing program designed to work with MODFLOW, the U.S. Geological Survey (USGS) finite-difference groundwater flow model. MODPATH version 7 is the fourth major release since its original publication. Previous versions were documented in USGS Open-File Reports 89–381 and 94–464 and in USGS Techniques and Methods 6–A41.MODPATH version 7 works with MODFLOW-2005 and MODFLOW–USG. Support for unstructured grids in MODFLOW–USG is limited to smoothed, rectangular-based quadtree and quadpatch grids.A software distribution package containing the computer program and supporting documentation, such as input instructions, output file descriptions, and example problems, is available from the USGS over the Internet (http://water.usgs.gov/ogw/modpath/).

  16. Enhanced Systemic Understanding of the Information Environment in Complex Crisis Management - Analytical Concept, Version 1.0

    Science.gov (United States)

    2010-10-22

    Coordinated Draft Version 1.0 – 22 October 2010 Page 33 of 205 UNCLASSIFIED FOR PUBLIC RELEASE o Spiral of Silence o Berlo Communication Model o...Washington, DC, June 2008. [Kilcullen 2007] Kilcullen, David : Counterinsurgency in Iraq: Theory and Practice, 2007. - Noetic. – Filename...Fischer Lexikon Publizistik Massenkommunikation. Fischer: Frankfurt am Main, 1994. [Nyheim et al. 2001] Nyheim, David ; Leonhardt, Manuela; Gaigals

  17. MATILDA Version 2: Rough Earth TIALD Model for Laser Probabilistic Risk Assessment in Hilly Terrain - Part I

    Science.gov (United States)

    2017-03-13

    AFRL-RH-FS-TR-2017-0009 MATILDA Version-2: Rough Earth TIALD Model for Laser Probabilistic Risk Assessment in Hilly Terrain – Part I Paul K...Probabilistic Risk Assessment in Hilly Terrain – Part I ii Distribution A: Approved for public release; distribution unlimited. PA Case No: TSRL-PA-2017-0169...any penalty for failing to comply with a collection of information if it does not display a currently valid OMB control number. PLEASE DO NOT RETURN

  18. Cost-effectiveness of modified-release prednisone in the treatment of moderate to severe rheumatoid arthritis with morning stiffness based on directly elicited public preference values

    Directory of Open Access Journals (Sweden)

    Dunlop W

    2013-10-01

    -prednisone. Furthermore, utility benefits were not captured in the clinical setting. Conclusion: This analysis demonstrates that, based on the CAPRA-1 trial and directly elicited public preference values, MR-prednisone is a cost-effective treatment option when compared with IR-prednisone for RA patients with morning stiffness over one year, according to commonly applied UK thresholds (£20,000–£30,000 per QALY. Further research into the costs of morning stiffness in RA is required. Keywords: modified-release prednisone, rheumatoid arthritis, morning stiffness, cost-effectiveness analysis, cost utility analysis, quality of life

  19. EJSCREEN Data--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — EJSCREEN is an environmental justice (EJ) screening and mapping tool that provides EPA with a nationally consistent dataset and methodology for calculating "EJ...

  20. EJSCREEN Indexes--2017 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — EJSCREEN is an environmental justice (EJ) screening and mapping tool that provides EPA with a nationally consistent dataset and methodology for calculating "EJ...

  1. EJSCREEN Indexes--2016 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — EJSCREEN is an environmental justice (EJ) screening and mapping tool that provides EPA with a nationally consistent dataset and methodology for calculating "EJ...

  2. Bibliography of SEAS Sponsored Publications, Version I

    Science.gov (United States)

    1980-07-01

    TRANSMISSION LOSS PRE31GTION 4OOLLS’" (U), LETT-ER REPORT, NJSO LER iER TAii-COl, 5 FE3RJARY 1975, CONFIDENTIAL DEVILBISS , . MARTINE .;A)YN N...JANUARY 1973, SFCRET ’lUNGER, A. A., "DISTRIBUTION OF POSITIVE AND NEGATIVE SURFACE MIKED LAYER SOUNU VELO ITY GADIENTS IN lIE tiORFHEASI ATLANTI.", NAVAL

  3. Drinking Water Mapping Application (DWMA) - Public Version

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Drinking Water Mapping Application (DWMA) is a web-based geographic information system (GIS) that enhances the capabilities to identify major contaminant risks...

  4. Drinking Water Mapping Application (DWMA) - Public Version

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Drinking Water Mapping Application (DWMA) is a web-based geographic information system (GIS) that enhances the capabilities to identify major contaminant risks...

  5. Zombies—A Pop Culture Resource for Public Health Awareness

    Centers for Disease Control (CDC) Podcasts

    2013-04-24

    Reginald Tucker reads an abridged version of the Emerging Infectious Diseases Another Dimension, Zombies—A Pop Culture Resource for Public Health Awareness.  Created: 4/24/2013 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/24/2013.

  6. East Asian Seas Regional Climatology Version 2.0 from 1804 to 2014 (NODC Accession 0123300)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The East Asian Seas Regional Climatology Version 2.0 is an update to the preliminary version released in May 2012. This update includes new temperature and salinity...

  7. TOUGH2 User's Guide Version 2

    Energy Technology Data Exchange (ETDEWEB)

    Pruess, K.; Oldenburg, C.M.; Moridis, G.J.

    1999-11-01

    TOUGH2 is a numerical simulator for nonisothermal flows of multicomponent, multiphase fluids in one, two, and three-dimensional porous and fractured media. The chief applications for which TOUGH2 is designed are in geothermal reservoir engineering, nuclear waste disposal, environmental assessment and remediation, and unsaturated and saturated zone hydrology. TOUGH2 was first released to the public in 1991; the 1991 code was updated in 1994 when a set of preconditioned conjugate gradient solvers was added to allow a more efficient solution of large problems. The current Version 2.0 features several new fluid property modules and offers enhanced process modeling capabilities, such as coupled reservoir-wellbore flow, precipitation and dissolution effects, and multiphase diffusion. Numerous improvements in previously released modules have been made and new user features have been added, such as enhanced linear equation solvers, and writing of graphics files. The T2VOC module for three-phase flows of water, air and a volatile organic chemical (VOC), and the T2DM module for hydrodynamic dispersion in 2-D flow systems have been integrated into the overall structure of the code and are included in the Version 2.0 package. Data inputs are upwardly compatible with the previous version. Coding changes were generally kept to a minimum, and were only made as needed to achieve the additional functionalities desired. TOUGH2 is written in standard FORTRAN77 and can be run on any platform, such as workstations, PCs, Macintosh, mainframe and supercomputers, for which appropriate FORTRAN compilers are available. This report is a self-contained guide to application of TOUGH2 to subsurface flow problems. It gives a technical description of the TOUGH2 code, including a discussion of the physical processes modeled, and the mathematical and numerical methods used. Illustrative sample problems are presented along with detailed instructions for preparing input data.

  8. The National Energy Audit (NEAT) Engineering Manual (Version 6)

    Energy Technology Data Exchange (ETDEWEB)

    Gettings, M.B.

    2001-04-20

    Government-funded weatherization assistance programs resulted from increased oil prices caused by the 1973 oil embargo. These programs were instituted to reduce US consumption of oil and help low-income families afford the increasing cost of heating their homes. In the summer of 1988, Oak Ridge National Laboratory (ORNL) began providing technical support to the Department of Energy (DOE) Weatherization Assistance Program (WAP). A preliminary study found no suitable means of cost-effectively selecting energy efficiency improvements (measures) for single-family homes that incorporated all the factors seen as beneficial in improving cost-effectiveness and usability. In mid-1989, ORNL was authorized to begin development of a computer-based measure selection technique. In November of 1992 a draft version of the program was made available to all WAP state directors for testing. The first production release, Version 4.3, was made available in october of 1993. The Department of Energy's Weatherization Assistance Program has continued funding improvements to the program increasing its user-friendliness and applicability. initial publication of this engineering manual coincides with availability of Version 6.1, November 1997, though algorithms described generally apply to all prior versions. Periodic updates of specific sections in the manual will permit maintaining a relevant document. This Engineering Manual delineates the assumptions used by NEAT in arriving at the measure recommendations based on the user's input of the building characteristics. Details of the actual data entry are available in the NEAT User's Manual (ORNL/Sub/91-SK078/1) and will not be discussed in this manual.

  9. Versioning Complex Data

    Energy Technology Data Exchange (ETDEWEB)

    Macduff, Matt C.; Lee, Benno; Beus, Sherman J.

    2014-06-29

    Using the history of ARM data files, we designed and demonstrated a data versioning paradigm that is feasible. Assigning versions to sets of files that are modified with some special assumptions and domain specific rules was effective in the case of ARM data, which has more than 5000 datastreams and 500TB of data.

  10. Solving the heat transfer in the cold rain of a cross flow cooling tower. N3S code - cooling tower release; Traitement thermique de la zone de pluie des aerorefrigerants a contre-courant. Code N3S - version aerorefrigerants

    Energy Technology Data Exchange (ETDEWEB)

    Grange, J.L.

    1996-09-01

    A simplified model for heat and mass transfer in the lower rainfall of a counter-flow cooling toward had to be implemented in the N3S code-cooling tower release It is built from an old code: ZOPLU. The air velocity field is calculated by N3S. The air and water temperature fields are solved by a Runge-Kutta method on a mesh in an adequate number of vertical plans. Heat exchange and drags correlations are given. And all the necessary parameters are specified. All the subroutines are described. They are taken from ZOPLU and modified in order to adapt their abilities to the N3S requirements. (author). 6 refs., 3 figs., 3 tabs., 3 appends.

  11. Version pressure feedback mechanisms for speculative versioning caches

    Science.gov (United States)

    Eichenberger, Alexandre E.; Gara, Alan; O& #x27; Brien, Kathryn M.; Ohmacht, Martin; Zhuang, Xiaotong

    2013-03-12

    Mechanisms are provided for controlling version pressure on a speculative versioning cache. Raw version pressure data is collected based on one or more threads accessing cache lines of the speculative versioning cache. One or more statistical measures of version pressure are generated based on the collected raw version pressure data. A determination is made as to whether one or more modifications to an operation of a data processing system are to be performed based on the one or more statistical measures of version pressure, the one or more modifications affecting version pressure exerted on the speculative versioning cache. An operation of the data processing system is modified based on the one or more determined modifications, in response to a determination that one or more modifications to the operation of the data processing system are to be performed, to affect the version pressure exerted on the speculative versioning cache.

  12. A public world without public relations?

    OpenAIRE

    Nayden, Nikolay

    2015-01-01

    The term "public relations" (PR) has long gained currency as meaning the practice of producing a positive public image. This article argues that public relations should be released from the prison of "PR" and, instead, reconceptualised as relations which define the public realm much as economic relations define the economy. From this point of view, three main levels of public relations can be distinguished: (1) relations between public institutions, (2) relations between citizens and public i...

  13. A public world without public relations?:

    OpenAIRE

    Nayden, Nikolay

    2009-01-01

    The term "public relations" (PR) has long gained currency as meaning the practice of producing a positive public image. This article argues that public relations should be released from the prison of "PR" and, instead, reconceptualised as relations which define the public realm much as economic relations define the economy. From this point of view, three main levels of public relations can be distinguished: (1) relations between public institutions, (2) relations between citizens and public i...

  14. MT3D-USGS version 1: A U.S. Geological Survey release of MT3DMS updated with new and expanded transport capabilities for use with MODFLOW

    Science.gov (United States)

    Bedekar, Vivek; Morway, Eric D.; Langevin, Christian D.; Tonkin, Matthew J.

    2016-09-30

    MT3D-USGS, a U.S. Geological Survey updated release of the groundwater solute transport code MT3DMS, includes new transport modeling capabilities to accommodate flow terms calculated by MODFLOW packages that were previously unsupported by MT3DMS and to provide greater flexibility in the simulation of solute transport and reactive solute transport. Unsaturated-zone transport and transport within streams and lakes, including solute exchange with connected groundwater, are among the new capabilities included in the MT3D-USGS code. MT3D-USGS also includes the capability to route a solute through dry cells that may occur in the Newton-Raphson formulation of MODFLOW (that is, MODFLOW-NWT). New chemical reaction Package options include the ability to simulate inter-species reactions and parent-daughter chain reactions. A new pump-and-treat recirculation package enables the simulation of dynamic recirculation with or without treatment for combinations of wells that are represented in the flow model, mimicking the above-ground treatment of extracted water. A reformulation of the treatment of transient mass storage improves conservation of mass and yields solutions for better agreement with analytical benchmarks. Several additional features of MT3D-USGS are (1) the separate specification of the partitioning coefficient (Kd) within mobile and immobile domains; (2) the capability to assign prescribed concentrations to the top-most active layer; (3) the change in mass storage owing to the change in water volume now appears as its own budget item in the global mass balance summary; (4) the ability to ignore cross-dispersion terms; (5) the definition of Hydrocarbon Spill-Source Package (HSS) mass loading zones using regular and irregular polygons, in addition to the currently supported circular zones; and (6) the ability to specify an absolute minimum thickness rather than the default percent minimum thickness in dry-cell circumstances.Benchmark problems that implement the new

  15. The Lagrangian particle dispersion model FLEXPART version 10

    Science.gov (United States)

    Pisso, Ignacio; Sollum, Espen; Grythe, Henrik; Kristiansen, Nina; Cassiani, Massimo; Eckhardt, Sabine; Thompson, Rona; Groot Zwaaftnik, Christine; Evangeliou, Nikolaos; Hamburger, Thomas; Sodemann, Harald; Haimberger, Leopold; Henne, Stephan; Brunner, Dominik; Burkhart, John; Fouilloux, Anne; Fang, Xuekun; Phillip, Anne; Seibert, Petra; Stohl, Andreas

    2017-04-01

    The Lagrangian particle dispersion model FLEXPART was in its first original release in 1998 designed for calculating the long-range and mesoscale dispersion of air pollutants from point sources, such as after an accident in a nuclear power plant. The model has now evolved into a comprehensive tool for atmospheric transport modelling and analysis. Its application fields are extended to a range of atmospheric transport processes for both atmospheric gases and aerosols, e.g. greenhouse gases, short-lived climate forces like black carbon, volcanic ash and gases as well as studies of the water cycle. We present the newest release, FLEXPART version 10. Since the last publication fully describing FLEXPART (version 6.2), the model code has been parallelised in order to allow for the possibility to speed up computation. A new, more detailed gravitational settling parametrisation for aerosols was implemented, and the wet deposition scheme for aerosols has been heavily modified and updated to provide a more accurate representation of this physical process. In addition, an optional new turbulence scheme for the convective boundary layer is available, that considers the skewness in the vertical velocity distribution. Also, temporal variation and temperature dependence of the OH-reaction are included. Finally, user input files are updated to a more convenient and user-friendly namelist format, and the option to produce the output-files in netCDF-format instead of binary format is implemented. We present these new developments and show recent model applications. Moreover, we also introduce some tools for the preparation of the meteorological input data, as well as for the processing of FLEXPART output data.

  16. MCNP(TM) Version 5.

    Energy Technology Data Exchange (ETDEWEB)

    Cox, L. J. (Lawrence J.); Barrett, R. F. (Richard F.); Booth, Thomas Edward; Briesmeister, Judith F.; Brown, F. B. (Forrest B.); Bull, J. S. (Jeffrey S.); Giesler, G. C. (Gregg Carl); Goorley, J. T. (John T.); Mosteller, R. D. (Russell D.); Forster, R. A. (R. Arthur); Post, S. E. (Susan E.); Prael, R. E. (Richard E.); Selcow, Elizabeth Carol,; Sood, A. (Avneet)

    2002-01-01

    The Monte Carlo transport workhorse, MCNP, is undergoing a massive renovation at Los Alamos National Laboratory (LANL) in support of the Eolus Project of the Advanced Simulation and Computing (ASCI) Program. MCNP Version 5 (V5) (expected to be released to RSICC in Spring, 2002) will consist of a major restructuring from FORTRAN-77 (with extensions) to ANSI-standard FORTRAN-90 with support for all of the features available in the present release (MCNP-4C2/4C3). To most users, the look-and-feel of MCNP will not change much except for the improvements (improved graphics, easier installation, better online documentation). For example, even with the major format change, full support for incremental patching will still be provided. In addition to the language and style updates, MCNP V5 will have various new user features. These include improved photon physics, neutral particle radiography, enhancements and additions to variance reduction methods, new source options, and improved parallelism support (PVM, MPI, OpenMP).

  17. Transfinite Version of Welter's Game

    OpenAIRE

    Abuku, Tomoaki

    2017-01-01

    We study the transfinite version of Welter's Game, a combinatorial game, which is played on the belt divided into squares with general ordinal numbers extended from natural numbers. In particular, we obtain a straight-forward solution for the transfinite version based on those of the transfinite version of Nim and the original version of Welter's Game.

  18. 7 CFR 550.29 - Press releases.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Press releases. 550.29 Section 550.29 Agriculture... Program Management § 550.29 Press releases. Press releases or other forms of public notification will be... opportunity to review, in advance, all written press releases and any other written information to be...

  19. Public Waters Inventory Maps

    Data.gov (United States)

    Minnesota Department of Natural Resources — This theme is a scanned and rectified version of the Minnesota DNR - Division of Waters "Public Waters Inventory" (PWI) maps. DNR Waters utilizes a small scale...

  20. T-PHOT version 2.0: Improved algorithms for background subtraction, local convolution, kernel registration, and new options

    Science.gov (United States)

    Merlin, E.; Bourne, N.; Castellano, M.; Ferguson, H. C.; Wang, T.; Derriere, S.; Dunlop, J. S.; Elbaz, D.; Fontana, A.

    2016-11-01

    Aims: We present the new release - version 2.0 - of t-phot, a publicly available software package developed to perform PSF-matched, prior-based, multiwavelength deconfusion photometry of extragalactic fields. Methods: New features included in the code are presented and discussed: background estimation, fitting using position dependent kernels, flux prioring, diagnostical statistics on the residual image, exclusion of selected sources from the model and residual images, and individual registration of fitted objects. Results: The new options improve on the performance of the code, allowing for more accurate results and providing useful aids for diagnostics.

  1. Representative Doses to Members of the Public from Atmospheric Releases of 131I at the Mayak Production Association Facilities from 1948 through 1972

    Energy Technology Data Exchange (ETDEWEB)

    Eslinger, Paul W.; Napier, Bruce A.; Anspaugh, Lynn R.

    2014-04-03

    Scoping epidemiologic studies performed by researchers from the Southern Urals Biophysics Institute revealed an excess prevalence of thyroid nodules and an increased incidence of thyroid cancer among residents of Ozersk, Russia, who were born in the early 1950s. Ozersk is located about 5 km from the facilities where the Mayak Production Association produced nuclear materials for the Russian weapons program. Reactor operations began in June 1948 and chemical separation of plutonium from irradiated fuel began in February 1949. The U.S.–Russia Joint Coordinating Committee on Radiation Effects Research conducted a series of projects over a 10-year period to assess the radiation risks in the Southern Urals. This paper uses data collected under Committee projects to reconstruct individual time-dependent thyroid doses to reference individuals living in Ozersk from 131I released to the atmosphere. Between 3.22×1016 and 4.31×1016 Bq of 131I released may have been released during the 1948–1972 time period, and a best estimate is 3.76×1016 Bq. A child born in 1947 is estimated to have received a cumulative thyroid dose of 2.3 Gy for 1948–1972, with a 95% confidence interval of 0.51–7.3 Gy. Annual doses were the highest in 1949 and a child who was 5 years old in 1949 is estimated to have a received an annual thyroid dose of 0.93 Gy with a 95% confidence interval of 0.19–3.5 Gy.

  2. 公众参与政府环境信息发布问责初探%Study of Public Participation Accountability in Governmental Environmental Information Release

    Institute of Scientific and Technical Information of China (English)

    潘佳

    2012-01-01

    政府的环境信息公开是一切环境管理工作的起点。我国时下的政府环境信息公开问责是内部的,缺乏公众对权力的制约,导致存在种种问题,极大地制约着信息公开工作的开展。因此,逐步引入外部制约是大势所趋。这一外部机制由公众参与考评、环境信息领域的独立监察专员和公民或环保组织提起的环境信息公开行政诉讼构成。外部参评机制的建构不能一蹴而就,宜和内部机制结合起来发挥作用,逐渐过渡到外部问责模式。%Governmental environmental information disclosure is the starting point of all the environ- mental management work. Nowadays, the public accountability of the governmental environmental in- formation in our country is internal, and all kinds of problems arise because of the lack of public pow- er constraints, which greatly restrict the implementation of information publicity. So the external con- straint is of great necessity. This external mechanism is composed of the public participation in the e- valuation, an independent ombudsman in the field of environmental information, and the administra- tive proceedings of the environmental information disclosure raised by the Citizens or environmental groups. The external mechanism can not accomplish in one move, so at present a transition from the combination of internal and external mechanism to the external accountability is desirable.

  3. Early Childhood Longitudinal Study, Kindergarten Class of 2010-11 (ECLS-K:2011). User's Manual for the ECLS-K:2011 Kindergarten-First Grade Data File and Electronic Codebook, Public Version. NCES 2015-078

    Science.gov (United States)

    Tourangeau, Karen; Nord, Christine; Lê, Thanh; Wallner-Allen, Kathleen; Hagedorn, Mary C.; Leggitt, John; Najarian, Michelle

    2015-01-01

    This manual provides guidance and documentation for users of the longitudinal kindergarten-first grade (K-1) data file of the Early Childhood Longitudinal Study, Kindergarten Class of 2010-11 (ECLS-K:2011). It mainly provides information specific to the first-grade rounds of data collection. Data for the ECLS-K:2011 are released in both a…

  4. A new tool for modeling dune field evolution based on an accessible, GUI version of the Werner dune model

    Science.gov (United States)

    Barchyn, Thomas E.; Hugenholtz, Chris H.

    2012-02-01

    Research into aeolian dune form and dynamics has benefited from simple and abstract cellular automata computer models. Many of these models are based upon a seminal framework proposed by Werner (1995). Unfortunately, most versions of this model are not publicly available or are not provided in a format that promotes widespread use. In our view, this hinders progress in linking model simulations to empirical data (and vice versa). To this end, we introduce an accessible, graphical user interface (GUI) version of the Werner model. The novelty of this contribution is that it provides a simple interface and detailed instructions that encourage widespread use and extension of the Werner dune model for research and training purposes. By lowering barriers for researchers to develop and test hypotheses about aeolian dune and dune field patterns, this release addresses recent calls to improve access to earth surface models.

  5. Nuflood, Version 1.x

    Energy Technology Data Exchange (ETDEWEB)

    2016-07-29

    NUFLOOD Version 1.x is a surface-water hydrodynamic package designed for the simulation of overland flow of fluids. It consists of various routines to address a wide range of applications (e.g., rainfall-runoff, tsunami, storm surge) and real time, interactive visualization tools. NUFLOOD has been designed for general-purpose computers and workstations containing multi-core processors and/or graphics processing units. The software is easy to use and extensible, constructed in mind for instructors, students, and practicing engineers. NUFLOOD is intended to assist the water resource community in planning against water-related natural disasters.

  6. TOGAF version 9

    CERN Document Server

    Group, The Open

    2010-01-01

    This is the official Open Group Pocket Guide for TOGAF Version 9 Enterprise Edition. This pocket guide is published by Van Haren Publishing on behalf of The Open Group.TOGAF, The Open Group Architectural Framework is a fast growing, worldwide accepted standard that can help organisations build their own Enterprise Architecture in a standardised way. This book explains why the in?s and out?s of TOGAF in a concise manner.This book explains how TOGAF can help to make an Enterprise Architecture. Enterprise Architecture is an approach that can help management to understand this growing complexity.

  7. Evaluation of unique identifiers used as keys to match identical publications in Pure and SciVal – a case study from health science [version 2; referees: 1 approved, 2 approved with reservations

    Directory of Open Access Journals (Sweden)

    Heidi Holst Madsen

    2016-09-01

    Full Text Available Unique identifiers (UID are seen as an effective key to match identical publications across databases or identify duplicates in a database. The objective of the present study is to investigate how well UIDs work as match keys in the integration between Pure and SciVal, based on a case with publications from the health sciences. We evaluate the matching process based on information about coverage, precision, and characteristics of publications matched versus not matched with UIDs as the match keys. We analyze this information to detect errors, if any, in the matching process. As an example we also briefly discuss how publication sets formed by using UIDs as the match keys may affect the bibliometric indicators number of publications, number of citations, and the average number of citations per publication.  The objective is addressed in a literature review and a case study. The literature review shows that only a few studies evaluate how well UIDs work as a match key. From the literature we identify four error types: Duplicate digital object identifiers (DOI, incorrect DOIs in reference lists and databases, DOIs not registered by the database where a bibliometric analysis is performed, and erroneous optical or special character recognition. The case study explores the use of UIDs in the integration between the databases Pure and SciVal. Specifically journal publications in English are matched between the two databases. We find all error types except erroneous optical or special character recognition in our publication sets. In particular the duplicate DOIs constitute a problem for the calculation of bibliometric indicators as both keeping the duplicates to improve the reliability of citation counts and deleting them to improve the reliability of publication counts will distort the calculation of average number of citations per publication. The use of UIDs as a match key in citation linking is implemented in many settings, and the availability of

  8. URGENCES NOUVELLE VERSION

    CERN Multimedia

    Medical Service

    2002-01-01

    The table of emergency numbers that appeared in Bulletin 10/2002 is out of date. The updated version provided by the Medical Service appears on the following page. Please disregard the previous version. URGENT NEED OF A DOCTOR GENEVAPATIENT NOT FIT TO BE MOVED: Call your family doctor Or SOS MEDECINS (24H/24H) 748 49 50 Or ASSOC. OF GENEVA DOCTORS (7H-23H) 322 20 20 PATIENT CAN BE MOVED: HOPITAL CANTONAL 24 Micheli du Crest 372 33 11 382 33 11 CHILDREN'S HOSPITAL 6 rue Willy Donzé 382 68 18 382 45 55 MATERNITY 24 Micheli du Crest 382 68 16 382 33 11 OPHTALMOLOGY 22 Alcide Jentzer 382 84 00 HOPITAL DE LA TOUR Meyrin 719 61 11 CENTRE MEDICAL DE MEYRIN Champs Fréchets 719 74 00 URGENCES : FIRE BRIGADE 118 FIRE BRIGADE CERN 767 44 44 BESOIN URGENT D'AMBULANCE (GENEVE ET VAUD) : 144 POLICE 117 ANTI-POISON CENTRE 24H/24H 01 251 51 510 EUROPEAN EMERGENCY CALL: 112 FRANCE PATIENT NOT FIT TO BE MOVED: call your family doctor PATIENT CAN BE MOVED: ST. JULIE...

  9. LHC brochure (English version)

    CERN Multimedia

    Lefevre, C

    2010-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  10. LHC brochure (Italian version)

    CERN Multimedia

    Lefevre, Christiane

    2011-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  11. LHC brochure (German version)

    CERN Multimedia

    Lefevre, Christiane

    2011-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  12. LHC brochure (Danish version)

    CERN Multimedia

    Lefevre, C

    2010-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  13. LHC brochure (French version)

    CERN Multimedia

    Lefevre, C

    2010-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  14. LHC brochure (English version)

    CERN Multimedia

    Lefevre, C

    2009-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  15. LHC brochure (German version)

    CERN Multimedia

    Marcastel, Fabienne

    2014-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  16. LHC brochure (French version)

    CERN Multimedia

    Marcastel, Fabienne

    2014-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  17. LHC brochure (English version)

    CERN Multimedia

    AUTHOR|(CDS)2070305

    2014-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which started up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  18. LHC brochure (Spanish version)

    CERN Multimedia

    Lefevre, C

    2008-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  19. LHC brochure (Polish version)

    CERN Multimedia

    Lefevre, C

    2008-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  20. LHC brochure (Greek version)

    CERN Multimedia

    Lefèvre, C

    2006-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  1. LHC Brochure (norwegian version)

    CERN Multimedia

    Marcastel, F

    2006-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  2. LHC brochure (Norwegian version)

    CERN Multimedia

    Lefevre, C

    2009-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  3. LHC Brochure (catalan version)

    CERN Multimedia

    Marcastel, F

    2006-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  4. LHC brochure (Catalan version)

    CERN Multimedia

    Lefevre, C

    2008-01-01

    A presentation of the largest and the most powerful particle accelerator in the world, the Large Hadron Collider (LHC), which will start-up in 2008. Its role, characteristics, technologies, etc. are explained for the general public.

  5. shiftNMFk 1.1: Robust Nonnegative matrix factorization with kmeans clustering and signal shift, for allocation of unknown physical sources, toy version for open sourcing with publications

    Energy Technology Data Exchange (ETDEWEB)

    2016-07-19

    This code is a toy (short) version of CODE-2016-83. From a general perspective, the code represents an unsupervised adaptive machine learning algorithm that allows efficient and high performance de-mixing and feature extraction of a multitude of non-negative signals mixed and recorded by a network of uncorrelated sensor arrays. The code identifies the number of the mixed original signals and their locations. Further, the code also allows deciphering of signals that have been delayed in regards to the mixing process in each sensor. This code is high customizable and it can be efficiently used for a fast macro-analyses of data. The code is applicable to a plethora of distinct problems: chemical decomposition, pressure transient decomposition, unknown sources/signal allocation, EM signal decomposition. An additional procedure for allocation of the unknown sources is incorporated in the code.

  6. Public Sector IS Maturity Models

    DEFF Research Database (Denmark)

    Zinner Henriksen, Helle; Andersen, Kim Normann; Medaglia, Rony

    2011-01-01

    citizenpublic interaction, such as in public education. In this paper we use a revised version of the Public Sector Process Rebuilding (PPR) maturity model for mapping 200 websites of public primary schools in Denmark. Findings reveal a much less favorable picture of the digitization of the Danish public sector...

  7. New features in McStas, version 1.5

    DEFF Research Database (Denmark)

    Åstrand, P.O.; Lefmann, K.; Farhi, E.

    2002-01-01

    The neutron ray-tracing simulation package McStas has attracted numerous users, and the development of the package continues with version 1.5 released at the ICNS 2001 conference. New features include: support for neutron polarisation, labelling of neutrons, realistic source and sample components...

  8. Documentation to the NCES Common Core of Data Public Elementary/Secondary School Universe Survey: School Year 2010-11. Version Provisional 2a. NCES 2012-338rev

    Science.gov (United States)

    Keaton, Patrick

    2012-01-01

    The Public Elementary/Secondary School Universe file includes data for the following variables: NCES school ID number, state school ID number, name of the school, name of the agency that operates the school, mailing address, physical location address, phone number, school type, operational status, locale code, latitude, longitude, county number,…

  9. Public Release of 30-year (1979-2008) NLDAS High-resolution Products - Analysis and Validation for Soil Moisture and Temperature

    Science.gov (United States)

    Xia, Y.; Ek, M. B.; Wood, E. F.; Luo, L.; Sheffield, J.; Lettenmaier, D. P.; Livneh, B.; Mocko, D. M.; Cosgrove, B.; Meng, C. J.; Wei, H.; Koren, V.; Schaake, J. C.; Mo, K. C.; Mitchell, K.

    2009-12-01

    The NCEP Environmental Modeling Center (EMC) collaborated with its CPPA (Climate Prediction Program of the Americas) partners to develop a North American Land Data Assimilation System (NLDAS, http://www.emc.ncep.noaa.gov/mmb/nldas). The NLDAS includes multi-model analysis/monitoring products to focus on drought and flooding monitoring. NLDAS products consist of 30-year (1979-2008) retrospective and 0.5-year near realtime (2009-current time, with a 4-day lag) water (i.e., evapotranspiration, runoff, canopy evaporation, sublimation) and energy (sensible heat flux, latent heat flux, ground heat flux, net radiation) fluxes, and state (i.e., soil moisture with different layers, soil temperatures, snow water equivalent, snow depth, snow cover) variables with an hourly temporal resolution and a 1/8th degree spatial resolution for four land surface models (NCEP/Noah, NASA/Mosaic, OHD/SAC, and Princeton/VIC). This study used common hourly land surface forcing derived from NCEP's retrospective and realtime North American Regional Reanalysis System (NARR) except for precipitation. The precipitation forcing is anchored to a daily gauge-only precipitation analysis over CONUS that applies the Parameter-elevation Regressions on Independent Slopes Model (PRISM) correction. This daily precipitation analysis is then temporally disaggregated to hourly precipitation amounts using stage II radar and satellite retrieved precipitation products. The NARR-based surface downward solar radiation is bias-corrected using seven years (1997-2004) of GOES satellite-derived solar radiation retrievals. This presentation summarizes the NLDAS concept, configuration, forcing data, the four land surface models and their output. All 30-year hourly forcing and hourly outputs from four land surface models are stored on a NCEP public server, which can be download by public users. In this presentation, we analyze soil moisture and temperature for four models and validate them using the Illinois soil

  10. Herwig++ 2.5 release note

    Energy Technology Data Exchange (ETDEWEB)

    Gieseke, S.; Roehr, C.A.; Siodmok, A. [Karlsruher Institut fuer Technologie, Karlsruhe (DE). Inst. fuer Theoretische Physik] (and others)

    2011-02-15

    A new release of the Monte Carlo program Herwig++ (version 2.5) is now available. This version comes with a number of improvements including: new next-to-leading order matrix elements, including weak boson pair production; a colour reconnection model; diffractive processes; additional models of physics beyond the Standard Model; new leading-order matrix elements for hadron-hadron and lepton-lepton collisions as well as photon-initiated processes. (orig.)

  11. Herwig++ 2.2 Release Note

    CERN Document Server

    Bahr, M; Gigg, M; Grellscheid, D; Hamilton, K; Latunde-Dada, O; Platzer, S; Richardson, P; Seymour, M H; Sherstnev, AUniversity of Cambridge; Webber, Bryan R

    2008-01-01

    A new release of the Monte Carlo program Herwig++ (version 2.2) is now available. This version includes a number of improvements including: matrix elements for the production of an electroweak gauge boson, W and Z, in association with a jet; several new processes for Higgs production in association with an electroweak gauge boson; and the matrix element correction for QCD radiation in Higgs production via gluon fusion.

  12. Git version control cookbook

    CERN Document Server

    Olsson, Aske

    2014-01-01

    This practical guide contains a wide variety of recipes, taking you through all the topics you need to know about to fully utilize the most advanced features of the Git system. If you are a software developer or a build and release engineer who uses Git in your daily work and want to take your Git knowledge to the next level, then this book is for you. To understand and follow the recipes included in this book, basic knowledge of Git command-line code is mandatory.

  13. A Review of Release Fiscal Budget and Final Account Information to the Public%财政预决算信息公开问题研究综述

    Institute of Scientific and Technical Information of China (English)

    周慧; 邓可可

    2015-01-01

    本文从预决算信息公开的概念、重要性、评估、建议四个方面,对预决算信息公开问题进行综述。预决算信息公开在保障公众知情权,加强监督、防治腐败,加快政府转型、促进“服务型”、“责任型”政府建设,推动政治体制改革、提高政府治理能力,实现“中国梦”方面具有重要意义。预决算信息公开的评估主要是根据具体原则要求,设立相对应的评价指标体系进行评估。建立预算公开的顶层制度设计、完善预算公开的相关法律法规、提高预算信息公开的质量和获取的便利性、引入公民参与机制等措施能够提升预决算信息公开的程度。通过综述,得出,即重视和分析预算、决算两方面信息的重要性,并对其进行对比绩效分析来促进财政信息公开。%This article reviews release fiscal budgets and final accounts information to the public from four aspects, Which are concepts , importance, estimates and suggestions. Release fiscal budgets and final accounts information to the public do good to protect the right of the public, strengthen supervision and prevent corruption, accelerate the transformation of the gov-ernment to promote the“service and responsible”state-building, promote political reform and improve the capacity of adminis-trative governance , realize“China Dream”. Budget and final accounts information disclosure evaluation is mainly based on the requirements of specific principles set up corresponding evaluation index system for evaluation. Establish the top-level system design of budget openness, perfect relevant laws and regulations, improve the quality and the convenience of budget informa-tion's openness, and introduction the mechanisms of citizen participation, all these can enhance the degree of releasing fiscal budgets and final accounts information to the public. By review, we can obtain the paper's innovations, that is paying

  14. Nuclear Criticality Safety Handbook, Version 2. English translation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-08-01

    The Nuclear Criticality Safety Handbook, Version 2 essentially includes the description of the Supplement Report to the Nuclear Criticality Safety Handbook, released in 1995, into the first version of the Nuclear Criticality Safety Handbook, published in 1988. The following two points are new: (1) exemplifying safety margins related to modeled dissolution and extraction processes, (2) describing evaluation methods and alarm system for criticality accidents. Revision has been made based on previous studies for the chapter that treats modeling the fuel system: e.g., the fuel grain size that the system can be regarded as homogeneous, non-uniformity effect of fuel solution, an burnup credit. This revision has solved the inconsistencies found in the first version between the evaluation of errors found in JACS code system and the criticality condition data that were calculated based on the evaluation. This report is an English translation of the Nuclear Criticality Safety Handbook, Version 2, originally published in Japanese as JAERI 1340 in 1999. (author)

  15. Publication of the Bulletin

    CERN Multimedia

    The final edition (Nos 51-52/2009 and 1-2/2010) of the last Weekly Bulletin of the year will be published on Friday 11 December and will cover events at CERN from 14 December 2009 to 8 January 2010. Announcements for publication in this issue should reach the Publication Section (Communications group) or the Staff Association, as appropriate, by noon on Tuesday 8 December. Bulletin publication 2010 The table below lists the 2010 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Bulletin Web version Bulletin Paper version 2-3 Tuesday 5 January Friday 8 and 15 January Wednesday 13 J...

  16. NODC Standard Product: World Ocean Database 1998 version 2 (5 disc set) (NODC Accession 0098461)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Since the first release of WOD98, the staff of the Ocean Climate Laboratory have performed additional quality control on the database. Version 2.0 also includes...

  17. Cryptanalysis of Achterbahn-Version 1 and -Version 2

    Institute of Scientific and Technical Information of China (English)

    Xiao-Li Huang; Chuan-Kun Wu

    2007-01-01

    Achterbahn is one of the candidate stream ciphers submitted to the eSTREAM, which is the ECRYPT StreamCipher Project. The cipher Achterbahn uses a new structure which is based on several nonlinear feedback shift registers(NLFSR) and a nonlinear combining output Boolean function. This paper proposes distinguishing attacks on Achterbahn-Version 1 and -Version 2 on the reduced mode and the full mode. These distinguishing attacks are based on linear approxi-mations of the output functions. On the basis of these linear approximations and the periods of the registers, parity checkswith noticeable biases are found. Then distinguishing attacks can be achieved through these biased parity checks. As toAchterbahn-Version 1, three cases that the output function has three possibilities are analyzed. Achterbahn-Version 2, themodification version of Achterbahn-Version 1, is designed to avert attacks based on approximations of the output Booleanfunction. Our attack with even much lower complexities on Achterbahn-Version 2 shows that Achterbahn-Version 2 cannotprevent attacks based on linear approximations.

  18. Versions Of Care Technology

    Directory of Open Access Journals (Sweden)

    Sampsa Hyysalo

    2007-01-01

    Full Text Available The importance of users for innovation has been increasingly emphasized in the literatures on design and management of technology. However, less attention has been given to how people shape technology-in-use. This paper first provides a review of literature on technology use in the social and cultural studies of technology. It then moves to examine empirically how a novel alarm and monitoring appliance was appropriated in the work of home-care nurses and in the everyday living of elderly people. Analysis shows that even these technically unsavvy users shaped the technology considerably by various, even if mundane, acts of adapting it materially, as well as by attributing different meanings to it. However, the paper goes on to argue that such commonplace phrasing of the findings obscures their significance and interrelations. Consequently, the final section of the paper reframes the key findings of this study using the concepts of practice, enactment, and versions of technology to reach a more adequate description.

  19. IMG 4 version of the integrated microbial genomes comparative analysis system

    Energy Technology Data Exchange (ETDEWEB)

    Markowitz, Victor M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Chen, I-Min A. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Palaniappan, Krishna [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Chu, Ken [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Szeto, Ernest [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Pillay, Manoj [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Ratner, Anna [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Huang, Jinghua [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Data Management and Technology Center. Computational Research Division; Woyke, Tanja [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Huntemann, Marcel [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Anderson, Iain [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Billis, Konstantinos [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Varghese, Neha [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Mavromatis, Konstantinos [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Pati, Amrita [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Ivanova, Natalia N. [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program; Kyrpides, Nikos C. [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States). Microbial Genome and Metagenome Program

    2013-10-27

    The Integrated Microbial Genomes (IMG) data warehouse integrates genomes from all three domains of life, as well as plasmids, viruses and genome fragments. IMG provides tools for analyzing and reviewing the structural and functional annotations of genomes in a comparative context. IMG’s data content and analytical capabilities have increased continuously since its first version released in 2005. Since the last report published in the 2012 NAR Database Issue, IMG’s annotation and data integration pipelines have evolved while new tools have been added for recording and analyzing single cell genomes, RNA Seq and biosynthetic cluster data. Finally, different IMG datamarts provide support for the analysis of publicly available genomes (IMG/W: http://img.jgi.doe.gov/w), expert review of genome annotations (IMG/ER: http://img.jgi.doe.gov/er) and teaching and training in the area of microbial genome analysis (IMG/EDU: http://img.jgi.doe.gov/edu).

  20. IMG 4 version of the integrated microbial genomes comparative analysis system.

    Science.gov (United States)

    Markowitz, Victor M; Chen, I-Min A; Palaniappan, Krishna; Chu, Ken; Szeto, Ernest; Pillay, Manoj; Ratner, Anna; Huang, Jinghua; Woyke, Tanja; Huntemann, Marcel; Anderson, Iain; Billis, Konstantinos; Varghese, Neha; Mavromatis, Konstantinos; Pati, Amrita; Ivanova, Natalia N; Kyrpides, Nikos C

    2014-01-01

    The Integrated Microbial Genomes (IMG) data warehouse integrates genomes from all three domains of life, as well as plasmids, viruses and genome fragments. IMG provides tools for analyzing and reviewing the structural and functional annotations of genomes in a comparative context. IMG's data content and analytical capabilities have increased continuously since its first version released in 2005. Since the last report published in the 2012 NAR Database Issue, IMG's annotation and data integration pipelines have evolved while new tools have been added for recording and analyzing single cell genomes, RNA Seq and biosynthetic cluster data. Different IMG datamarts provide support for the analysis of publicly available genomes (IMG/W: http://img.jgi.doe.gov/w), expert review of genome annotations (IMG/ER: http://img.jgi.doe.gov/er) and teaching and training in the area of microbial genome analysis (IMG/EDU: http://img.jgi.doe.gov/edu).

  1. IMG/M 4 version of the integrated metagenome comparative analysis system.

    Science.gov (United States)

    Markowitz, Victor M; Chen, I-Min A; Chu, Ken; Szeto, Ernest; Palaniappan, Krishna; Pillay, Manoj; Ratner, Anna; Huang, Jinghua; Pagani, Ioanna; Tringe, Susannah; Huntemann, Marcel; Billis, Konstantinos; Varghese, Neha; Tennessen, Kristin; Mavromatis, Konstantinos; Pati, Amrita; Ivanova, Natalia N; Kyrpides, Nikos C

    2014-01-01

    IMG/M (http://img.jgi.doe.gov/m) provides support for comparative analysis of microbial community aggregate genomes (metagenomes) in the context of a comprehensive set of reference genomes from all three domains of life, as well as plasmids, viruses and genome fragments. IMG/M's data content and analytical tools have expanded continuously since its first version was released in 2007. Since the last report published in the 2012 NAR Database Issue, IMG/M's database architecture, annotation and data integration pipelines and analysis tools have been extended to copewith the rapid growth in the number and size of metagenome data sets handled by the system. IMG/M data marts provide support for the analysis of publicly available genomes, expert review of metagenome annotations (IMG/M ER: http://img.jgi.doe.gov/mer) and Human Microbiome Project (HMP)-specific metagenome samples (IMG/M HMP: http://img.jgi.doe.gov/imgm_hmp).

  2. AF-GEOSPACE Version 2.1

    Science.gov (United States)

    Hilmer, R. V.; Ginet, G. P.; Hall, T.; Holeman, E.; Madden, D.; Tautz, M.; Roth, C.

    2004-05-01

    AF-GEOSpace is a graphics-intensive software program with space environment models and applications developed and distributed by the Space Weather Center of Excellence at AFRL. A review of current (Version 2.0) and planned (Version 2.1) AF-GEOSpace capabilities will be given. A wide range of physical domains is represented enabling the software to address such things as solar disturbance propagation, radiation belt configuration, and ionospheric auroral particle precipitation and scintillation. The software is currently being used to aid with the design, operation, and simulation of a wide variety of communications, navigation, and surveillance systems. Building on the success of previous releases, AF-GEOSpace has become a platform for the rapid prototyping of automated operational and simulation space weather visualization products and helps with a variety of tasks, including: orbit specification for radiation hazard avoidance; satellite design assessment and post-event anomaly analysis; solar disturbance effects forecasting; frequency and antenna management for radar and HF communications; determination of link outage regions for active ionospheric conditions; scientific model validation and comparison, physics research, and education. Version 2.0 provided a simplified graphical user interface, improved science and application modules, and significantly enhanced graphical performance. Common input data archive sets, application modules, and 1-D, 2-D, and 3-D visualization tools are provided to all models. Dynamic capabilities permit multiple environments to be generated at user-specified time intervals while animation tools enable displays such as satellite orbits and environment data together as a function of time. Building on the existing Version 2.0 software architecture, AF-GEOSpace Version 2.1 is currently under development and will include a host of new modules to provide, for example, geosynchronous charged particle fluxes, neutral atmosphere densities

  3. The new version 2.12 of BKG Ntrip Client (BNC)

    Science.gov (United States)

    Stürze, Andrea; Mervart, Leos; Weber, Georg; Rülke, Axel; Wiesensarter, Erwin; Neumaier, Peter

    2016-04-01

    A new version of the BKG Ntrip Client (BNC) has been released. Originally developed in cooperation of the Federal Agency for Cartography and Geodesy (BKG) and the Czech Technical University (CTU) with a focus on multi-stream real-time access to GPS observations, the software has once again been substantially extended. Promoting Open Standards as recommended by the Radio Technical Commission for Maritime Services (RTCM) remains the prime subject. Beside its Graphical User Interface (GUI), the real-time software for Windows, Linux, Mac, and Linux platforms now comes with complete Command Line Interface (CLI) and considerable post processing functionality. RINEX Version 3 file editing & Quality Check (QC) with full support of Galileo, BeiDou, and SBAS - besides GPS and GLONASS - is part of the new features. Comparison of satellite orbit/clock files in SP3 format is another fresh ability of BNC. Simultaneous multi-station Precise Point Positioning (PPP) for real-time displacement-monitoring of entire reference station networks is one more recent addition to BNC. Implemented RTCM messages for PPP (under development) comprise satellite orbit and clock corrections, code and phase observation biases, and the Vertical Total Electron Content (VTEC) of the ionosphere. The well established, mature codebase is mostly written in C++ language. Its publication under GNU GPL is thought to be well-suited for test, validation and demonstration of new approaches in precise real-time satellite navigation when IP streaming is involved. The poster highlights BNC features which are new in version 2.12 and beneficial to IAG institutions and services such as IGS/RT-IGS and to the interested public in general.

  4. GNU Octave Manual Version 3

    DEFF Research Database (Denmark)

    W. Eaton, John; Bateman, David; Hauberg, Søren

    This manual is the definitive guide to GNU Octave, an interactive environment for numerical computation. The manual covers the new version 3 of GNU Octave.......This manual is the definitive guide to GNU Octave, an interactive environment for numerical computation. The manual covers the new version 3 of GNU Octave....

  5. CLIPS - C LANGUAGE INTEGRATED PRODUCTION SYSTEM (IBM PC VERSION)

    Science.gov (United States)

    Riley, G.

    1994-01-01

    version each contain a windowing variant of CLIPS as well as the standard line oriented version. The mouse/window interface version for the PC works with a Microsoft compatible mouse or without a mouse. This window version uses the proprietary CURSES library for the PC, but a working executable of the window version is provided. The window oriented version for the Macintosh includes a version which uses a full Macintosh-style interface, including an integrated editor. This version allows the user to observe the changing fact base and rule activations in separate windows while a CLIPS program is executing. The IBM PC version is available bundled with CLIPSITS, The CLIPS Intelligent Tutoring System for a special combined price (COS-10025). The goal of CLIPSITS is to provide the student with a tool to practice the syntax and concepts covered in the CLIPS User's Guide. It attempts to provide expert diagnosis and advice during problem solving which is typically not available without an instructor. CLIPSITS is divided into 10 lessons which mirror the first 10 chapters of the CLIPS User's Guide. The program was developed for the IBM PC series with a hard disk. CLIPSITS is also available separately as MSC-21679. The CLIPS program is written in C for interactive execution and has been implemented on an IBM PC computer operating under DOS, a Macintosh and DEC VAX series computers operating under VMS or ULTRIX. The line oriented version should run on any computer system which supports a full (Kernighan and Ritchie) C compiler or the ANSI standard C language. CLIPS was developed in 1986 and Version 4.2 was released in July of 1988. Version 4.3 was released in June of 1989.

  6. CLIPS - C LANGUAGE INTEGRATED PRODUCTION SYSTEM (MACINTOSH VERSION)

    Science.gov (United States)

    Culbert, C.

    1994-01-01

    version each contain a windowing variant of CLIPS as well as the standard line oriented version. The mouse/window interface version for the PC works with a Microsoft compatible mouse or without a mouse. This window version uses the proprietary CURSES library for the PC, but a working executable of the window version is provided. The window oriented version for the Macintosh includes a version which uses a full Macintosh-style interface, including an integrated editor. This version allows the user to observe the changing fact base and rule activations in separate windows while a CLIPS program is executing. The IBM PC version is available bundled with CLIPSITS, The CLIPS Intelligent Tutoring System for a special combined price (COS-10025). The goal of CLIPSITS is to provide the student with a tool to practice the syntax and concepts covered in the CLIPS User's Guide. It attempts to provide expert diagnosis and advice during problem solving which is typically not available without an instructor. CLIPSITS is divided into 10 lessons which mirror the first 10 chapters of the CLIPS User's Guide. The program was developed for the IBM PC series with a hard disk. CLIPSITS is also available separately as MSC-21679. The CLIPS program is written in C for interactive execution and has been implemented on an IBM PC computer operating under DOS, a Macintosh and DEC VAX series computers operating under VMS or ULTRIX. The line oriented version should run on any computer system which supports a full (Kernighan and Ritchie) C compiler or the ANSI standard C language. CLIPS was developed in 1986 and Version 4.2 was released in July of 1988. Version 4.3 was released in June of 1989.

  7. Training Materials for Release 3

    DEFF Research Database (Denmark)

    Wake, Jo Dugstad; Hansen, Cecilie; Debus, Kolja;

    This document, D7.4 – training materials for release 3, provides an overview of the training material for version 3 of the NEXT-TELL tools and methods. Previous documents submitted as part of work package 7, which is about teacher training, are D7.1 – Training Concept, D7.2 – Training Materials...... for Release 1 and D7.3 – Training Materials for Release 2. D7.4 builds on D7.1 and D7.2 and D7.3. D7.4 contains further development of previous work within WP7, essentially a revised theoretical approach to the teacher training, and expansion of the notion of tool training. The media in use have been expanded...

  8. Contact: Releasing the news

    Science.gov (United States)

    Pinotti, Roberto

    The problem of mass behavior after man's future contacts with other intelligences in the universe is not only a challenge for social scientists and political leaders all over the world, but also a cultural time bomb as well. In fact, since the impact of CETI (Contact with Extraterrestrial Intelligence) on human civilization, with its different cultures, might cause a serious socio-anthropological shock, a common and predetermined worldwide strategy is necessary in releasing the news after the contact, in order to keep possible manifestations of fear, panic and hysteria under control. An analysis of past studies in this field and of parallel historical situations as analogs suggests a definite "authority crisis" in the public as a direct consequence of an unexpected release of the news, involving a devastating "chain reaction" process (from both the psychological and sociological viewpoints) of anomie and maybe the collapse of today's society. The only way to prevent all this is to prepare the world's public opinion concerning contact before releasing the news, and to develop a long-term strategy through the combined efforts of scientists, political leaders, intelligence agencies and the mass media, in order to create the cultural conditions in which a confrontation with ETI won't affect mankind in a traumatic way. Definite roles and tasks in this multi-level model are suggested.

  9. The IACOB spectroscopic database: recent updates and first data release

    CERN Document Server

    Simón-Díaz, S; Apellániz, J Maíz; Castro, N; Herrero, A; Garcia, M; Pérez-Prieto, J A; Caon, N; Alacid, J M; Camacho, I; Dorda, R; Godart, M; González-Fernández, C; Holgado, G; Rübke, K

    2015-01-01

    The IACOB project is an ambitious long-term project which is contributing to step forward in our knowledge about the physical properties and evolution of Galactic massive stars. The project aims at building a large database of high-resolution, multi-epoch, spectra of Galactic OB stars, and the scientific exploitation of the database using state-of-the-art models and techniques. In this proceeding, we summarize the latest updates of the IACOB spectroscopic database and highlight some of the first scientific results from the IACOB project; we also announce the first data release and the first public version of the iacob-broad tool for the line-broadening characterization of OB-type spectra.

  10. Publication of the bulletin

    CERN Multimedia

    DG Unit

    2010-01-01

    The final edition (Nos 50-51-52/2010 and 1-2/2011) of the last Weekly Bulletin of the year will be published on Friday 10 December and will cover events at CERN from 13 December 2010 to 14 January 2011. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate by noon, on Tuesday 7 December. The table below lists the 2011 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Bulletin Web version Bulletin Printed version 3-4   Tuesday 11 January Fridays 14 and 21 January Wednes...

  11. Comparing Danish and Swedish versions of PISA scientific literacy

    DEFF Research Database (Denmark)

    Serder, Malmø University, Margareta; Sørensen, Helene

    This paper presents a comparison between the Swedish, Danish, English, and French versions of three scientific literacy test-units from the released PISA items 2006. More specifically it compares how different words and concepts have been translated in the Swedish and Danish tests, compared...... with these three PISA units. In the paper we claim that in spite of detailed and strongly controlled methods for achieving translations of high standard used by the PISA, important and perhaps even decisive, differences between the four versions exist....

  12. Comparing Danish and Swedish versions of PISA scientific literacy

    DEFF Research Database (Denmark)

    Serder, Malmø University, Margareta; Sørensen, Helene

    This paper presents a comparison between the Swedish, Danish, English, and French versions of three scientific literacy test-units from the released PISA items 2006. More specifically it compares how different words and concepts have been translated in the Swedish and Danish tests, compared...... to the English and French original versions. Differences that occur as a result of the translation process concerning words’ meaning are demonstrated. The possible consequences of such differences are exemplified by an excerpt from a situation in which Swedish 15-year-old students collaboratively worked...

  13. Simple Techniques For Assessing Impacts Of Oil And Gas Operations On Public Lands: A Field Evaluation Of A Photoionization Detector (PID) At A Condensate Release Site, Padre Island National Seashore, Texas

    Science.gov (United States)

    Otton, James K.; Zielinski, Robert A.

    2001-01-01

    Simple, cost-effective techniques are needed for land managers to assess the environmental impacts of oil and gas production activities on public lands, so that sites may be prioritized for remediation or for further, more formal assessment. Field-portable instruments provide real-time data and allow the field investigator to extend an assessment beyond simply locating and mapping obvious disturbances. Field investigators can examine sites for the presence of hydrocarbons in the subsurface using a soil auger and a photoionization detector (PID). The PID measures volatile organic compounds (VOC) in soil gases. This allows detection of hydrocarbons in the shallow subsurface near areas of obvious oil-stained soils, oil in pits, or dead vegetation. Remnants of a condensate release occur in sandy soils at a production site on the Padre Island National Seashore in south Texas. Dead vegetation had been observed by National Park Service personnel in the release area several years prior to our visit. The site is located several miles south of the Malaquite Beach Campground. In early 2001, we sampled soil gases for VOCs in the area believed to have received the condensate. Our purpose in this investigation was: 1) to establish what sampling techniques might be effective in sandy soils with a shallow water and contrast them with techniques used in an earlier study; and 2) delineate the probable area of condensate release. Our field results show that sealing the auger hole with a clear, rigid plastic tube capped at the top end and sampling the soil gas through a small hole in the cap increases the soil VOC gas signature, compared to sampling soil gases in the bottom of an open hole. This sealed-tube sampling method increases the contrast between the VOC levels within a contaminated area and adjacent background areas. The tube allows the PID air pump to draw soil gas from the volume of soil surrounding the open hole below the tube in a zone less influenced by atmospheric air

  14. Enigma Version 12

    Science.gov (United States)

    Shores, David; Goza, Sharon P.; McKeegan, Cheyenne; Easley, Rick; Way, Janet; Everett, Shonn; Guerra, Mark; Kraesig, Ray; Leu, William

    2013-01-01

    Enigma Version 12 software combines model building, animation, and engineering visualization into one concise software package. Enigma employs a versatile user interface to allow average users access to even the most complex pieces of the application. Using Enigma eliminates the need to buy and learn several software packages to create an engineering visualization. Models can be created and/or modified within Enigma down to the polygon level. Textures and materials can be applied for additional realism. Within Enigma, these models can be combined to create systems of models that have a hierarchical relationship to one another, such as a robotic arm. Then these systems can be animated within the program or controlled by an external application programming interface (API). In addition, Enigma provides the ability to use plug-ins. Plugins allow the user to create custom code for a specific application and access the Enigma model and system data, but still use the Enigma drawing functionality. CAD files can be imported into Enigma and combined to create systems of computer graphics models that can be manipulated with constraints. An API is available so that an engineer can write a simulation and drive the computer graphics models with no knowledge of computer graphics. An animation editor allows an engineer to set up sequences of animations generated by simulations or by conceptual trajectories in order to record these to highquality media for presentation. Enigma Version 12 Lyndon B. Johnson Space Center, Houston, Texas 28 NASA Tech Briefs, September 2013 Planetary Protection Bioburden Analysis Program NASA's Jet Propulsion Laboratory, Pasadena, California This program is a Microsoft Access program that performed statistical analysis of the colony counts from assays performed on the Mars Science Laboratory (MSL) spacecraft to determine the bioburden density, 3-sigma biodensity, and the total bioburdens required for the MSL prelaunch reports. It also contains numerous

  15. Publication of the bulletin

    CERN Multimedia

    DSU Department

    2007-01-01

    The table below lists the 2008 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin publication 2008 Bulletin N° 4-5 Publication: Monday 21 january Submission deadline for announcements: Tuesday 15 January Bulletin N° 6-7 Publication: Monday 4 february Submission deadline for announcements: Tuesday 29 January Bulletin N° 8-9 Publication: Monday 18 february Submission deadline for announcements: Tuesday 12 February Bulletin N° 10-11 Publication: Monday 3 march Submission deadline for announcements: Tuesday 26 February Bulletin N° 12-13 Publication: Monday 17 march Submission deadline for announcements: Tuesday 11 March Bulletin N° 14-15 Publication: Monday 31 march Submission deadline for announcements: Tuesday 25 March Bulletin N° 16-17 Publication: Monday 14 april Submission deadline for...

  16. Renin release

    DEFF Research Database (Denmark)

    Schweda, Frank; Friis, Ulla; Wagner, Charlotte;

    2007-01-01

    The aspartyl-protease renin is the key regulator of the renin-angiotensin-aldosterone system, which is critically involved in salt, volume, and blood pressure homeostasis of the body. Renin is mainly produced and released into circulation by the so-called juxtaglomerular epithelioid cells, located......, salt, and volume overload. In contrast, the events controlling the function of renin-secreting cells at the organ and cellular level are markedly less clear and remain mysterious in certain aspects. The unravelling of these mysteries has led to new and interesting insights into the process of renin...

  17. The Second Data Release of the Sloan Digital Sky Survey

    CERN Document Server

    Abazajian, Kevork; ̈ueros, Marcel A. Ag; Allam, Sahar S.; Anderson, KurtS. J.; Anderson, Scott F.; Annis, James; Bahcall, Neta A.; Baldry, Ivan K.; StevenBastian; Berlind, Andreas; Bernardi, Mariangela; Blanton, Michael R.; BochanskiJr., John J.; Boroski, William N.; Briggs, John W.; Brinkmann, J.; Brunner, Robert J.; ́ari, Tam ́asBudav; Carey, Larry N.; Carliles, Samuel; Castander, Francisco J.; Connolly, A. J.; Csabai, Istvan; Doi, Mamoru; Dong, Feng; Eisenstein, Daniel J.; Evans, Michael L.; Fan, Xiaohui; Finkbeiner, Douglas P.; Friedman, Scott D.; Frieman, Joshua A.; Fukugita, Masataka; Gal, RoyR.; Gillespie, Bruce; Glazebrook, Karl; Gray, Jim; Grebel, Eva K.; Gunn, James E.; Gurbani, Vijay K.; Hall, Patrick B.; Hamabe, Masaru; Harris, Frederick H.; C.Harris, Hugh; Harvanek, Michael; Heckman, Timothy M.; Hendry, John S.; Hennessy, Gregory S.; Hindsley, Robert B.; Hogan, Craig J.; Hogg, David W.; Holmgren, Donald J.; Ichikawa, Shin-ichi; Ichikawa, Takashi; Ivezic, Zeljko; Jester, Sebastian; Johnston, David E.; Jorgensen, AndersM.; Kent, Stephen M.; Kleinman, S. J.; Knapp, G. R.; Kniazev, Alexei Yu.; Kron, Richard G.; Krzesinski, Jurek; Kunszt, Peter Z.; Kuropatkin, Nickolai; Q.Lamb, Donald; Lampeitl, Hubert; Lee, Brian C.; Leger, R. French; Li, Nolan; Lin, Huan; Loh, Yeong-Shang; Long, Daniel C.; Loveday, Jon; Lupton, Robert H.; Malik, Tanu; BruceMargon; Matsubara, Takahiko; McGehee, Peregrine M.; McKay, Timothy A.; AveryMeiksin; Munn, Jeffrey A.; Nakajima, Reiko; Nash, Thomas; Neilsen, Eric H. Jr.; JoNewberg, Heidi; Newman, Peter R.; Nichol, Robert C.; Nicinski, Tom; Nieto-Santisteban, Maria; Nitta, Atsuko; Okamura, Sadanori; O'Mullane, William; Ostriker, Jeremiah P.; Owen, Russell; Padmanabhan, Nikhil; Peoples, John; Pier, Jeffrey R.; Pope, Adrian C.; Quinn, Thomas R.; Richards, Gordon T.; Richmond, Michael W.; Rix, Hans-Walter; Rockosi, Constance M.; Schlegel, David J.; Schneider, Donald P.; Scranton, Ryan; Sekiguchi, Maki; Seljak, Uros; Sergey, Gary; Sesar, Branimir; Sheldon, Erin; Shimasaku, Kazu; Siegmund, Walter A.; Silvestri, Nicole M.; Smith, J. Allyn; ́c, Vernesa Smolči; Snedden, Stephanie A.; AlbertStebbins; Stoughton, Chris; Strauss, Michael A.; SubbaRao, Mark; Szalay, Alexander S.; Szapudi, Istv ́an; Szkody, Paula; Szokoly, Gyula P.; Tegmark, Max; Teodoro, Luis; Thakar, AniruddhaR.; Tremonti, Christy; Tucker, Douglas L.; Uomoto, Alan; Vanden Berk, Daniel E.; Vandenberg, Jan; Vogeley, Michael S.; Voges, Wolfgang; Vogt, Nicole P.; M.Walkowicz, Lucianne; Wang, Shu-i; Weinberg, David H.; West, Andrew A.; White, Simon D.M.; Wilhite, BrianC.; Xu, Yongzhong; Yanny, Brian; Yasuda, Naoki; Yip, Ching-Wa; Yocum, D. R.; York, Donald G.; Zehavi, Idit; Zibetti, Stefano; Zucker, Daniel B.

    2004-01-01

    The Sloan Digital Sky Survey has validated and made publicly available its Second Data Release. This data release consists of 3324 square degrees of five-band (u g r i z) imaging data with photometry for over 88 million unique objects, 367,360 spectra of galaxies, quasars, stars and calibrating blank sky patches selected over 2627 degrees of this area, and tables of measured parameters from these data. The imaging data reach a depth of r ~ 22.2 (95% completeness limit for point sources) and are photometrically and astrometrically calibrated to 2% rms and 100 milli-arcsec rms per coordinate, respectively. The imaging data have all been processed through a new version of the SDSS imaging pipeline, in which the most important improvement since the last data release is fixing an error in the model fits to each object. The result is that model magnitudes are now a good proxy for point spread function (PSF) magnitudes for point sources, and Petrosian magnitudes for extended sources. The spectroscopy extends from 38...

  18. VVV DR1: The First Data Release of the Milky Way Bulge and Southern Plane from the Near-Infrared ESO Public Survey VISTA Variables in the Via Lactea

    CERN Document Server

    Saito, R K; Minniti, D; Lucas, P W; Rejkuba, M; Toledo, I; Gonzalez, O A; Alonso-Garcia, J; Irwin, M J; Gonzalez-Solares, E; Hodgkin, S T; Lewis, J R; Cross, N; Ivanov, V D; Kerins, E; Emerson, J P; Soto, M; Amores, E B; Gurovich, S; Dekany, I; Angeloni, R; Beamin, J C; Catelan, M; Padilla, N; Zoccali, M; Pietrukowicz, P; Bidin, C Moni; Mauro, F; Geisler, D; Folkes, S L; Sale, S E; Borissova, J; Kurtev, R; Ahumada, A V; Alonso, M V; Adamson, A; Arias, J I; Bandyopadhyay, R M; Barba, R H; Barbuy, B; Baume, G L; Bedin, L R; Bellini, A; Benjamin, R; Bica, E; Bonatto, C; Bronfman, L; Carraro, G; Chene, A N; Claria, J J; Clarke, J R A; Contreras, C; Corvillon, A; de Grijs, R; Dias, B; Drew, J E; Farina, C; Feinstein, C; Fernandez-Lajus, E; Gamen, R C; Gieren, W; Goldman, B; Gonzalez-Fernandez, C; Grand, R J J; Gunthardt, G; Hambly, N C; Hanson, M M; Helminiak, K G; Hoare, M G; Huckvale, L; Jordan, A; Kinemuchi, K; Longmore, A; Lopez-Corredoira, M; Maccarone, T; Majaess, D; Martin, E L; Masetti, N; Mennickent, R E; Mirabel, I F; Monaco, L; Morelli, L; Motta, V; Palma, T; Parisi, M C; Parker, Q; Penaloza, F; Pietrzynski, G; Pignata, G; Popescu, B; Read, M A; Rojas, A; Roman-Lopes, A; Ruiz, M T; Saviane, I; Schreiber, M R; Schroder, A C; Sharma, S; Smith, M D; Sodre, L; Stead, J; Stephens, A W; Tamura, M; Tappert, C; Thompson, M A; Valenti, E; Vanzi, L; Walton, N A; Weidmann, W; Zijlstra, A

    2011-01-01

    The ESO Public Survey VISTA Variables in the Via Lactea (VVV) started in 2010. VVV targets 562 sq. deg in the Galactic bulge and an adjacent plane region and is expected to run for ~5 years. In this paper we describe the progress of the survey observations in the first observing season, the observing strategy and quality of the data obtained. The observations are carried out on the 4-m VISTA telescope in the ZYJHKs filters. In addition to the multi-band imaging the variability monitoring campaign in the Ks filter has started. Data reduction is carried out using the pipeline at the Cambridge Astronomical Survey Unit. The photometric and astrometric calibration is performed via the numerous 2MASS sources observed in each pointing. The first data release contains the aperture photometry and astrometric catalogues for 348 individual pointings in the ZYJHKs filters taken in the 2010 observing season. The typical image quality is ~0.9-1.0". The stringent photometric and image quality requirements of the survey are ...

  19. Systematic comparisons between PRISM version 1.0.0, BAP, and CSMIP ground-motion processing

    Science.gov (United States)

    Kalkan, Erol; Stephens, Christopher

    2017-02-23

    A series of benchmark tests was run by comparing results of the Processing and Review Interface for Strong Motion data (PRISM) software version 1.0.0 to Basic Strong-Motion Accelerogram Processing Software (BAP; Converse and Brady, 1992), and to California Strong Motion Instrumentation Program (CSMIP) processing (Shakal and others, 2003, 2004). These tests were performed by using the MatLAB implementation of PRISM, which is equivalent to its public release version in Java language. Systematic comparisons were made in time and frequency domains of records processed in PRISM and BAP, and in CSMIP, by using a set of representative input motions with varying resolutions, frequency content, and amplitudes. Although the details of strong-motion records vary among the processing procedures, there are only minor differences among the waveforms for each component and within the frequency passband common to these procedures. A comprehensive statistical evaluation considering more than 1,800 ground-motion components demonstrates that differences in peak amplitudes of acceleration, velocity, and displacement time series obtained from PRISM and CSMIP processing are equal to or less than 4 percent for 99 percent of the data, and equal to or less than 2 percent for 96 percent of the data. Other statistical measures, including the Euclidian distance (L2 norm) and the windowed root mean square level of processed time series, also indicate that both processing schemes produce statistically similar products.

  20. TOUGHREACT Version 2.0: A simulator for subsurface reactive transport under non-isothermal multiphase flow conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu, T.; Spycher, N.; Sonnenthal, E.; Zhang, G.; Zheng, L.; Pruess, K.

    2010-08-01

    TOUGHREACT is a numerical simulation program for chemically reactive non-isothermal flows of multiphase fluids in porous and fractured media, and was developed by introducing reactive chemistry into the multiphase fluid and heat flow simulator TOUGH2 V2. The first version of TOUGHREACT was released to the public through the U.S. Department of Energy's Energy Science and Technology Software Center (ESTSC) in August 2004. It is among the most frequently requested of ESTSC's codes. The code has been widely used for studies in CO{sub 2} geological sequestration, nuclear waste isolation, geothermal energy development, environmental remediation, and increasingly for petroleum applications. Over the past several years, many new capabilities have been developed, which were incorporated into Version 2 of TOUGHREACT. Major additions and improvements in Version 2 are discussed here, and two application examples are presented: (1) long-term fate of injected CO{sub 2} in a storage reservoir and (2) biogeochemical cycling of metals in mining-impacted lake sediments.

  1. An Open Platform for Processing IFC Model Versions

    Institute of Scientific and Technical Information of China (English)

    Mohamed Nour; Karl Beucke

    2008-01-01

    The IFC initiative from the International Alliance of Interoperability has been developing since the mid-nineties through several versions.This paper addresses the problem of binding the growing number of IFC versions and their EXPRESS definitions to programming environments (Java and.NET).The solution developed in this paper automates the process of generating early binding classes,whenever a new version of the IFC model is released.Furthermore, a runtime instantiation of the generated eady binding classes takes place by importing IFC-STEP ISO 10303-P21 models.The user can navigate the IFC STEP model with relevance to the defining EXPRESS-schema,modify,deletem,and create new instances.These func-tionalities are considered to be a basis for any IFC based implementation.It enables researchers to experi-ment the IFC model independently from any software application.

  2. Recommended Parameter Values for GENII Modeling of Radionuclides in Routine Air and Water Releases

    Energy Technology Data Exchange (ETDEWEB)

    Snyder, Sandra F.; Arimescu, Carmen; Napier, Bruce A.; Hay, Tristan R.

    2012-11-01

    The GENII v2 code is used to estimate dose to individuals or populations from the release of radioactive materials into air or water. Numerous parameter values are required for input into this code. User-defined parameters cover the spectrum from chemical data, meteorological data, agricultural data, and behavioral data. This document is a summary of parameter values that reflect conditions in the United States. Reasonable regional and age-dependent data is summarized. Data availability and quality varies. The set of parameters described address scenarios for chronic air emissions or chronic releases to public waterways. Considerations for the special tritium and carbon-14 models are briefly addressed. GENIIv2.10.0 is the current software version that this document supports.

  3. Rock Visualization System. Technical description (RVS version 3.8)

    Energy Technology Data Exchange (ETDEWEB)

    Curtis, P.; Elfstroem, M.; Markstroem, I. [Golder Associates AB (Sweden)

    2007-06-15

    The Rock Visualization System (RVS) has been developed by SKB for use in visualizing geological and engineering data in 3D. The purpose of this report is to provide a technical description of RVS aimed at potential program users and interested parties as well as fulfilling the function of a more general RVS reference that can be cited when writing other technical reports. The report describes RVS version 4.0. Updated versions of this report or addenda will be made available following further development of RVS and the release of subsequent versions of the program. The report covers the following main items: Technical description of the program with illustrations and examples. Limitations of the program and of functionality. For most RVS functions step-by-step tutorials are available describing how a particular function can be used to carry out a specific task. A complete set of updated tutorials is issued with each new version release of the RVS program. However, the tutorials do not cover all the possible uses of all the individual functions but rather give an overall view of their functionality. A detailed description of every RVS function and how it can be used is included in the RVS online Help system.

  4. Rock Visualization System. Technical description (RVS version 3.8)

    Energy Technology Data Exchange (ETDEWEB)

    Curtis, P.; Elfstroem, M.; Markstroem, I. [FB Engineering, Goeteborg (Sweden)

    2005-04-01

    The Rock Visualization System (RVS) has been developed by SKB for use in visualizing geological and engineering data in 3D. The purpose of this report is to provide a technical description of RVS aimed at potential program users and interested parties as well as fulfilling the function of a more general RVS reference that can be cited when writing other technical reports. The report describes RVS version 3.8. Updated versions of this report or addenda will be made available following further development of RVS and the release of subsequent versions of the program. The report covers the following main items: Technical description of the program with illustrations and examples. Limitations of the program and of functionality. For most RVS functions step-by-step tutorials are available describing how a particular function can be used to carryout a specific task. A complete set of updated tutorials is issued with each new version release of the RVS program. However, the tutorials do not cover all the possible uses of all the individual functions but rather give an overall view of their functionality. A detailed description of every RVS function and how it can be used is included in the RVS online Help system.

  5. National Radiobiology Archives Distributed Access User`s Manual, Version 1.1. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Smith, S.K.; Prather, J.C.; Ligotke, E.K.; Watson, C.R.

    1992-06-01

    This supplement to the NRA Distributed Access User`s manual (PNL-7877), November 1991, describes installation and use of Version 1.1 of the software package; this is not a replacement of the previous manual. Version 1.1 of the NRA Distributed Access Package is a maintenance release. It eliminates several bugs, and includes a few new features which are described in this manual. Although the appearance of some menu screens has changed, we are confident that the Version 1.0 User`s Manual will provide an adequate introduction to the system. Users who are unfamiliar with Version 1.0 may wish to experiment with that version before moving on to Version 1.1.

  6. National Radiobiology Archives Distributed Access User's Manual, Version 1. 1

    Energy Technology Data Exchange (ETDEWEB)

    Smith, S.K.; Prather, J.C.; Ligotke, E.K.; Watson, C.R.

    1992-06-01

    This supplement to the NRA Distributed Access User's manual (PNL-7877), November 1991, describes installation and use of Version 1.1 of the software package; this is not a replacement of the previous manual. Version 1.1 of the NRA Distributed Access Package is a maintenance release. It eliminates several bugs, and includes a few new features which are described in this manual. Although the appearance of some menu screens has changed, we are confident that the Version 1.0 User's Manual will provide an adequate introduction to the system. Users who are unfamiliar with Version 1.0 may wish to experiment with that version before moving on to Version 1.1.

  7. Publicity and public relations

    Science.gov (United States)

    Fosha, Charles E.

    1990-01-01

    This paper addresses approaches to using publicity and public relations to meet the goals of the NASA Space Grant College. Methods universities and colleges can use to publicize space activities are presented.

  8. Preliminary Evaluation of the Community Multiscale Air Quality (CMAQ) Model Version 5.1

    Science.gov (United States)

    The AMAD will perform two annual CMAQ model simulations, one with the current publically available version of the CMAQ model (v5.0.2) and the other with the beta version of the new model (v5.1). The results of each model simulation will then be compared to observations and the pe...

  9. Evaluation of the Community Multiscale Air Quality (CMAQ) Model Version 5.1

    Science.gov (United States)

    The AMAD will performed two CMAQ model simulations, one with the current publically available version of the CMAQ model (v5.0.2) and the other with the new version of the CMAQ model (v5.1). The results of each model simulation are compared to observations and the performance of t...

  10. GENII Version 2 Software Design Document

    Energy Technology Data Exchange (ETDEWEB)

    Napier, Bruce A.; Strenge, Dennis L.; Ramsdell, James V.; Eslinger, Paul W.; Fosmire, Christian J.

    2004-03-08

    This document describes the architectural design for the GENII-V2 software package. This document defines details of the overall structure of the software, the major software components, their data file interfaces, and specific mathematical models to be used. The design represents a translation of the requirements into a description of the software structure, software components, interfaces, and necessary data. The design focuses on the major components and data communication links that are key to the implementation of the software within the operating framework. The purpose of the GENII-V2 software package is to provide the capability to perform dose and risk assessments of environmental releases of radionuclides. The software also has the capability of calculating environmental accumulation and radiation doses from surface water, groundwater, and soil (buried waste) media when an input concentration of radionuclide in these media is provided. This report represents a detailed description of the capabilities of the software product with exact specifications of mathematical models that form the basis for the software implementation and testing efforts. This report also presents a detailed description of the overall structure of the software package, details of main components (implemented in the current phase of work), details of data communication files, and content of basic output reports. The GENII system includes the capabilities for calculating radiation doses following chronic and acute releases. Radionuclide transport via air, water, or biological activity may be considered. Air transport options include both puff and plume models, each allow use of an effective stack height or calculation of plume rise from buoyant or momentum effects (or both). Building wake effects can be included in acute atmospheric release scenarios. The code provides risk estimates for health effects to individuals or populations; these can be obtained using the code by applying

  11. JEnsembl: a version-aware Java API to Ensembl data systems

    Science.gov (United States)

    Paterson, Trevor; Law, Andy

    2012-01-01

    Motivation: The Ensembl Project provides release-specific Perl APIs for efficient high-level programmatic access to data stored in various Ensembl database schema. Although Perl scripts are perfectly suited for processing large volumes of text-based data, Perl is not ideal for developing large-scale software applications nor embedding in graphical interfaces. The provision of a novel Java API would facilitate type-safe, modular, object-orientated development of new Bioinformatics tools with which to access, analyse and visualize Ensembl data. Results: The JEnsembl API implementation provides basic data retrieval and manipulation functionality from the Core, Compara and Variation databases for all species in Ensembl and EnsemblGenomes and is a platform for the development of a richer API to Ensembl datasources. The JEnsembl architecture uses a text-based configuration module to provide evolving, versioned mappings from database schema to code objects. A single installation of the JEnsembl API can therefore simultaneously and transparently connect to current and previous database instances (such as those in the public archive) thus facilitating better analysis repeatability and allowing ‘through time’ comparative analyses to be performed. Availability: Project development, released code libraries, Maven repository and documentation are hosted at SourceForge (http://jensembl.sourceforge.net). Contact: jensembl-develop@lists.sf.net, andy.law@roslin.ed.ac.uk, trevor.paterson@roslin.ed.ac.uk PMID:22945789

  12. Data Identifiers, Versioning, and Micro-citation

    Science.gov (United States)

    Parsons, M. A.; Duerr, R. E.

    2012-12-01

    Data citation, especially using Digital Object Identifiers (DOIs), is an increasingly accepted scientific practice. For example, the AGU Council asserts that data "publications" should "be credited and cited like the products of any other scientific activity," and Thomson Reuters has recently announced a data citation index built from DOIs assigned to data sets. Correspondingly, formal guidelines for how to cite a data set (using DOIs or similar identifiers/locators) have recently emerged, notably those from the international DataCite consortium, the UK Digital Curation Centre, and the US Federation of Earth Science Information Partners. These different data citation guidelines are largely congruent. They agree on the basic practice and elements of data citation, especially for relatively static, whole data collections. There is less agreement on some of the more subtle nuances of data citation. They define different methods for handling different data set versions, especially for the very dynamic, growing data sets that are common in Earth Sciences. They also differ in how people should cite specific, arbitrarily large elements, "passages," or subsets of a larger data collection, i.e., the precise data records actually used in a study. This detailed "micro-citation", and careful reference to exact versions of data are essential to ensure scientific reproducibility. Identifiers such as DOIs are necessary but not sufficient for the precise, detailed, references necessary. Careful practice must be coupled with the use of curated identifiers. In this paper we review the pros and cons of different approaches to versioning and micro-citation. We suggest a workable solution for most existing Earth science data and suggest a more rigorous path forward for the future.

  13. Public Relations Guide.

    Science.gov (United States)

    Proctor and Gamble Co., Cincinnati, OH.

    This guide was especially designed for home economists and includes 50 pages of practical ideas and examples on how to set public relations objectives, determine target audiences, work with the media, write releases' and prepare for broadcast interviews. The guide includes definitions of basic terms used in public relations, establishes guidelines…

  14. [Software version and medical device software supervision].

    Science.gov (United States)

    Peng, Liang; Liu, Xiaoyan

    2015-01-01

    The importance of software version in the medical device software supervision does not cause enough attention at present. First of all, the effect of software version in the medical device software supervision is discussed, and then the necessity of software version in the medical device software supervision is analyzed based on the discussion of the misunderstanding of software version. Finally the concrete suggestions on software version naming rules, software version supervision for the software in medical devices, and software version supervision scheme are proposed.

  15. Special population planner, version 4.0.

    Energy Technology Data Exchange (ETDEWEB)

    Kuiper, J.; Tanzman, E.; Metz, W.

    2007-03-26

    man-made disasters that many of the problems posed by emergency planning for a chemical weapons agent release are shared by other hazards as well. The notion that emergency planning shares common functions underlies the decision by FEMA to include the Chemical Stockpile Emergency Preparedness Program (CSEPP) in its 'all-hazards' planning approach. The CSEPP's official planning guidance operationalizes this approach by suggesting that state and local CSEPP emergency plans 'should be appended to the existing all-hazards emergency plan.' The SPP is programmed as a set of tools within an ESRI ArcMap 9.1 project. ArcMap is a component of both ESRI ArcGIS 9.1 and ESRI ArcView 9.1, and it provides a rich GIS user interface for viewing spatial and tabular data, analyzing it, and producing output reports and maps. This GIS interface has been augmented with the SPP tools for a user interface that provides custom functionality for emergency planning. The system as released also includes some hypothetical example records for special needs populations, facilities, resources, control points and sirens sufficient for showing how the system would work with real information. A GIS database is included with some publicly available example layers. The SPP is designed to support emergency planners as they address emergency management issues, and includes capabilities that support the collection and importing of data, the review of data in a spatial context, and GIS tools for emergency planning. The SPP system allows for the identification and categorization of response zones to allow for multiple levels of preparedness. An Immediate Response Zone (IRZ) might be designated as the area 0 to 10 miles from a facility where the response would be the most urgent. SPP can support more than one set of planning zones to accommodate different types of emergencies or the different jurisdictions of emergency response organizations. These areas can be delineated by any number

  16. Converge, Version 3.0

    Directory of Open Access Journals (Sweden)

    Lotfi Tadj

    1993-01-01

    Full Text Available Although intended for college teachers/students, Converge presents a feature that may interest all scientists: it allows an easy export of graphic files to most known word processors, specifically to the ℙ, Version 2.1, a powerful WYSIWYG mathematical word processor.

  17. A Nobel prize to public science communication (Italian original version

    Directory of Open Access Journals (Sweden)

    Pietro Greco

    2007-12-01

    Full Text Available The Norwegian Nobel Committee has bestowed the 2007 Nobel Peace Price equally upon the scientists of the Intergovernmental Panel on Climate Change (IPCC and Al Gore, former vice-President of the United States of America, with the same motivation: «for their efforts to build up and disseminate greater knowledge about man-made climate change, and to lay the foundations for the measures that are needed to counteract such change».

  18. Amyris, Inc. Integrated Biorefinery Project Summary Final Report - Public Version

    Energy Technology Data Exchange (ETDEWEB)

    Gray, David; Sato, Suzanne; Garcia, Fernando; Eppler, Ross; Cherry, Joel

    2014-03-12

    The Amyris pilot-scale Integrated Biorefinery (IBR) leveraged Amyris synthetic biology and process technology experience to upgrade Amyris’s existing Emeryville, California pilot plant and fermentation labs to enable development of US-based production capabilities for renewable diesel fuel and alternative chemical products. These products were derived semi-synthetically from high-impact biomass feedstocks via microbial fermentation to the 15-carbon intermediate farnesene, with subsequent chemical finishing to farnesane. The Amyris IBR team tested and provided methods for production of diesel and alternative chemical products from sweet sorghum, and other high-impact lignocellulosic feedstocks, at pilot scale. This enabled robust techno-economic analysis (TEA), regulatory approvals, and a basis for full-scale manufacturing processes and facility design.

  19. Defence Capability Plan 2009 (Australian Department of Defence). Public Version

    Science.gov (United States)

    2009-01-24

    could involve a direct capital acquisition or privately financed lease , or elements of both. Background Initially, an improved rotary wing training...The Commonwealth seeks a ‘ turnkey ’ service providing aerial target presentations in line with an agreed annual schedule. All target assets are to be... lease . Through-life Support Depending on the procurement (ADF ownership or lease ) strategy, the through-life support concept for this project will

  20. In the Stocks: Perilous Press Releases.

    Science.gov (United States)

    Morton, Linda P.; Loving, Bill

    1994-01-01

    Reviews some of the legal responsibilities of public relations practitioners in the preparation of press releases. Discusses legal criteria for judging the fraudulence of press releases and discusses the timeframe for fraudulent action. Concludes with lessons that practitioners need to understand. (SR)

  1. Herwig++ 2.7 Release Note

    CERN Document Server

    Bellm, J; Grellscheid, D; Papaefstathiou, A; Platzer, S; Richardson, P; Rohr, C; Schuh, T; Seymour, M H; Siodmok, A; Wilcock, A; Zimmermann, B

    2013-01-01

    A new release of the Monte Carlo event generator Herwig++ (version 2.7) is now available. This version comes with a number of improvements including: an interface to the Universal FeynRules Output (UFO) format allowing the simulation of a wide range of new-physics models; developments of the Matchbox framework for next-to-leading order (NLO) simulations; better treatment of QCD radiation in heavy particle decays in new-physics models; a new tune of underlying event and colour connection parameters that allows a good simultaneous description of both Tevatron and LHC underlying event data and the effective cross-section parameter for double-parton scattering.

  2. 32 CFR 516.43 - Release of Army and other agency records.

    Science.gov (United States)

    2010-07-01

    ... AUTHORITIES AND PUBLIC RELATIONS LITIGATION Release of Information and Appearance of Witnesses Scope Release... approved for release can be authenticated for introduction in evidence by use of DA Form 4. (See §...

  3. Update of the European Landslide Susceptibility Map (ELSUS Version 2)

    Science.gov (United States)

    Wilde, Martina; Günther, Andreas; Malet, Jean-Philippe; Reichenbach, Paola; Hervás, Javier

    2015-04-01

    We present an update of the initial version of the European Landslide Susceptibility Map (ELSUS Version 1) that was released in 2012 through the EU Joint Research Centre (JRC) European Soil Data Centre (ESDAC). The susceptibility evaluation methodology employed for the updated map ELSUS Version 2 presented in this paper is identical to the previous approach, and comprises the differentiation of the analyzed European area into seven climate-physiographical model zones, the use of a reduced set of spatial susceptibility predictors (shallow subsurface lithology, slope angle, and land cover), and model zone-specific heuristic spatial multicriteria evaluations (SMCE) for susceptibility mapping. The most important improvement for ELSUS version 2 is the replacement of the original "lithology" data set consisting of soil parent material information derived from the European Soil Database (ESDB) by new information derived from the digital version of the International Hydrogeological Map of Europe at scale 1 : 1.5 Million (IHME 1500). IHME lithology describes both consolidated and unconsolidated shallow geological materials over Europe and can be shown to have a higher significance for landslide susceptibility evaluation than the soil parent material derived from ESDB. Other improvements consist in the change of the mapping unit from 1 km to 200 m grid size and the incorporation of terrains not covered by ELSUS version 1 (e.g., Iceland, the Faroers, the Shetlands, and Cyprus). Additionally, the new ELSUS version 2 was calibrated and validated with an updated pan-European landslide inventory now containing more than 155,000 landslides (30% more than used for ELSUS version 1). The enhanced and updated landslide inventory and the higher quality of the "lithology" data enabled us to establish more consistent SMCE-schemes for the individual model zones. The enhancements of ELSUS Version 2 result in an overall increase of the predictive power of the map for about 10%, as indicated

  4. Constructive version of Boolean algebra

    CERN Document Server

    Ciraulo, Francesco; Toto, Paola

    2012-01-01

    The notion of overlap algebra introduced by G. Sambin provides a constructive version of complete Boolean algebra. Here we first show some properties concerning overlap algebras: we prove that the notion of overlap morphism corresponds classically to that of map preserving arbitrary joins; we provide a description of atomic set-based overlap algebras in the language of formal topology, thus giving a predicative characterization of discrete locales; we show that the power-collection of a set is the free overlap algebra join-generated from the set. Then, we generalize the concept of overlap algebra and overlap morphism in various ways to provide constructive versions of the category of Boolean algebras with maps preserving arbitrary existing joins.

  5. Online Cake Cutting (published version)

    CERN Document Server

    Walsh, Toby

    2011-01-01

    We propose an online form of the cake cutting problem. This models situations where agents arrive and depart during the process of dividing a resource. We show that well known fair division procedures like cut-and-choose and the Dubins-Spanier moving knife procedure can be adapted to apply to such online problems. We propose some fairness properties that online cake cutting procedures can possess like online forms of proportionality and envy-freeness. We also consider the impact of collusion between agents. Finally, we study theoretically and empirically the competitive ratio of these online cake cutting procedures. Based on its resistance to collusion, and its good performance in practice, our results favour the online version of the cut-and-choose procedure over the online version of the moving knife procedure.

  6. News/Press Releases

    Data.gov (United States)

    Office of Personnel Management — A press release, news release, media release, press statement is written communication directed at members of the news media for the purpose of announcing programs...

  7. The propagation effect of paper version and the iPad version for periodicals

    Directory of Open Access Journals (Sweden)

    Cong Zhang

    2015-04-01

    Full Text Available Purpose: Digital journal created a new development pattern. We use journal APP as an example to analyze how to migrate the journal content to Internet and other kind of media. Based on the case study of GQ and other fashion magazines, through text analysis, control experiments, in-depth interviews and other research methods, the authors analyzed the differences and connections between the iPad App and print edition of magazines, discussed the approaches towards operation of new media, offered the tendency of mobile device platform development for China’s periodical publications. Design/methodology/approach: control experiment. Findings: The authors give a stance that the print edition of periodical publication will being alive still, and conclude that journal APP and printed version can be mutually beneficial and achieve a win-win state. And we believe that the journal APP is good at advertising propagation, which will accelerate the development of journal APP in such the information age, and such kind of media can integrate many information with variety of media forms. Research limitations/implications: Because of the limitation of technology, the authors only have the experiment on fashion magazine, which might to some degree simplify the issue under discussion. Practical implications: According to the conclusion of a series of experiments, we can imply the future of the media, and give the suggestion of both paper version and ipad version of the journal. Social implications: Since people can not live without media and media has to develope with the help of public, we have to give the new way of both sunrise media and sunset media. Originality/value: Based on the case study of GQ and other fashion magazines, through text analysis, control experiments, in-depth interviews and other research methods, the authors analyzed the differences and connections between the iPad App and print edition of magazines, discussed the approaches towards

  8. Public Education, Public Good.

    Science.gov (United States)

    Tomlinson, John

    1986-01-01

    Criticizes policies which would damage or destroy a public education system. Examines the relationship between government-provided education and democracy. Concludes that privatization of public education would emphasize self-interest and selfishness, further jeopardizing the altruism and civic mindedness necessary for the public good. (JDH)

  9. User's Manual for LEWICE Version 3.2

    Science.gov (United States)

    Wright, William

    2008-01-01

    A research project is underway at NASA Glenn to produce a computer code which can accurately predict ice growth under a wide range of meteorological conditions for any aircraft surface. This report will present a description of the code inputs and outputs from version 3.2 of this software, which is called LEWICE. This version differs from release 2.0 due to the addition of advanced thermal analysis capabilities for de-icing and anti-icing applications using electrothermal heaters or bleed air applications, the addition of automated Navier-Stokes analysis, an empirical model for supercooled large droplets (SLD) and a pneumatic boot option. An extensive effort was also undertaken to compare the results against the database of electrothermal results which have been generated in the NASA Glenn Icing Research Tunnel (IRT) as was performed for the validation effort for version 2.0. This report will primarily describe the features of the software related to the use of the program. Appendix A has been included to list some of the inner workings of the software or the physical models used. This information is also available in the form of several unpublished documents internal to NASA. This report is intended as a replacement for all previous user manuals of LEWICE. In addition to describing the changes and improvements made for this version, information from previous manuals may be duplicated so that the user will not need to consult previous manuals to use this software.

  10. CMS releases new batch of LHC open data

    CERN Multimedia

    Achintya Rao

    2016-01-01

    CMS makes 300 TB of high-quality data from the LHC available to the public through the CERN Open Data Portal.   A CMS collision event as seen in the built-in event display on the CERN Open Data Portal (Image: CERN) The CMS collaboration has made 300 TB of high-quality data from the LHC available to the public through the CERN Open Data Portal. The collision data come in two types: The so-called “primary datasets” are in the same format used by the CMS Collaboration to perform research. The “derived datasets” on the other hand require a lot less computing power and can be readily analysed by university or even high-school students. Notably, CMS is also providing the simulated data generated with the same software version that should be used to analyse the primary datasets. Simulations play a crucial role in particle-physics research and CMS is also making available the protocols for generating the simulations that are provided. The data release is accompanie...

  11. GENIE Production Release 2.10.0

    CERN Document Server

    Alam, M; Athar, M; Bodek, A; Christy, E; Coopersmith, B; Dennis, S; Dytman, S; Gallagher, H; Geary, N; Golan, T; Hatcher, R; Hoshina, K; Liu, J; Mahn, K; Marshall, C; Morrison, J; Nirkko, M; Nowak, J; Perdue, G N; Yarba, J

    2015-01-01

    GENIE is a neutrino Monte Carlo event generator that simulates the primary interaction of a neutrino with a nuclear target, along with the subsequent propagation of the reaction products through the nuclear medium. It additionally contains libraries for fully-featured detector geometries and for managing various types of neutrino flux. This note details recent updates to GENIE, in particular changes introduced into the newest production release, version 2.10.0.

  12. GENIE Production Release 2.10.0

    Energy Technology Data Exchange (ETDEWEB)

    Alam, M. [Aligarh Muslim Univ., Aligarh (India). Dept. of Physics; Andreopoulos, C. [Univ. of Liverpool (United Kingdom). Dept. of Physics; Science and Technology Facilities Council (STFC), Oxford (United Kingdom). Rutherford Appleton Lab. (RAL); Athar, M. [Aligarh Muslim Univ., Aligarh (India). Dept. of Physics; Bodek, A. [Univ. of Rochester, NY (United States). Dept. of Physics; Christy, E. [Hampton Univ., Hampton, VA (United States). Dept. of Physics; Coopersmith, B. [Univ. of Rochester, NY (United States). Dept. of Physics; Dennis, S. [Univ. of Warwick, Coventry (United Kingdom). Dept .of Physics; Dytman, S. [Univ. of Pittsburgh, PA (United States). Dept. of Physics and Astronomy; Gallagher, H. [Tufts Univ., Medford, MA (United States). Dept. of Physics and Astronomy; Geary, N. [Univ. of Pittsburgh, PA (United States). Dept. of Physics and Astronomy; Golan, T. [Univ. of Rochester, NY (United States). Dept. of Physics; Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Hatcher, R. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Hoshina, K. [Univ. of Wisconsin, Madison, WI (United States). Dept. of Physics. Wisconsin IceCube Particle Astrophysics Center; Liu, J. [College of William and Mary, Williamsburg, VA (United States). Dept. of Physics; Mahn, K. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy; Marshall, C. [Univ. of Rochester, NY (United States). Dept. of Physics; Morrison, J. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy; Nirkko, M. [Univ. of Bern (Switzerland). Albert Einstein Center for Fundamental Physics. Lab. for High Energy Physics (LHEP); Nowak, J. [Lancaster Univ. (United Kingdom). Dept. of Physics; Perdue, G. N. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Yarba, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States)

    2015-12-25

    GENIE is a neutrino Monte Carlo event generator that simulates the primary interaction of a neutrino with a nuclear target, along with the subsequent propagation of the reaction products through the nuclear medium. It additionally contains libraries for fully-featured detector geometries and for managing various types of neutrino flux. This note details recent updates to GENIE, in particular, changes introduced into the newest production release, version 2.10.0.

  13. Current status of the dual-frequency precipitation radar on the global precipitation measurement core spacecraft and the new version of GPM standard products

    Science.gov (United States)

    Furukawa, K.; Nio, T.; Konishi, T.; Masaki, T.; Kubota, T.; Oki, R.; Iguchi, T.

    2016-10-01

    The Dual-frequency Precipitation Radar (DPR) on the Global Precipitation Measurement (GPM) core satellite was developed by Japan Aerospace Exploration Agency (JAXA) and National Institute of Information and Communications Technology (NICT). The objective of the GPM mission is to observe global precipitation more frequently and accurately. The GPM core satellite is a joint product of National Aeronautics and Space Administration (NASA), JAXA and NICT. NASA developed the satellite bus and the GPM Microwave Imager (GMI), and JAXA and NICT developed the DPR. The inclination of the GPM core satellite is 65 degrees, and the nominal flight altitude is 407 km. The non-sunsynchronous circular orbit is necessary for measuring the diurnal change of rainfall. The DPR consists of two radars, which are Ku-band precipitation radar (KuPR) and Ka-band precipitation radar (KaPR). GPM core observatory was successfully launched by H2A launch vehicle on Feb. 28, 2014. DPR keeps its performances on orbit after launch. DPR products were released to the public on Sep. 2, 2014. JAXA is continuing DPR trend monitoring, calibration and validation operations to confirm that DPR keeps its function and performance on orbit. JAXA have started to provide new version (Version 4) of GPM standard products on March 3, 2016. Various improvements of the DPR algorithm were implemented in the Version 4 product. Moreover, the latent heat product based on the Spectral Latent Heating (SLH) algorithm is available since Version 4 product. Current orbital operation status of the GPM/DPR and highlights of the Version 4 product are reported.

  14. Version 1 of the Hubble Source Catalog

    CERN Document Server

    Whitmore, Bradley C; Budavari, Tamas; Casertano, Stefano; Downes, Ronald A; Donaldson, Thomas; Fall, S Michael; Lubow, Stephen H; Quick, Lee; Strolger, Louis-Gregory; Wallace, Geoff; White, Richard L

    2016-01-01

    The Hubble Source Catalog is designed to help optimize science from the Hubble Space Telescope by combining the tens of thousands of visit-based source lists in the Hubble Legacy Archive into a single master catalog. Version 1 of the Hubble Source Catalog includes WFPC2, ACS/WFC, WFC3/UVIS, and WFC3/IR photometric data generated using SExtractor software to produce the individual source lists. The catalog includes roughly 80 million detections of 30 million objects involving 112 different detector/filter combinations, and about 160 thousand HST exposures. Source lists from Data Release 8 of the Hubble Legacy Archive are matched using an algorithm developed by Budavari & Lubow (2012). The mean photometric accuracy for the catalog as a whole is better than 0.10 mag, with relative accuracy as good as 0.02 mag in certain circumstances (e.g., bright isolated stars). The relative astrometric residuals are typically within 10 mas, with a value for the mode (i.e., most common value) of 2.3 mas. The absolute astro...

  15. New version of the web based CERN Phonebook

    CERN Multimedia

    GS Department

    2011-01-01

    A new version of CERN’s web-based phonebook will be deployed during the weekend of 17/18 December 2011. The most important new feature will be the possibility to see the CERN identity card photo of every person listed in the phonebook who has a registered photo.   The photo will be available on each person's details page and will be visible to all employed and associated members of the personnel who have the appropriate authentication (i.e. those who log in using their AIS login). More information about other new features of the release will be available from 19 December 2011 from the webpage detailing the version history of the CERN phonebook.

  16. Verification and validation of RADMODL Version 1.0

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, K.D.

    1993-03-01

    RADMODL is a system of linked computer codes designed to calculate the radiation environment following an accident in which nuclear materials are released. The RADMODL code and the corresponding Verification and Validation (V&V) calculations (Appendix A), were developed for Westinghouse Savannah River Company (WSRC) by EGS Corporation (EGS). Each module of RADMODL is an independent code and was verified separately. The full system was validated by comparing the output of the various modules with the corresponding output of a previously verified version of the modules. The results of the verification and validation tests show that RADMODL correctly calculates the transport of radionuclides and radiation doses. As a result of this verification and validation effort, RADMODL Version 1.0 is certified for use in calculating the radiation environment following an accident.

  17. Neutrino Mass Seesaw Version 3: Recent Developments

    CERN Document Server

    Ma, Ernest

    2009-01-01

    The origin of neutrino mass is usually attributed to a seesaw mechanism, either through a heavy Majorana fermion singlet (version 1) or a heavy scalar triplet (version 2). Recently, the idea of using a heavy Majorana fermion triplet (version 3) has gained some attention. This is a review of the basic idea involved, its U(1) gauge extension, and some recent developments.

  18. EIA new releases, July--August, 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-02

    This publication identifies energy related publications of the Energy Information Administration of the US Department of Energy. The topics and articles in this issue include data on residential energy use available on diskettes and Internet, natural gas price predictions, coal deliveries to electric utilities, growth in the US uranium industry, microfiche products, features and press releases, EIA`s electronic publishing system, new reports, machine-readable files, how to order EIA publications and energy data information contacts.

  19. Publication of the bulletin

    CERN Multimedia

    DSU Unit

    2008-01-01

    The final edition (Nos 51-52/2008 and 1-2/2009) of the last Weekly Bulletin of the year will be published on Friday 12 December and will cover events at CERN from 15 December 2008 to 12 January 2009. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate by noon, on Tuesday 9 December. Bulletin publication 2009 The table below lists the 2009 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Publication date 3-4 Tuesday 6 January Monday 12 January 5-6 Tuesday 20 January Monday 26 January 7-8 Tuesday 3 February Monday 9 February 9-10 Tuesday 17 Februar...

  20. Embrittlement data base, version 1

    Energy Technology Data Exchange (ETDEWEB)

    Wang, J.A.

    1997-08-01

    The aging and degradation of light-water-reactor (LWR) pressure vessels is of particular concern because of their relevance to plant integrity and the magnitude of the expected irradiation embrittlement. The radiation embrittlement of reactor pressure vessel (RPV) materials depends on many different factors such as flux, fluence, fluence spectrum, irradiation temperature, and preirradiation material history and chemical compositions. These factors must be considered to reliably predict pressure vessel embrittlement and to ensure the safe operation of the reactor. Based on embrittlement predictions, decisions must be made concerning operating parameters and issues such as low-leakage-fuel management, possible life extension, and the need for annealing the pressure vessel. Large amounts of data from surveillance capsules and test reactor experiments, comprising many different materials and different irradiation conditions, are needed to develop generally applicable damage prediction models that can be used for industry standards and regulatory guides. Version 1 of the Embrittlement Data Base (EDB) is such a comprehensive collection of data resulting from merging version 2 of the Power Reactor Embrittlement Data Base (PR-EDB). Fracture toughness data were also integrated into Version 1 of the EDB. For power reactor data, the current EDB lists the 1,029 Charpy transition-temperature shift data points, which include 321 from plates, 125 from forgoings, 115 from correlation monitor materials, 246 from welds, and 222 from heat-affected-zone (HAZ) materials that were irradiated in 271 capsules from 101 commercial power reactors. For test reactor data, information is available for 1,308 different irradiated sets (352 from plates, 186 from forgoings, 303 from correlation monitor materials, 396 from welds and 71 from HAZs) and 268 different irradiated plus annealed data sets.

  1. Independent Verification and Validation SAPHIRE Version 8 Final Report Project Number: N6423 U.S. Nuclear Regulatory Commission

    Energy Technology Data Exchange (ETDEWEB)

    Kent Norris

    2010-04-01

    This report provides an evaluation of the SAPHIRE version 8 software product. SAPHIRE version 8 is being developed with a phased or cyclic iterative rapid application development methodology. Due to this approach, a similar approach has been taken for the IV&V activities on each vital software object. IV&V and Software Quality Assurance (SQA) activities occur throughout the entire development life cycle and therefore, will be required through the full development of SAPHIRE version 8. Later phases of the software life cycle, the operation and maintenance phases, are not applicable in this effort since the IV&V is being done prior to releasing Version 8.

  2. DEMAID - A DESIGN MANAGER'S AID FOR INTELLIGENT DECOMPOSITION (MACINTOSH VERSION)

    Science.gov (United States)

    Rogers, J. L.

    1994-01-01

    effects of an output with respect to a change in a particular input. The second method traces backward to determine what modules must be re-executed if the output of a module must be recomputed. DeMAID is available in three machine versions: a Macintosh version which is written in Symantec's Think C 3.01, a Sun version, and an SGI IRIS version, both of which are written in C language. The Macintosh version requires system software 6.0.2 or later and CLIPS 4.3. The source code for the Macintosh version will not compile under version 4.0 of Think C; however, a sample executable is provided on the distribution media. QuickDraw is required for plotting. The Sun version requires GKS 4.1 graphics libraries, OpenWindows 3, and CLIPS 4.3. The SGI IRIS version requires CLIPS 4.3. Since DeMAID is not compatible with CLIPS 5.0 or later, the source code for CLIPS 4.3 is included on the distribution media; however, the documentation for CLIPS 4.3 is not included in the documentation package for DeMAID. It is available from COSMIC separately as the documentation for MSC-21208. The standard distribution medium for the Macintosh version of DeMAID is a set of four 3.5 inch 800K Macintosh format diskettes. The standard distribution medium for the Sun version of DeMAID is a .25 inch streaming magnetic tape cartridge (QIC-24) in UNIX tar format. The standard distribution medium for the IRIS version is a .25 inch IRIX compatible streaming magnetic tape cartridge in UNIX tar format. All versions include sample input. DeMAID was originally developed for use on VAX VMS computers in 1989. The Macintosh version of DeMAID was released in 1991 and updated in 1992. The Sun version of DeMAID was released in 1992 and updated in 1993. The SGI IRIS version was released in 1993.

  3. DEMAID - A DESIGN MANAGER'S AID FOR INTELLIGENT DECOMPOSITION (SUN VERSION)

    Science.gov (United States)

    Rogers, J. L.

    1994-01-01

    effects of an output with respect to a change in a particular input. The second method traces backward to determine what modules must be re-executed if the output of a module must be recomputed. DeMAID is available in three machine versions: a Macintosh version which is written in Symantec's Think C 3.01, a Sun version, and an SGI IRIS version, both of which are written in C language. The Macintosh version requires system software 6.0.2 or later and CLIPS 4.3. The source code for the Macintosh version will not compile under version 4.0 of Think C; however, a sample executable is provided on the distribution media. QuickDraw is required for plotting. The Sun version requires GKS 4.1 graphics libraries, OpenWindows 3, and CLIPS 4.3. The SGI IRIS version requires CLIPS 4.3. Since DeMAID is not compatible with CLIPS 5.0 or later, the source code for CLIPS 4.3 is included on the distribution media; however, the documentation for CLIPS 4.3 is not included in the documentation package for DeMAID. It is available from COSMIC separately as the documentation for MSC-21208. The standard distribution medium for the Macintosh version of DeMAID is a set of four 3.5 inch 800K Macintosh format diskettes. The standard distribution medium for the Sun version of DeMAID is a .25 inch streaming magnetic tape cartridge (QIC-24) in UNIX tar format. The standard distribution medium for the IRIS version is a .25 inch IRIX compatible streaming magnetic tape cartridge in UNIX tar format. All versions include sample input. DeMAID was originally developed for use on VAX VMS computers in 1989. The Macintosh version of DeMAID was released in 1991 and updated in 1992. The Sun version of DeMAID was released in 1992 and updated in 1993. The SGI IRIS version was released in 1993.

  4. 50 CFR 600.425 - Release of statistics.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Release of statistics. 600.425 Section 600... ADMINISTRATION, DEPARTMENT OF COMMERCE MAGNUSON-STEVENS ACT PROVISIONS Confidentiality of Statistics § 600.425 Release of statistics. (a) The Assistant Administrator will not release to the public any...

  5. 7 CFR 1951.154 - Satisfaction and release of documents.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Satisfaction and release of documents. 1951.154... Loans § 1951.154 Satisfaction and release of documents. (a) Authorization. FmHA or its successor agency under Public Law 103-354 is authorized to execute the necessary releases and satisfactions and...

  6. Earnings Public-Use File, 2006

    Data.gov (United States)

    Social Security Administration — Social Security Administration released Earnings Public-Use File (EPUF) for 2006. File contains earnings information for individuals drawn from a systematic random...

  7. CRIS Cyber Range Lexicon, Version 1.0

    Science.gov (United States)

    2015-11-10

    Dr. Suresh K. Damodaran, MIT Lincoln Laboratory Ms. Kathy Smith, GBL Systems Corporation This work is sponsored by the Test Resource...not necessarily endorsed by the United States Government . Approved for public release; distribution is unlimited...2 2.0 Cyber Range Terminology

  8. Public Speech.

    Science.gov (United States)

    Green, Thomas F.

    1994-01-01

    Discusses the importance of public speech in society, noting the power of public speech to create a world and a public. The paper offers a theory of public speech, identifies types of public speech, and types of public speech fallacies. Two ways of speaking of the public and of public life are distinguished. (SM)

  9. New features in McStas, version 1.5

    Science.gov (United States)

    Åstrand, P.-O.; Lefmann, K.; Farhi, E.; Nielsen, K.; Skårup, P.

    The neutron ray-tracing simulation package McStas has attracted numerous users, and the development of the package continues with version 1.5 released at the ICNS 2001 conference. New features include: support for neutron polarisation, labelling of neutrons, realistic source and sample components, and interface to the Riso instrument-control software TASCOM. We give a general introduction to McStas and present the latest developments. In particular, we give an example of how the neutron-label option has been used to locate the origin of a spurious side-peak, observed in an experiment with RITA-1 at Riso.

  10. New features in McStas, version 1.5

    CERN Document Server

    Aastrand, P O; Nielsen, K; Skaarup, P; Farhi, E

    2002-01-01

    The neutron ray-tracing simulation package McStas has attracted numerous users, and the development of the package continues with version 1.5 released at the ICNS 2001 conference. New features include: support for neutron polarisation, labelling of neutrons, realistic source and sample components, and interface to the Riso instrument-control software TASCOM. We give a general introduction to McStas and present the latest developments. In particular, we give an example of how the neutron-label option has been used to locate the origin of a spurious side-peak, observed in an experiment with RITA-1 at Riso. (orig.)

  11. Release of RANKERN 16A

    Directory of Open Access Journals (Sweden)

    Bird Adam

    2017-01-01

    Full Text Available RANKERN 16 is the latest version of the point-kernel gamma radiation transport Monte Carlo code from AMEC Foster Wheeler’s ANSWERS Software Service. RANKERN is well established in the UK shielding community for radiation shielding and dosimetry assessments. Many important developments have been made available to users in this latest release of RANKERN. The existing general 3D geometry capability has been extended to include import of CAD files in the IGES format providing efficient full CAD modelling capability without geometric approximation. Import of tetrahedral mesh and polygon surface formats has also been provided. An efficient voxel geometry type has been added suitable for representing CT data. There have been numerous input syntax enhancements and an extended actinide gamma source library. This paper describes some of the new features and compares the performance of the new geometry capabilities.

  12. Release of RANKERN 16A

    Science.gov (United States)

    Bird, Adam; Murphy, Christophe; Dobson, Geoff

    2017-09-01

    RANKERN 16 is the latest version of the point-kernel gamma radiation transport Monte Carlo code from AMEC Foster Wheeler's ANSWERS Software Service. RANKERN is well established in the UK shielding community for radiation shielding and dosimetry assessments. Many important developments have been made available to users in this latest release of RANKERN. The existing general 3D geometry capability has been extended to include import of CAD files in the IGES format providing efficient full CAD modelling capability without geometric approximation. Import of tetrahedral mesh and polygon surface formats has also been provided. An efficient voxel geometry type has been added suitable for representing CT data. There have been numerous input syntax enhancements and an extended actinide gamma source library. This paper describes some of the new features and compares the performance of the new geometry capabilities.

  13. New Source Term Model for the RESRAD-OFFSITE Code Version 3

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Charley [Argonne National Lab. (ANL), Argonne, IL (United States); Gnanapragasam, Emmanuel [Argonne National Lab. (ANL), Argonne, IL (United States); Cheng, Jing-Jy [Argonne National Lab. (ANL), Argonne, IL (United States); Kamboj, Sunita [Argonne National Lab. (ANL), Argonne, IL (United States); Chen, Shih-Yew [Argonne National Lab. (ANL), Argonne, IL (United States)

    2013-06-01

    This report documents the new source term model developed and implemented in Version 3 of the RESRAD-OFFSITE code. This new source term model includes: (1) "first order release with transport" option, in which the release of the radionuclide is proportional to the inventory in the primary contamination and the user-specified leach rate is the proportionality constant, (2) "equilibrium desorption release" option, in which the user specifies the distribution coefficient which quantifies the partitioning of the radionuclide between the solid and aqueous phases, and (3) "uniform release" option, in which the radionuclides are released from a constant fraction of the initially contaminated material during each time interval and the user specifies the duration over which the radionuclides are released.

  14. GLOBAL MAPPING PROJECT – APPLICATIONS AND DEVELOPMENT OF VERSION 2 DATASET

    Directory of Open Access Journals (Sweden)

    T. Ubukawa

    2012-07-01

    Full Text Available The Global Mapping Project aims to develop basic geospatial information of the whole land area of the globe, named Global Map, through the cooperation of National Mapping Organizations (NMOs around the world. The Global Map data can be a base of global geospatial infrastructure and is composed of eight layers: Boundaries, Drainage, Transportation, Population Centers, Elevation, Land Use, Land Cover and Vegetation. The Global Map Version 1 was released in 2008, and the Version 2 will be released in 2013 as the data are to be updated every five years. In 2009, the International Steering Committee for Global Mapping (ISCGM adopted new Specifications to develop the Global Map Version 2 with a change of its format so that it is compatible with the international standards, namely ISO 19136 and ISO 19115. With the support of the secretariat of ISCGM, the project participating countries are accelerating their data development toward the completion of the global coverage in 2013, while some countries have already released their Global Map version 2 datasets since 2010. Global Map data are available from the Internet free of charge for non-commercial purposes, which can be used to predict, assess, prepare for and cope with global issues by combining with other spatial data. There are a lot of Global Map applications in various fields, and further utilization of Global Map is expected. This paper summarises the activities toward the development of the Global Map Version 2 as well as some examples of the Global Map applications in various fields.

  15. Bulletin publication schedule

    CERN Multimedia

    Publications Section, DG-CO Group

    2011-01-01

    The final edition (Nos 51-52/2011 and 1-2-3/2012) of the Bulletin this year will be published on Friday 16 December and will cover events at CERN from 19 December 2011 to 19 January 2012. Announcements for publication in this issue should reach the Communication Group or the Staff Association, as appropriate, by noon on Tuesday 13 December. Bulletin publication schedule for 2012 The table below lists the 2012 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 noon on Tuesdays at the latest.   Bulletin No. Week number Submission of announcements (before 12.00 midday) Bulletin Web version Bulletin Printed version 4-5   Tuesday 17 January Fridays 20 and 27 January Wednesday25 January 6-7   Tuesday 31 January Fridays 3 and 10 February Wednesday 8 February 8-9 Tuesday 14 February Fridays 17 and 24 february Wednesday 22 Februa...

  16. Science news release and its benefits to your research

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    News release to the latest science findings is beneficial to both researchers and their served institutions as well as the public. It will help to set a bridge of communication between researchers, the public and media, and publishers, making the latest research findings well known to the public. World Journal of Gastroenterology has currently freely opened the News Release Service System (WJG-NRSS) for original articles with potential significance and novelty for news release to mass media to broaden the findings to the public.

  17. Versions in the lifecycle of academic papers user requirements and guidelins fo digital repositories

    CERN Document Server

    CERN. Geneva

    2005-01-01

    An academic research paper evolves through various stages during its lifecycle, for example from early conference presentation through working paper to final published refereed journal article. Different versions can co-exist in publicly available electronic form. Finding out researchers’ attitudes towards storing, labelling and making accessible these different versions, both of their own and of their peers’ work is at the heart of the VERSIONS Project, funded by the JISC under the Digital Repositories Programme. The project addresses the issues and uncertainties relating to versions of academic papers in digital repositories. By including a user requirements study, the project will clarify the needs of researchers and other stakeholders for deposit, storage and accessibility of different versions in the lifecycle of a digital resource. In addition to looking at user needs, the project will analyse researchers’ current practice in terms of retention of author copies of their own material. This investig...

  18. Incremental Testing of the Community Multiscale Air Quality (CMAQ) Modeling System Version 4.7

    Science.gov (United States)

    This paper describes the scientific and structural updates to the latest release of the Community Multiscale Air Quality (CMAQ) modeling system version 4.7 (v4.7) and points the reader to additional resources for further details. The model updates were evaluated relative to obse...

  19. An update to the Surface Ocean CO2 Atlas (SOCAT version 2)

    Digital Repository Service at National Institute of Oceanography (India)

    Bakker, D.C.E; Hankin, S.; Olsen, A; Pfeil, B; Smith, K.; Alin, S.R.; Cosca, C; Hales, B.; Harasawa, S.; Kozyr, A.; Nojiri, Y.; OBrien, K.M.; Schuster, U.; Telszewski, M.; Tilbrook, B.; Wada, C.; Akl, J.; Barbero, L.; Bates, N.; Boutin, J.; Cai, W.J.; Castle, R.D.; Chavez, F.; Chen, L.; Chierici, M.; Currie, K.; Evans, W.; Feely, R.A.; Fransson, A.; Gao, Z.; Hardman-Mountford, N.; Hoppema, M.; Huang, W.J.; Hunt, C.W.; Huss, B.; Ichikawa, T.; Jacobson, A.; Johannessen, T.; Jones, E.M.; Jones, S.; Sara, J.; Kitidis, V.; Kortzinger, A.; Lauvset, S.; Lefevre, N.; Manke, A.B; Mathis, J.; Metzl, N.; Monteiro, P.; Murata, A.; Newberger, T.; Nobuo, T.; Ono, T.; Paterson, K.; Pierrot, D.; Rios, A.F.; Sabine, C.L.; Saito, S.; Salisbury, J.; Sarma, V.V.S.S.; Schlitzer, R.; Sieger, R.; Skjelvan, I.; Steinhoff, T.; Sullivan, K.; Sutherland, S.C.; Suzuki, T.; Sutton, A.; Sweeney, C.; Takahashi, T.; Tjiputra, J.; VanHeuven, S.; Vandemark, D.; Vlahos, P.; Wallace, D.W.R.; Wanninkhof, R.; Watson, A.J.

    of SOCAT is an update of the previous release (version 1) with more data (increased from 6.3 million to 10.1 million surface water fCO2 values) and extended data coverage (from 1968–2007 to 1968–2011). The quality control criteria, while...

  20. A multi-decade record of high-quality fCO2 data in version 3 of the Surface Ocean CO2 Atlas (SOCAT)

    Science.gov (United States)

    Bakker, Dorothee; Landa, Camilla S.; Pfeil, Benjamin; Metzl, Nicolas; O’Brien, Kevin; Olsen, Are; Smith, Karl; Cosca, Cathy; Harasawa, Sumiko; Nakaoka, Shin-ichiro; Jones, Stephen; Nojiri, Yukihiro; Steinhoff, Tobias; Sweeney, Colm; Schuster, Ute; Takahashi, Taro; Tilbrook, Bronte; Wada, Chisato; Wanninkhof, Rik; Alin, Simone R.; Balestrini, Carlos F.; Barbero, Leticia; Bates, Nicholas; Bianchi, Alejandro A.; Bonou, Frédéric; Boutin, Jacqueline; Bozec, Yann; Burger, Eugene F.; Cai, Wei-Jun; Castle, Robert D.; Chen, Liqi; Chierici, Melissa; Currie, Kim; Evans, Wiley; Featherstone, Charles; Feely, Richard; Fransson, Agneta; Goyet, Catherine; Greenwood, Naomi; Gregor, Luke; Hankin, Steven; Hardman-Mountford, Nick J.; Harlay, Jérôme; Hauck, Judith; Hoppema, Mario; Humphreys, Matthew P.; Hunt, Christopher W.; Huss, Betty; Ibánhez, J. Severino P.; Keeling, Ralph F.; Johannessen, Truls; Kitidis, Vassilis; Körtzinger, Arne; Kozyr, Alex; Krasakopoulou, Evangelia; Kuwata, Akira; Landschützer, Peter; Lauvset, Siv K.; Lefèvre, Nathalie; Lo Monaco, Claire; Manke, Ansley; Mathis, Jeremy T.; Merlivat, Liliane; Millero, Frank J.; Monteiro, Pedro M. S.; Munro, David R.; Murata, Akihiko; Newberger, Timothy; Omar, Abdirahman M.; Ono, Tsuneo; Paterson, Kristina; Pearce, David; Pierrot, Denis; Robbins, Lisa L.; Saito, Shu; Salisbury, Joe; Schlitzer, Reiner; Schneider, Bernd; Schweitzer, Roland; Sieger, Rainer; Skjelvan, Ingunn; Sullivan, Kevin F.; Sutherland, Stewart C.; Sutton, Adrienne J.; Tadokoro, Kazuaki; Telszewski, Maciej; Tuma, Matthias; van Heuven, Steven M. A. C.; Vandemark, Douglas; Ward, Brian; Watson, Andrew J.; Xu, Suqing

    2016-01-01

    The Surface Ocean CO2 Atlas (SOCAT) is a synthesis of quality-controlled f CO2 (fugacity of carbon dioxide) values for the global surface oceans and coastal seas with regular updates. Version 3 of SOCAT has 14.7 million f CO2 values from 3646 data sets covering the years 1957 to 2014. This latest version has an additional 4.6 million f CO2 values relative to version 2 and extends the record from 2011 to 2014. Version 3 also significantly increases the data availability for 2005 to 2013. SOCAT has an average of approximately 1.2 million surface water f CO2 values per year for the years 2006 to 2012. Quality and documentation of the data has improved. A new feature is the data set quality control (QC) flag of E for data from alternative sensors and platforms. The accuracy of surface water f CO2 has been defined for all data set QC flags. Automated range checking has been carried out for all data sets during their upload into SOCAT. The upgrade of the interactive Data Set Viewer (previously known as the Cruise Data Viewer) allows better interrogation of the SOCAT data collection and rapid creation of high-quality figures for scientific presentations. Automated data upload has been launched for version 4 and will enable more frequent SOCAT releases in the future. High-profile scientific applications of SOCAT include quantification of the ocean sink for atmospheric carbon dioxide and its long-term variation, detection of ocean acidification, as well as evaluation of coupled-climate and ocean-only biogeochemical models. Users of SOCAT data products are urged to acknowledge the contribution of data providers, as stated in the SOCAT Fair Data Use Statement. This ESSD (Earth System Science Data) “living data” publication documents the methods and data sets used for the assembly of this new version of the SOCAT data collection and compares these with those used for earlier versions of the data collection (Pfeil et al., 2013; Sabine et al., 2013; Bakker et al., 2014). 

  1. A multi-decade record of high-quality fCO2 data in version 3 of the Surface Ocean CO2 Atlas (SOCAT)

    Science.gov (United States)

    Bakker, Dorothee C. E.; Pfeil, Benjamin; Landa, Camilla S.; Metzl, Nicolas; O'Brien, Kevin M.; Olsen, Are; Smith, Karl; Cosca, Cathy; Harasawa, Sumiko; Jones, Stephen D.; Nakaoka, Shin-ichiro; Nojiri, Yukihiro; Schuster, Ute; Steinhoff, Tobias; Sweeney, Colm; Takahashi, Taro; Tilbrook, Bronte; Wada, Chisato; Wanninkhof, Rik; Alin, Simone R.; Balestrini, Carlos F.; Barbero, Leticia; Bates, Nicholas R.; Bianchi, Alejandro A.; Bonou, Frédéric; Boutin, Jacqueline; Bozec, Yann; Burger, Eugene F.; Cai, Wei-Jun; Castle, Robert D.; Chen, Liqi; Chierici, Melissa; Currie, Kim; Evans, Wiley; Featherstone, Charles; Feely, Richard A.; Fransson, Agneta; Goyet, Catherine; Greenwood, Naomi; Gregor, Luke; Hankin, Steven; Hardman-Mountford, Nick J.; Harlay, Jérôme; Hauck, Judith; Hoppema, Mario; Humphreys, Matthew P.; Hunt, Christopher W.; Huss, Betty; Ibánhez, J. Severino P.; Johannessen, Truls; Keeling, Ralph; Kitidis, Vassilis; Körtzinger, Arne; Kozyr, Alex; Krasakopoulou, Evangelia; Kuwata, Akira; Landschützer, Peter; Lauvset, Siv K.; Lefèvre, Nathalie; Lo Monaco, Claire; Manke, Ansley; Mathis, Jeremy T.; Merlivat, Liliane; Millero, Frank J.; Monteiro, Pedro M. S.; Munro, David R.; Murata, Akihiko; Newberger, Timothy; Omar, Abdirahman M.; Ono, Tsuneo; Paterson, Kristina; Pearce, David; Pierrot, Denis; Robbins, Lisa L.; Saito, Shu; Salisbury, Joe; Schlitzer, Reiner; Schneider, Bernd; Schweitzer, Roland; Sieger, Rainer; Skjelvan, Ingunn; Sullivan, Kevin F.; Sutherland, Stewart C.; Sutton, Adrienne J.; Tadokoro, Kazuaki; Telszewski, Maciej; Tuma, Matthias; van Heuven, Steven M. A. C.; Vandemark, Doug; Ward, Brian; Watson, Andrew J.; Xu, Suqing

    2016-09-01

    The Surface Ocean CO2 Atlas (SOCAT) is a synthesis of quality-controlled fCO2 (fugacity of carbon dioxide) values for the global surface oceans and coastal seas with regular updates. Version 3 of SOCAT has 14.7 million fCO2 values from 3646 data sets covering the years 1957 to 2014. This latest version has an additional 4.6 million fCO2 values relative to version 2 and extends the record from 2011 to 2014. Version 3 also significantly increases the data availability for 2005 to 2013. SOCAT has an average of approximately 1.2 million surface water fCO2 values per year for the years 2006 to 2012. Quality and documentation of the data has improved. A new feature is the data set quality control (QC) flag of E for data from alternative sensors and platforms. The accuracy of surface water fCO2 has been defined for all data set QC flags. Automated range checking has been carried out for all data sets during their upload into SOCAT. The upgrade of the interactive Data Set Viewer (previously known as the Cruise Data Viewer) allows better interrogation of the SOCAT data collection and rapid creation of high-quality figures for scientific presentations. Automated data upload has been launched for version 4 and will enable more frequent SOCAT releases in the future. High-profile scientific applications of SOCAT include quantification of the ocean sink for atmospheric carbon dioxide and its long-term variation, detection of ocean acidification, as well as evaluation of coupled-climate and ocean-only biogeochemical models. Users of SOCAT data products are urged to acknowledge the contribution of data providers, as stated in the SOCAT Fair Data Use Statement. This ESSD (Earth System Science Data) "living data" publication documents the methods and data sets used for the assembly of this new version of the SOCAT data collection and compares these with those used for earlier versions of the data collection (Pfeil et al., 2013; Sabine et al., 2013; Bakker et al., 2014). Individual

  2. Expansion of ARAC for chemical releases

    Energy Technology Data Exchange (ETDEWEB)

    Baskett, R.L.; Blair, M.D.; Foster, C.S.; Taylor, A.G.

    1997-07-01

    In 1996 the Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory (LLNL) completed an effort to expand its national emergency response modeling system for chemical releases. Key components of the new capability include the integration of (1) an extensive chemical property database, (2) source modeling for tanks and evaporating pools, (3) denser-than-air dispersion, (4) public exposure guidelines, and (5) an interactive graphical user interface (GUI). Recent use and the future of the new capability are also discussed.

  3. Tools and publications for reference decay data

    Energy Technology Data Exchange (ETDEWEB)

    Dulieu, C.; Be, M.M.; Chiste, V. [CEA Saclay, Lab. National Henri Becquerel (LNE-CEA/LNHB), 91 - Gif sur Yvette (France)

    2008-07-01

    As a primary laboratory in the field of ionizing radiation metrology, the LNE-CEA/LNHB is involved in measurement, evaluation and dissemination of radioactive decay data. Data measurements obtained by various laboratories are evaluated by an international group of experts (Decay Data Evaluation Project) in order to establish a set of recommended decay scheme data. Those data are subsequently distributed to users through various tools developed in our laboratory and well suited to each application domain. They are presented in an exhaustive and documented way through the publication of a multi-volume printed monograph (Monographie BIPM-5), for which a new issue has been released by the end of 2006. This monograph is recommended as a reference database by the CCRI (Ionizing Radiation Consultative Committee) of the BIPM. Those data can also be accessed via a specific software NUCLEIDE whose database contains more than 300 nuclides of particular interest. In the field of alpha and gamma spectrometry, a web application has been specially developed in order to present the major emissions of a given nuclide. Moreover, it allows us to find nuclides corresponding to search criteria on their emission energies or intensities. Finally a booklet version of this database will soon be published. It will present in a concise way the main alpha, X, gamma and electron emissions and their half-life, for some 250 nuclides. This paper intends to describe some features of these tools and publications. (authors)

  4. Prisoner reentry: a public health or public safety issue for social work practice?

    Science.gov (United States)

    Patterson, George T

    2013-01-01

    A significant literature identifies the policy, economic, health, and social challenges that confront released prisoners. This literature also describes the public health and public safety risks associated with prisoner reentry, provides recommendations for improving the reentry process, and describes the effectiveness of prison-based programs on recidivism rates. Public health and public safety risks are particularly significant in communities where large numbers of prisoners are released and few evidence-based services exist. The purpose of this article is to describe the public health and public safety risks that released prisoners experience when they reenter communities, and to discuss the social justice issues relevant for social work practice.

  5. Summary of Information and Resources Related to Energy Use in Healthcare Facilities - Version 1

    Energy Technology Data Exchange (ETDEWEB)

    Singer, Brett C.; Coughlin, Jennifer L.; Mathew, Paul A.

    2009-09-08

    This document presents the results of a review of publicly available information on energy use in health care facilities. The information contained in this document and in the sources cited herein provides the background and context for efforts to reduce energy use and costs in health care. Recognizing the breadth and diversity of relevant information, the author acknowledges that the report is likely not comprehensive. It is intended only to present a broad picture of what is currently known about health care energy use. This review was conducted as part of a 'High Performance Health Care Buildings' research study funded by the California Energy Commission. The study was motivated by the recognition that health care facilities collectively account for a substantial fraction of total commercial building energy use, due in large part to the very high energy intensity of hospitals and other inpatient care facilities. The goal of the study was to develop a roadmap of research, development and deployment (RD&D) needs for the health care industry. In addition to this information review, the road map development process included interviews with industry experts and a full-day workshop at LBNL in March 2009. This report is described as 'Version 1' with the intent that it will be expanded and updated as part of an ongoing LBNL program in healthcare energy efficiency. The document is being released in this form with the hope that it can assist others in finding and accessing the resources described within.

  6. The XMM-LSS catalogue: X-ray sources and associated multiwavelength data. Version II

    CERN Document Server

    Chiappetti, L; Pacaud, F; Pierre, M; Gueguen, A; Paioro, L; Polletta, M; Melnyk, O; Elyiv, A; Surdej, J; Faccioli, L

    2012-01-01

    We present the final release of the multi-wavelength XMM-LSS data set,covering the full survey area of 11.1 square degrees, with X-ray data processed with the latest XMM-LSS pipeline version. The present publication supersedes the Pierre et al.(2007) catalogue pertaining to the initial 5 square degrees. We provide X-ray source lists in the customary energy bands (0.5-2 and 2-10 keV) for a total of 6721 objects in the deep full-exposure catalogue and 5572 in the 10ks-limited one, above a detection likelihood of 15 in at least one band. We also provide a multiwavelength catalogue, cross-correlating our list with IR, NIR, optical and UV catalogues. Customary data products (X-ray FITS images, CFHTLS and SWIRE thumbnail images) are made available together with our interactively queriable database in Milan, while a static snapshot of the catalogues will be supplied to CDS, as soon as final acceptance is completed.

  7. XTALOPT Version r10: An open-source evolutionary algorithm for crystal structure prediction

    Science.gov (United States)

    Avery, Patrick; Falls, Zackary; Zurek, Eva

    2017-08-01

    A new version of XTALOPT, an evolutionary algorithm for crystal structure prediction, is available for download from the CPC library or the XTALOPT website, http://xtalopt.github.io. XTALOPT is published under the Gnu Public License (GPL), which is an open source license that is recognized by the Open Source Initiative. The new version incorporates many bug-fixes and new features, as detailed below.

  8. Toxics Release Inventory (TRI)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Toxics Release Inventory (TRI) is a dataset compiled by the U.S. Environmental Protection Agency (EPA). It contains information on the release and waste...

  9. The limits of mathematics alternative version

    CERN Document Server

    Chaitin, G J

    1994-01-01

    This is an alternative version of the course notes in chao-dyn/9407003. The previous version is based on measuring the size of lisp s-expressions. This version is based on measuring the size of what I call lisp m-expressions, which are lisp s-expressions with most parentheses omitted. This formulation of algorithmic information theory is harder to understand than the one that was presented in chao-dyn/9407003, but the constants obtained in all theorems are now less than half the size that they were before. It is not clear to me which version of algorithmic information theory is to be preferred.

  10. Modeling of Fission Gas Release in UO2

    Energy Technology Data Exchange (ETDEWEB)

    MH Krohn

    2006-01-23

    A two-stage gas release model was examined to determine if it could provide a physically realistic and accurate model for fission gas release under Prometheus conditions. The single-stage Booth model [1], which is often used to calculate fission gas release, is considered to be oversimplified and not representative of the mechanisms that occur during fission gas release. Two-stage gas release models require saturation at the grain boundaries before gas is release, leading to a time delay in release of gases generated in the fuel. Two versions of a two-stage model developed by Forsberg and Massih [2] were implemented using Mathcad [3]. The original Forsbers and Massih model [2] and a modified version of the Forsberg and Massih model that is used in a commercially available fuel performance code (FRAPCON-3) [4] were examined. After an examination of these models, it is apparent that without further development and validation neither of these models should be used to calculate fission gas release under Prometheus-type conditions. There is too much uncertainty in the input parameters used in the models. In addition. the data used to tune the modified Forsberg and Massih model (FRAPCON-3) was collected under commercial reactor conditions, which will have higher fission rates relative to Prometheus conditions [4].

  11. Public Values

    DEFF Research Database (Denmark)

    Beck Jørgensen, Torben; Rutgers, Mark R.

    2015-01-01

    administration is approached in terms of processes guided or restricted by public values and as public value creating: public management and public policy-making are both concerned with establishing, following and realizing public values. To study public values a broad perspective is needed. The article suggest......This article provides the introduction to a symposium on contemporary public values research. It is argued that the contribution to this symposium represent a Public Values Perspective, distinct from other specific lines of research that also use public value as a core concept. Public...... a research agenda for this encompasing kind of public values research. Finally the contributions to the symposium are introduced....

  12. Malicious release of radioactive materials in urban area. Exposure of the public and emergency staff, protective measures; Boeswillige Freisetzung radioaktiver Stoffe in urbanen Bereichen. Exposition von Bevoelkerung und Einsatzpersonal, Schutzmassnahmen

    Energy Technology Data Exchange (ETDEWEB)

    Koch, Wolfgang [Fraunhofer-Institut fuer Toxikologie und Experimentelle Medizin ITEM, Hannover (Germany). Bereich Aerosolforschung und Analytische Chemie; Lange, Florentin

    2016-07-01

    The preparedness for hypothetical radiological scenarios is part of the tasks for governmental authorities, safety and emergency organizations and the staff in case of the incident. The EURATOM guideline for radiation protection has to be implemented into national laws. According to the guidelines it is required that emergency planning has to be prepared for hypothetical radiological scenarios including terroristic or other maliciously motivated attacks using radioactive materials. The study includes assumptions on the released respirable radioactivity, restriction of the hazardous area, wind induced re-suspension of radioactive dusts and inhalation exposure, and mitigation measures.

  13. ELECTROMAGNETIC RELEASE MECHANISM

    Science.gov (United States)

    Michelson, C.

    1960-09-13

    An electromagnetic release mechanism is offered that may be used, for example, for supporting a safety rod for a nuclear reactor. The release mechanism is designed to have a large excess holding force and a rapid, uniform, and dependable release. The fast release is accomplished by providing the electromagnet with slotttd polts separated by an insulating potting resin, and by constructing the poles with a ferro-nickel alloy. The combination of these two features materially reduces the eddy current power density whenever the magnetic field changes during a release operation. In addition to these features, the design of the armature is such as to provide ready entrance of fluid into any void that might tend to form during release of the armature. This also improves the release time for the mechanism. The large holding force for the mechanism is accomplished by providing a small, selected, uniform air gap between the inner pole piece and the armature.

  14. AF-GEOSpace Version 2.5: Space Environment Software

    Science.gov (United States)

    Hilmer, R. V.; Hall, T.; Roth, C.; Ling, A.; Ginet, G. P.; Madden, D.

    2010-12-01

    AF-GEOSpace is a graphics-intensive software program with space environment models and applications developed by the Space Weather Center of Excellence at AFRL. The software addresses a wide range of physical domains, e.g., solar disturbance propagation, geomagnetic field and radiation belt configurations, auroral particle precipitation, and ionospheric scintillation. AF-GEOSpace has become a platform for developing and prototyping space weather visualization products. The new AF-GEOSpace Version 2.5 (release scheduled for 2010) expands on the content of Version 2.1 by including modules addressing the following new topics: (1) energetic proton maps for the South Atlantic Anomaly (from Ginet et al. [2007]), (2) GPS scintillation outage simulation tools, (3) magnetopause location determination (Shue et al. [1998]), (4) a plasmasphere model (Global Core Plasma Model, 2009 version based on Gallagher et al. [2000]), (5) a standard ionospheric model (International Reference Ionosphere 2007), (6) the CAMMICE/MICS model of inner magnetosphere plasma population (based on Roeder et al. [2005]), (7) magnetic field models (e.g., Tsyganenko and Sitnov [2005]), and (8) loading and displaying externally-produced 3D gridded data sets within AF-GEOSpace. Improvements to existing Version 2.1 capabilities include: (1) a 2005 update to the geomagnetic cutoff rigidity model of Smart and Shea [2003], (2) a 2005 update to the ionospheric scintillation Wide-Band Model (WBMOD) of Secan and Bussey [1994], and (3) improved magnetic field flux mapping options for the existing set of AF-GEOSpace radiation belt models. A basic review of these new AF-GEOSpace capabilities will be provided. To obtain a copy of the software, please contact the first author.

  15. Medhost: An encyclopedic bibliography of the host plants of the Mediterranean fruit fly, Ceratitis capitata (Wiedemann),Version 2.0

    Science.gov (United States)

    MEDHOST,Version 2.0 is the second revision of:"MEDHOST: An encyclopedic bibliography of the host plants of the Mediterranean fruit fly,Ceratitis capitata(Wiedemann),Version 1.0," which was released in 1998 as a Windows-based executable database and listed all plant species reported as hosts of Medit...

  16. Global Historical Climatology Network - Daily (GHCN-Daily), Version 2 (Version Superseded)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Please note, this dataset has been superseded by a newer version (see below). Users should not use this version except in rare cases (e.g., when reproducing previous...

  17. Senate Republican leadership releases revised ACA repeal and replace bill

    Directory of Open Access Journals (Sweden)

    Moore NS

    2017-07-01

    Full Text Available No abstract available. Article truncated after first 150 words. Today, the Senate Republican leadership released a revised version of a bill to repeal and replace the Affordable Care Act (ACA. The new bill draft includes an amendment sponsored by Sen. Cruz (R-TX that permits insurers to offer health insurance plans on the ACA exchanges that do not cover the ACA’s 10 essential health benefits (EHB as long as they offer at least one other plan that provides full coverage of EHB’s. The bill also includes more funding for opioid addiction and for state initiatives to reduce insurance premiums and additionally, some flexibility for state Medicaid funding in the event of a public health crisis. The bill must still receive a cost estimate from the Congressional Budget Office (CBO, which will include the impact of the bill on insurance coverage levels, expected out Monday. The ATS remains deeply concerned about the bill because under the Cruz proposal, insurance coverage costs …

  18. TAE+ 5.1 - TRANSPORTABLE APPLICATIONS ENVIRONMENT PLUS, VERSION 5.1 (SUN3 VERSION)

    Science.gov (United States)

    TAE SUPPORT OFFICE

    1994-01-01

    workbench-generated resource files during each execution, details such as color, font, location, and object type remain independent from the application code, allowing changes to the user interface without recompiling and relinking. The Silicon Graphics version of TAE Plus now has a font caching scheme and a color caching scheme to make color allocation more efficient. In addition to WPTs, TAE Plus can control interaction of objects from the interpreted TAE Command Language. TCL provides an extremely powerful means for the more experienced developer to quickly prototype an application's use of TAE Plus interaction objects and add programming logic without the overhead of compiling or linking. TAE Plus requires MIT's X Window System, Version 11 Release 4, and the Open Software Foundation's Motif Toolkit 1.1 or 1.1.1. The Workbench and WPTs are written in C++ and the remaining code is written in C. TAE Plus is available by license for an unlimited time period. The licensed program product includes the TAE Plus source code and one set of supporting documentation. Additional documentation may be purchased separately at the price indicated below. The amount of disk space required to load the TAE Plus tar format tape is between 35Mb and 67Mb depending on the machine version. The recommended minimum memory is 12Mb. Each TAE Plus platform delivery tape includes pre-built libraries and executable binary code for that particular machine, as well as source code, so users do not have to do an installation. Users wishing to recompile the source will need both a C compiler and either GNU's C++ Version 1.39 or later, or a C++ compiler based on AT&T 2.0 cfront. TAE Plus comes with InterViews and idraw, two software packages developed by Stanford University and integrated in TAE Plus. TAE Plus was developed in 1989 and version 5.1 was released in 1991. TAE Plus is currently available on media suitable for eight different machine platforms: 1) DEC VAX computers running VMS 5.3 or higher (TK

  19. TAE+ 5.1 - TRANSPORTABLE APPLICATIONS ENVIRONMENT PLUS, VERSION 5.1 (DEC VAX ULTRIX VERSION)

    Science.gov (United States)

    TAE SUPPORT OFFICE

    1994-01-01

    workbench-generated resource files during each execution, details such as color, font, location, and object type remain independent from the application code, allowing changes to the user interface without recompiling and relinking. The Silicon Graphics version of TAE Plus now has a font caching scheme and a color caching scheme to make color allocation more efficient. In addition to WPTs, TAE Plus can control interaction of objects from the interpreted TAE Command Language. TCL provides an extremely powerful means for the more experienced developer to quickly prototype an application's use of TAE Plus interaction objects and add programming logic without the overhead of compiling or linking. TAE Plus requires MIT's X Window System, Version 11 Release 4, and the Open Software Foundation's Motif Toolkit 1.1 or 1.1.1. The Workbench and WPTs are written in C++ and the remaining code is written in C. TAE Plus is available by license for an unlimited time period. The licensed program product includes the TAE Plus source code and one set of supporting documentation. Additional documentation may be purchased separately at the price indicated below. The amount of disk space required to load the TAE Plus tar format tape is between 35Mb and 67Mb depending on the machine version. The recommended minimum memory is 12Mb. Each TAE Plus platform delivery tape includes pre-built libraries and executable binary code for that particular machine, as well as source code, so users do not have to do an installation. Users wishing to recompile the source will need both a C compiler and either GNU's C++ Version 1.39 or later, or a C++ compiler based on AT&T 2.0 cfront. TAE Plus comes with InterViews and idraw, two software packages developed by Stanford University and integrated in TAE Plus. TAE Plus was developed in 1989 and version 5.1 was released in 1991. TAE Plus is currently available on media suitable for eight different machine platforms: 1) DEC VAX computers running VMS 5.3 or higher (TK

  20. Development of environmental dose assessment system (EDAS) code of PC version

    CERN Document Server

    Taki, M; Kobayashi, H; Yamaguchi, T

    2003-01-01

    A computer code (EDAS) was developed to assess the public dose for the safety assessment to get the license of nuclear reactor operation. This code system is used for the safety analysis of public around the nuclear reactor in normal operation and severe accident. This code was revised and composed for personal computer user according to the Nuclear Safety Guidelines reflected the ICRP1990 recommendation. These guidelines are revised by Nuclear Safety Commission on March, 2001, which are 'Weather analysis guideline for the safety assessment of nuclear power reactor', 'Public dose around the facility assessment guideline corresponding to the objective value for nuclear power light water reactor' and 'Public dose assessment guideline for safety review of nuclear power light water reactor'. This code has been already opened for public user by JAERI, and English version code and user manual are also prepared. This English version code is helpful for international cooperation concerning the nuclear safety assessme...

  1. The new 2013 seventh version of the Declaration of Helsinki--more old wine in a new bottle?

    Science.gov (United States)

    Muthuswamy, Vasantha

    2014-01-01

    The eagerly awaited seventh version of the Declaration of Helsinki (DoH) was released by the World Medical Assembly (WMA) on October 19, 2013 at the 64th General Assembly. It has been 13 years since the most debated version of the DoH, the fifth one, was released in 2000, followed by two related notifications in 2002 and 2004 and the less debated sixth version of 2008. The decade following the fifth version has witnessed many conceptual changes and debates all over the world. Of special note is the fact that most research participants are drawn from the developing countries and are considered to have a higher degree of vulnerability than their counterparts in the developed countries. Since 2000, a landmark year from many perspectives, national and international ethical guidelines have been updated or new ones developed to address the current and emerging issues facing the research community.

  2. EIA new releases, November--December 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-09

    Thus publication contains information compiled by the Energy information administration (EIA) on the following topics: heating fuel supplies; alternative fuel vehicles; natural gas production; clean air laws and coal transportation; EIA`s world Wide Web Site; EIA`s CD-ROM; Press Releases; Microfiched products; electronic publishing; new reports; machine-readable files; how to order EIA publications; and Energy Data Information Contracts.

  3. Texts in multiple versions: histories of editions

    NARCIS (Netherlands)

    Giuliani, L.; Brinkman, H.; Lernout, G.; Mathijsen, M.

    2006-01-01

    Texts in multiple versions constitute the core problem of textual scholarship. For texts from antiquity and the medieval period, the many versions may be the result of manuscript transmission, requiring editors and readers to discriminate between levels of authority in variant readings produced

  4. Schema Versioning for Multitemporal Relational Databases.

    Science.gov (United States)

    De Castro, Cristina; Grandi, Fabio; Scalas, Maria Rita

    1997-01-01

    Investigates new design options for extended schema versioning support for multitemporal relational databases. Discusses the improved functionalities they may provide. Outlines options and basic motivations for the new design solutions, as well as techniques for the management of proposed schema versioning solutions, includes algorithms and…

  5. Distributed Version Control and Library Metadata

    Directory of Open Access Journals (Sweden)

    Galen M. Charlton

    2008-06-01

    Full Text Available Distributed version control systems (DVCSs are effective tools for managing source code and other artifacts produced by software projects with multiple contributors. This article describes DVCSs and compares them with traditional centralized version control systems, then describes extending the DVCS model to improve the exchange of library metadata.

  6. UPGRADES TO Monteburns, VERSION 3.0

    Energy Technology Data Exchange (ETDEWEB)

    Galloway, Jack D [Los Alamos National Laboratory; Trellue, Holly R [Los Alamos National Laboratory

    2012-06-22

    Monteburns VERSION 3.0 is an upgrade of the existing Monteburns code available through RSICC. The new version includes modern programming style, increased parallel computing, more accurate capture gamma calculations and an automated input generator. This capability was demonstrated through a small PWR core simulation.

  7. Texts in multiple versions: histories of editions

    NARCIS (Netherlands)

    L. Giuliani; H. Brinkman; G. Lernout; M. Mathijsen

    2006-01-01

    Texts in multiple versions constitute the core problem of textual scholarship. For texts from antiquity and the medieval period, the many versions may be the result of manuscript transmission, requiring editors and readers to discriminate between levels of authority in variant readings produced alon

  8. Herwig++ 2.7 release note

    Energy Technology Data Exchange (ETDEWEB)

    Bellm, J.; Gieseke, S. [Karlsruher Institut fuer Technologie, Karlsruhe (Germany). Inst. fuer Theoretische Physik; Grellscheid, D. [IPPP, Durham (United Kingdom). Dept. of Physics] [and others

    2013-10-15

    A new release of the Monte Carlo event generator Herwig++ (version 2.7) is now available. This version comes with a number of improvements including: an interface to the Universal FeynRules Output (UFO) format allowing the simulation of a wide range of new-physics models; developments of the Matchbox framework for next-to-leading order (NLO) simulations; better treatment of QCD radiation in heavy particle decays in new-physics models; a new tune of underlying event and colour connection parameters that allows a good simultaneous description of both Tevatron and LHC underlying event data and the effective cross-section parameter for double-parton scattering parameter {sigma}{sub eff}.

  9. Public Relations in Special Libraries.

    Science.gov (United States)

    Rutkowski, Hollace Ann; And Others

    1991-01-01

    This theme issue includes 11 articles on public relations (PR) in special libraries. Highlights include PR at the Special Libraries Association (SLA); sources for marketing research for libraries; developing a library image; sample PR releases; brand strategies for libraries; case studies; publicizing a consortium; and a bibliography of pertinent…

  10. Publication of the bulletin

    CERN Multimedia

    2007-01-01

    The final edition (Nos 51-52/2007 and 1-2-3/2008) of the last Bulletin of the year will appear on Friday 14 December and will cover events at CERN from 17 December 2007 to 18 January 2008. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate, by noon on Tuesday 11 December. The table below lists the 2008 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin publication 2008 Bulletin N° 4-5 Publication: Monday 21 january Submission deadline for announcements: Tuesday 15 January Bulletin N° 6-7 Publication: Monday 4 february Submission deadline for announcements: Tuesday 29 January Bulletin N° 8-9 Publication: Monday 18 february Submission deadline for announcements: Tuesday 12 February Bulletin N° 10-11 P...

  11. CLIPS - C LANGUAGE INTEGRATED PRODUCTION SYSTEM (IBM PC VERSION WITH CLIPSITS)

    Science.gov (United States)

    Riley, , .

    1994-01-01

    version each contain a windowing variant of CLIPS as well as the standard line oriented version. The mouse/window interface version for the PC works with a Microsoft compatible mouse or without a mouse. This window version uses the proprietary CURSES library for the PC, but a working executable of the window version is provided. The window oriented version for the Macintosh includes a version which uses a full Macintosh-style interface, including an integrated editor. This version allows the user to observe the changing fact base and rule activations in separate windows while a CLIPS program is executing. The IBM PC version is available bundled with CLIPSITS, The CLIPS Intelligent Tutoring System for a special combined price (COS-10025). The goal of CLIPSITS is to provide the student with a tool to practice the syntax and concepts covered in the CLIPS User's Guide. It attempts to provide expert diagnosis and advice during problem solving which is typically not available without an instructor. CLIPSITS is divided into 10 lessons which mirror the first 10 chapters of the CLIPS User's Guide. The program was developed for the IBM PC series with a hard disk. CLIPSITS is also available separately as MSC-21679. The CLIPS program is written in C for interactive execution and has been implemented on an IBM PC computer operating under DOS, a Macintosh and DEC VAX series computers operating under VMS or ULTRIX. The line oriented version should run on any computer system which supports a full (Kernighan and Ritchie) C compiler or the ANSI standard C language. CLIPS was developed in 1986 and Version 4.2 was released in July of 1988. Version 4.3 was released in June of 1989.

  12. CERN Permanent exhibitions short version

    CERN Multimedia

    2016-01-01

    Visits Explore by yourself the issues CERN's physicists are trying to solve: given that the entire universe is made of particles, where do they come from? Why do they behave in the way they do? Discover the massive apparatus used by physicists at CERN, like the LHC, and see how each part works. CERN invites the public to discover the mysteries of the Universe and the work of the world's biggest physics laboratory through free of charge guided tours and permanent exhibitions. As a group, with friends, individually, on foot, on your bike, come and discover CERN or explore it virtually. Welcome!

  13. Identification of the growth hormone-releasing hormone analogue [Pro1, Val14]-hGHRH with an incomplete C-term amidation in a confiscated product.

    Science.gov (United States)

    Esposito, Simone; Deventer, Koen; Van Eenoo, Peter

    2014-01-01

    In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investigation of the product suggests also an incomplete C-term amidation. Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance-enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well.

  14. The Basic Public Finance of Public-Private Partnerships

    OpenAIRE

    Engel, Eduardo M. R. A.; Fischer, Ronald D.; Galetovic, Alexander

    2007-01-01

    Public-private partnerships (PPPs) have been justified because they release public funds or save on distortionary taxes. However, the resources saved by a government that does not finance the upfront investment are offset by giving up future revenue flows to the concessionaire. If a PPP can be justified on efficiency grounds, the PPP contract that optimally balances demand risk, userfee distortions and the opportunity cost of public funds has a minimum revenue guarantee and a revenue cap. The...

  15. The Basic Public Finance of Public-Private Partnerships

    OpenAIRE

    Eduardo M.R.A. Engel; Ronald D. Fischer; Galetovic, Alexander

    2007-01-01

    Public-private partnerships (PPPs) have been justified because they release public funds or save on distortionary taxes. However, the resources saved by a government that does not finance the upfront investment are offset by giving up future revenue flows to the concessionaire. If a PPP can be justified on efficiency grounds, the PPP contract that optimally balances demand risk, userfee distortions and the opportunity cost of public funds has a minimum revenue guarantee and a revenue cap. The...

  16. Why Should We Care What the Public Thinks?

    DEFF Research Database (Denmark)

    Thomsen, Frej Klem

    2014-01-01

    This chapter explores three versions of the argument to the effect that we ought to punish in accordance with popular sentiment: While the first two versions of the argument are rejected, it is held that the third argument may provide a reason in favour of incorporating public opinion.......This chapter explores three versions of the argument to the effect that we ought to punish in accordance with popular sentiment: While the first two versions of the argument are rejected, it is held that the third argument may provide a reason in favour of incorporating public opinion....

  17. Tritium release during nuclear power operation in China.

    Science.gov (United States)

    Yang, D J; Chen, X Q; Li, B

    2012-06-01

    Overviews were evaluated of tritium releases and related doses to the public from airborne and liquid effluents from nuclear power plants on the mainland of China before 2009. The differences between tritium releases from various nuclear power plants were also evaluated. The tritium releases are mainly from liquid pathways for pressurised water reactors, but tritium releases between airborne and liquid effluents are comparable for heavy water reactors. The airborne release from a heavy water reactor is obviously higher than that from a pressurised water reactor.

  18. Release the Body, Release the Mind.

    Science.gov (United States)

    Stoner, Martha Goff

    1998-01-01

    A college English teacher describes the anxiety and resentment of students during in-class writing assignments and the successful classroom use of meditation and body movement. Movement seemed to relax the students, change their attitudes, and release their creative impulses to write. Implications related to the body-mind connection are pondered.…

  19. UNICOS Evolution: CPC Version 6

    CERN Document Server

    Blanco Vinuela, E; Bradu, B; Durand, Ph; Fernandez Adiego, B; Izquierdo Rosas, S; Merezhin, A; Ortola Vidal, J; Rochez, J; Willeman, D

    2011-01-01

    The UNICOS (UNified Industrial COntrol System) framework was created back in 1998. Since then a noticeable number of applications in different domains have used this framework. Furthermore UNICOS has been formalized and its supervision layer has been reused in other kinds of applications (e.g. monitoring or supervisory tasks) where a control layer is not necessarily UNICOS oriented. The process control package has been reformulated as the UNICOS CPC package (Continuous Process Control) and a reengineering process has been followed. The drive behind these noticeable changes was (1) being able to upgrade to the new more performing IT technologies in the automatic code generation, (2) being flexible enough to create new additional device types to cope with other needs (e.g. Vacuum or Cooling and Ventilation applications) without major impact on the framework or the PLC code baselines and (3) enhance the framework with new functionalities (e.g. recipes). This publication addresses the motivation, changes, new fun...

  20. The PASTEL catalogue: 2016 version

    CERN Document Server

    Soubiran, Caroline; Brouillet, Nathalie; Chemin, Laurent

    2016-01-01

    The bibliographical compilation of stellar atmospheric parameters (Teff, logg, [Fe/H]) relying on high-resolution, high signal-to-noise spectroscopy started in the eighties with the so-called [Fe/H] catalogue, and was continued in 2010 with the PASTEL catalogue, which also includes determinations of Teff alone, based on various methods. Here we present an update of the PASTEL catalogue. The main journals and the CDS database have been surveyed to find relevant publications presenting new determinations of atmospheric parameters. As of February 2016, PASTEL includes 64082 determinations of either Teff or (Teff, logg, [Fe/H]) for 31401 stars, corresponding to 1142 bibliographical references. Some 11197 stars have a determination of the three parameters (Teff, logg, [Fe/H]) with a high-quality spectroscopic metallicity.

  1. The PASTEL catalogue: 2016 version

    Science.gov (United States)

    Soubiran, Caroline; Le Campion, Jean-François; Brouillet, Nathalie; Chemin, Laurent

    2016-06-01

    The bibliographical compilation of stellar atmospheric parameters (Teff, log g, [Fe/H]) relying on high-resolution, high signal-to-noise spectroscopy started in the eighties with the so-called [Fe/H] catalogue, and was continued in 2010 with the PASTEL catalogue, which also includes determinations of Teff alone, based on various methods. Here we present an update of the PASTEL catalogue. The main journals and the CDS database have been surveyed to find relevant publications presenting new determinations of atmospheric parameters. As of February 2016, PASTEL includes 64 082 determinations of either Teff or (Teff, log g, [Fe/H]) for 31 401 stars, corresponding to 1142 bibliographical references. Some 11 197 stars have a determination of the three parameters (Teff, log g, [Fe/H]) with a high-quality spectroscopic metallicity. The PASTEL catalogue is available in electronic form at the CDS (http://vizier.u-strasbg.fr/viz-bin/VizieR?-source=B/pastel).

  2. The limits of mathematics third version

    CERN Document Server

    Chaitin, G J

    1994-01-01

    This is yet another version of the course notes in chao-dyn/9407003. Here we change the universal Turing machine that is used to measure program-size complexity so that the constants in our information-theoretic incompleteness theorems are further reduced. This is done by inventing a more complicated version of lisp in which the parentheses associating defined functions with their arguments can be omitted. This is the third and last version of my course notes. It is not clear to me which is to be preferred, so all three have been made available for comment.

  3. Public lighting.

    NARCIS (Netherlands)

    Schreuder, D.A.

    1986-01-01

    The function of public lighting and the relationship between public lighting and accidents are considered briefly as aspects of effective countermeasures. Research needs and recent developments in installation and operational described. Public lighting is an efficient accident countermeasure, but

  4. USGS library for S-PLUS for Windows -- Release 4.0

    Science.gov (United States)

    Lorenz, David L.; Ahearn, Elizabeth A.; Carter, Janet M.; Cohn, Timothy A.; Danchuk, Wendy J.; Frey, Jeffrey W.; Helsel, Dennis R.; Lee, Kathy E.; Leeth, David C.; Martin, Jeffrey D.; McGuire, Virginia L.; Neitzert, Kathleen M.; Robertson, Dale M.; Slack, James R.; Starn, J. Jeffrey; Vecchia, Aldo V.; Wilkison, Donald H.; Williamson, Joyce E.

    2011-01-01

    Release 4.0 of the U.S. Geological Survey S-PLUS library supercedes release 2.1. It comprises functions, dialogs, and datasets used in the U.S. Geological Survey for the analysis of water-resources data. This version does not contain ESTREND, which was in version 2.1. See Release 2.1 for information and access to that version. This library requires Release 8.1 or later of S-PLUS for Windows. S-PLUS is a commercial statistical and graphical analysis software package produced by TIBCO corporation(http://www.tibco.com/). The USGS library is not supported by TIBCO or its technical support staff.

  5. The Moab Design for Digital Object Versioning

    Directory of Open Access Journals (Sweden)

    Richard Anderson

    2013-07-01

    Full Text Available The Stanford Digital Repository has adopted the "Moab" design for versioned archiving of digital objects--a locally developed approach that optimizes data transfer, storage, and replication while providing efficient single file retrieval or full object reconstruction for any version of an object. This paper includes a review of various versioning strategies including forward-delta, reverse-delta and content-addressable mechanisms, the pro's and cons of each, and highlights the relative advantages of the Moab design. In our approach, the fixity information of a file manifestation is used as its primary identifier and the filename is treated as metadata. Storage and retrieval of an object's files is faciliated by mapping between a virtual version inventory and the physical location via a file signature catalog.

  6. The radial velocity experiment (RAVE) : Fourth data release

    NARCIS (Netherlands)

    Kordopatis, G.; Gilmore, G.; Steinmetz, M.; Boeche, C.; Seabroke, G. M.; Siebert, A.; Zwitter, T.; Binney, J.; de Laverny, P.; Recio-Blanco, A.; Williams, M. E. K.; Piffl, T.; Enke, H.; Roeser, S.; Bijaoui, A.; Wyse, R. F. G.; Freeman, K.; Munari, U.; Carrillo, I.; Anguiano, B.; Burton, D.; Campbell, R.; Cass, C. J. P.; Fiegert, K.; Hartley, M.; Parker, Q. A.; Reid, W.; Ritter, A.; Russell, K. S.; Stupar, M.; Watson, F. G.; Bienayme, O.; Bland-Hawthorn, J.; Gerhard, O.; Gibson, B. K.; Grebel, E. K.; Helmi, A.; Navarro, J. F.; Conrad, C.; Famaey, B.; Faure, C.; Just, A.; Kos, J.; Matijevic, G.; McMillan, P. J.; Minchev, I.; Scholz, R.; Sharma, S.; Siviero, A.; de Boer, E. Wylie; Zerjal, M.

    2013-01-01

    We present the stellar atmospheric parameters (effective temperature, surface gravity, overall metallicity), radial velocities, individual abundances, and distances determined for 425,561 stars, which constitute the fourth public data release of the RAdial Velocity Experiment (RAVE). The stellar atm

  7. The Radial Velocity Experiment (RAVE): Fourth Data Release

    NARCIS (Netherlands)

    Kordopatis, G.; Gilmore, G.; Steinmetz, M.; Boeche, C.; Seabroke, G. M.; Siebert, A.; Zwitter, T.; Binney, J.; de Laverny, P.; Recio-Blanco, A.; Williams, M. E. K.; Piffl, T.; Enke, H.; Roeser, S.; Bijaoui, A.; Wyse, R. F. G.; Freeman, K.; Munari, U.; Carrillo, I.; Anguiano, B.; Burton, D.; Campbell, R.; Cass, C. J. P.; Fiegert, K.; Hartley, M.; Parker, Q. A.; Reid, W.; Ritter, A.; Russell, K. S.; Stupar, M.; Watson, F. G.; Bienaymé, O.; Bland-Hawthorn, J.; Gerhard, O.; Gibson, B. K.; Grebel, E. K.; Helmi, A.; Navarro, J. F.; Conrad, C.; Famaey, B.; Faure, C.; Just, A.; Kos, J.; Matijevič, G.; McMillan, P. J.; Minchev, I.; Scholz, R.; Sharma, S.; Siviero, A.; de Boer, E. Wylie; Žerjal, M.

    2013-01-01

    We present the stellar atmospheric parameters (effective temperature, surface gravity, overall metallicity), radial velocities, individual abundances, and distances determined for 425,561 stars, which constitute the fourth public data release of the RAdial Velocity Experiment (RAVE). The stellar atm

  8. Improving the user experience of patient versions of clinical guidelines: user testing of a Scottish Intercollegiate Guideline Network (SIGN) patient version.

    Science.gov (United States)

    Fearns, Naomi; Graham, Karen; Johnston, Gordon; Service, Duncan

    2016-02-02

    Guideline producers are increasingly producing versions of guidelines for the public, and knowledge of what the public want from them is also increasing. The aim of this study was to user test a patient version of a SIGN clinical guideline that was designed based on preliminary work for the DECIDE project. SIGN is the leading national guideline producer in Scotland. People with a diagnosis of glaucoma and non-professional carers were recruited from across Scotland. User testing was conducted using a think-aloud protocol method. Each session was conducted by one interviewer and one observer. All sessions were recorded and transcribed. The data was analysed, problems with the guideline were identified and resolved and key findings were themed using a user experience model. Thirteen user testing sessions with people with glaucoma and one with a carer were conducted. Key facilitators of desirability and usability identified include clear branding as a patient version and a clearly described purpose, audience and contents page. Other facilitators include a "friendly" tone which is achieved by the use of colour, quotes, icons, simple language and charts, and brief chunked text. The value and usefulness of the patient guideline was influenced by its ability to: inform the public, link information to actions, and empower people in their interaction with healthcare professionals. Participants were disappointed by the lack of information on treatment in the patient version, which was outside its scope. Information on the evidence based guideline production process and the involvement of appropriately skilled professionals was key to the credibility of the guideline. Lack of awareness of guidelines and guideline producing bodies, is a potentially serious threat to findability/accessibility. It is important for guideline producers to maximise the user experience of the public when they access patient versions of guidelines, particularly given the current low level of access

  9. A kernel version of multivariate alteration detection

    DEFF Research Database (Denmark)

    Nielsen, Allan Aasbjerg; Vestergaard, Jacob Schack

    2013-01-01

    Based on the established methods kernel canonical correlation analysis and multivariate alteration detection we introduce a kernel version of multivariate alteration detection. A case study with SPOT HRV data shows that the kMAD variates focus on extreme change observations.......Based on the established methods kernel canonical correlation analysis and multivariate alteration detection we introduce a kernel version of multivariate alteration detection. A case study with SPOT HRV data shows that the kMAD variates focus on extreme change observations....

  10. Ecodesign Directive version 2.0

    DEFF Research Database (Denmark)

    This present report reports on the main findings of the project Ecodesign Directive version 2.0 - from Energy Efficiency to Resource Efficiency. The project is financed by the Danish Environmental Protection Agency and ran from December 2012 to June 2014.......This present report reports on the main findings of the project Ecodesign Directive version 2.0 - from Energy Efficiency to Resource Efficiency. The project is financed by the Danish Environmental Protection Agency and ran from December 2012 to June 2014....

  11. Cubical version of combinatorial differential forms

    DEFF Research Database (Denmark)

    Kock, Anders

    2010-01-01

    The theory of combinatorial differential forms is usually presented in simplicial terms. We present here a cubical version; it depends on the possibility of forming affine combinations of mutual neighbour points in a manifold, in the context of synthetic differential geometry.......The theory of combinatorial differential forms is usually presented in simplicial terms. We present here a cubical version; it depends on the possibility of forming affine combinations of mutual neighbour points in a manifold, in the context of synthetic differential geometry....

  12. PCATool-ADULT-BRAZIL: a reduced version

    Directory of Open Access Journals (Sweden)

    Mônica Maria Celestina de Oliveira

    2013-09-01

    Full Text Available The reorganization of the Brazilian health system brings the need for on-going evaluation of the services offered to the population. The Primary Care Assessment Tool (PCATool-Brazil version for adult users, validated for the Brazilian context, adequately measures the presence and extent of attributes of primary health care (PHC services. A reduced version of this instrument is required to optimize the process of implementation and use of the results in strategic actions. This article aims to present a reduced version of the PCATool-Brazil for adult users and analyze its suitability. The instrument was applied to 2404 adult residents of areas covered by primary health care (PHC units in Porto Alegre, Rio Grande do Sul state. By the two-parameter logistic model of Item Response Theory (ML-2, 23 items that presented discrimination classified as moderate to strong, contemplating the seven attributes of PHC, were selected. As a measure of consistency, the results obtained with this version were compared with the complete version, revealing consistent PHC scores. These findings indicate that the PCATool-Brazil reduced version for adult users presents adequate validity and reliability, and it can be adopted as a rapid assessment tool to evaluate PHC in Brazilian services, permitting decision making guided by evidence in the development of actions to improve the quality of care offered to the population.

  13. CBP TOOLBOX VERSION 2.0: CODE INTEGRATION ENHANCEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Smith, F.; Flach, G.; BROWN, K.

    2013-06-01

    This report describes enhancements made to code integration aspects of the Cementitious Barriers Project (CBP) Toolbox as a result of development work performed at the Savannah River National Laboratory (SRNL) in collaboration with Vanderbilt University (VU) in the first half of fiscal year 2013. Code integration refers to the interfacing to standalone CBP partner codes, used to analyze the performance of cementitious materials, with the CBP Software Toolbox. The most significant enhancements are: 1) Improved graphical display of model results. 2) Improved error analysis and reporting. 3) Increase in the default maximum model mesh size from 301 to 501 nodes. 4) The ability to set the LeachXS/Orchestra simulation times through the GoldSim interface. These code interface enhancements have been included in a new release (Version 2.0) of the CBP Toolbox.

  14. Selling a Story: How to Write a Successful Press Release

    Science.gov (United States)

    Pearson, E.

    2016-12-01

    Press releases are an important part of communicating new discoveries with the general public. However, if they are confusing or difficult to read then they are unlikely to be picked up by media outlets. This article details how to create a successful press release by addressing a series of points: learning how to identify the audience; writing text that is both eye catching and clear; including multimedia and contact details; getting your press release to the media; and timing.

  15. Version 3.0 of EMINERS - Economic Mineral Resource Simulator

    Science.gov (United States)

    Duval, Joseph S.

    2012-01-01

    Quantitative mineral resource assessment, as developed by the U.S. Geological Survey (USGS), consists of three parts: (1) development of grade and tonnage mineral deposit models; (2) delineation of tracts permissive for each deposit type; and (3) probabilistic estimation of the numbers of undiscovered deposits for each deposit type. The estimate of the number of undiscovered deposits at different levels of probability is the input to the EMINERS (Economic Mineral Resource Simulator) program. EMINERS uses a Monte Carlo statistical process to combine probabilistic estimates of undiscovered mineral deposits with models of mineral deposit grade and tonnage to estimate mineral resources. Version 3.0 of the EMINERS program is available as this USGS Open-File Report 2004-1344. Changes from version 2.0 include updating 87 grade and tonnage models, designing new templates to produce graphs showing cumulative distribution and summary tables, and disabling economic filters. The economic filters were disabled because embedded data for costs of labor and materials, mining techniques, and beneficiation methods are out of date. However, the cost algorithms used in the disabled economic filters are still in the program and available for reference for mining methods and milling techniques. The release notes included with this report give more details on changes in EMINERS over the years. EMINERS is written in C++ and depends upon the Microsoft Visual C++ 6.0 programming environment. The code depends heavily on the use of Microsoft Foundation Classes (MFC) for implementation of the Windows interface. The program works only on Microsoft Windows XP or newer personal computers. It does not work on Macintosh computers. For help in using the program in this report, see the "Quick-Start Guide for Version 3.0 of EMINERS-Economic Mineral Resource Simulator" (W.J. Bawiec and G.T. Spanski, 2012, USGS Open-File Report 2009-1057, linked at right). It demonstrates how to execute EMINERS software

  16. 78 FR 53184 - Land Release for Penn Yan Airport

    Science.gov (United States)

    2013-08-28

    ... Federal Aviation Administration Land Release for Penn Yan Airport AGENCY: Federal Aviation Administration... requesting public comment on the Penn Yan Airport (PEO), Penn Yan, New York, Notice of Proposed Release from Aeronautical Use of approximately 0.069 +/- acres of airport property, to allow for...

  17. 77 FR 12905 - Land Release for Penn Yan Airport

    Science.gov (United States)

    2012-03-02

    ... Federal Aviation Administration Land Release for Penn Yan Airport AGENCY: Federal Aviation Administration... requesting public comment on the Penn Yan Airport (PEO), Penn Yan, New York, Notice of Proposed Release from Aeronautical Use of approximately 10.00 +/- acres of airport property, to allow for...

  18. 77 FR 27272 - Land Release for Dunkirk Airport

    Science.gov (United States)

    2012-05-09

    ... Federal Aviation Administration Land Release for Dunkirk Airport AGENCY: Federal Aviation Administration... requesting public comment on the Dunkirk Airport (DKK), Dunkirk, New York, Notice of Proposed Release from Aeronautical Use of approximately 2.666 +/- acres of airport property, to allow for...

  19. On the barriers for local government releasing open data

    NARCIS (Netherlands)

    Conradie, P.; Choenni, R.

    2014-01-01

    Due to expected benefits such as citizen participation and innovation, the release of Public Sector Information as open data is getting increased attention on various levels of government. However, currently data release by governments is still novel and there is little experience and knowledge thus

  20. Validation of the dutch version of the CDC core healthy days measures in a community sample

    NARCIS (Netherlands)

    J. Toet (Jaap); H. Raat (Hein); E.J.C. van Ameijden (E. J C)

    2006-01-01

    textabstractAn important disadvantage of most indicators of health related quality of life used in public health surveillance is their length. In this study the authors investigated the reliability and validity of a short indicator of health related quality of life, the Dutch version of the four

  1. Assessment of Cognitive Components of Decision Making with Military Versions of the IGT and WCST

    Science.gov (United States)

    2014-10-29

    19b. TELEPHONE NUMBER Quinn Kennedy Quinn Kennedy, Pete Nesbitt , Jon Alt 611102 c. THIS PAGE The public reporting burden for this collection of...DECISION MAKING WITH MILITARY VERSIONS OF THE IGT AND WCST Quinn Kennedy, Peter Nesbitt , and Jon Alt Naval Postgraduate School The U.S

  2. Public Broadcasting.

    Science.gov (United States)

    Shooshan, Harry M.; Arnheim, Louise

    This paper, the second in a series exploring future options for public policy in the communications and information arenas, examines some of the issues underlying public broadcasting, primarily public television. It advances two reasons why quality local public television programming is scarce: funds for the original production of programming have…

  3. Release Notes for Whisper-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Forrest B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alwin, Jennifer Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-04-27

    Whisper is a statistical analysis package developed in 2014 to support nuclear criticality safety (NCS) validation [1-3]. It uses the sensitivity profile data for an application as computed by MCNP6 [4-6] along with covariance files [7,8] for the nuclear data to determine a baseline upper-subcritical-limit (USL) for the application. Whisper version 1.0 was first developed and used at LANL in 2014 [3]. During 2015-2016, Whisper was updated to version 1.1 [9] and is to be included with the upcoming release of MCNP6.2. This document describes the Whisper-1.1 package that will be included with the MCNP6.2 release during 2017. Specific details are provided on the computer systems supported, the software quality assurance (SQA) procedures, installation, and testing. This document does not address other important topics, such as the importance of sensitivity-uncertainty (SU) methods to NCS validation, the theory underlying SU methodology, tutorials on the usage of MCNP-Whisper, practical approaches to using SU methodology to support and extend traditional validation, etc. There are over 50 documents included with Whisper-1.1 and available in the MCNP Reference Collection on the MCNP website (mcnp.lanl.gov) that address all of those topics and more. In this document, however, a complete bibliography of relevant MCNP-Whisper references is provided.

  4. Public Health and Midwifery in Indonesia.

    Science.gov (United States)

    2007-11-02

    JPRS: ^472 21 March 1961 PUBLIC HEALTH AND MIDWIFERY IN INDONESIA 3y M. Joedono DISTRIBUTION STATEMENT A Approved for Public Release...established to service the translation and research needs of the various government departments. ,-^’ JPRS: J^72 CSO: 1335-S/d PUBLIC HEALTH AND MIDWIFERY

  5. Intracellular drug release nanosystems

    Directory of Open Access Journals (Sweden)

    Fenghua Meng

    2012-10-01

    Full Text Available In order to elicit therapeutic effects, many drugs including small molecule anticancer drugs, proteins, siRNA, and DNA have to be delivered and released into the specific cellular compartments typically the cytoplasm or nucleus of target cells. Intracellular environment-responsive nanosystems that exhibit good extracellular stability while rapidly releasing drugs inside cancer cells have been actively pursued for effective cancer therapy. Here, we highlight novel designs of smart nanosystems that release drugs in response to an intracellular biological signal of cancer cells such as acidic pH in endo/lysosomal compartments, enzymes in lysosomes, and redox potential in cytoplasm and the cell nucleus.

  6. Publication of the bulletin in 2011

    CERN Multimedia

    DG Unit

    2010-01-01

    The table below lists the 2011 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Bulletin Web version Bulletin Printed version 3-4   Tuesday 11 January Fridays 14 and 21 January Wednesday 19 January 5-6   Tuesday 25 January Fridays 28 January and 4 February Wednesday 2 February 7-8 Tuesday 8 February Fridays 11 and 18 February Wednesday 16 February 9-10 Tuesday 22 F...

  7. ELEFUNT test results under FX/FORTRAN Version 1. 0 on the Alliant FX/8

    Energy Technology Data Exchange (ETDEWEB)

    Cody, W.J.

    1986-07-01

    This paper summarizes and analyzes the results of running various programs designed to test the arithmetic and the Fortran elementary and intrinsic function packages. The programs run include MACHAR and the ELEFUNT suite of transportable Fortran test programs, from the Software Manual for the Elementary Functions by Cody and Waite, the Fortran version of the arithmetic test program PARANOIA, and the prototype programs from the nascent INTFUNT test suite for intrinsic functions. All tests were run using Release 1.0 of FX/Fortran under Release 1.0 of the Concentrix operating system. 7 refs., 4 tabs.

  8. The SeaFlux Turbulent Flux Dataset Version 1.0 Documentation

    Science.gov (United States)

    Clayson, Carol Anne; Roberts, J. Brent; Bogdanoff, Alec S.

    2012-01-01

    Under the auspices of the World Climate Research Programme (WCRP) Global Energy and Water cycle EXperiment (GEWEX) Data and Assessment Panel (GDAP), the SeaFlux Project was created to investigate producing a high-resolution satellite-based dataset of surface turbulent fluxes over the global oceans. The most current release of the SeaFlux product is Version 1.0; this represents the initial release of turbulent surface heat fluxes, associated near-surface variables including a diurnally varying sea surface temperature.

  9. Publication of the bulletin

    CERN Multimedia

    2006-01-01

    The final edition (Nos. 51-52/2006 and 1-2-3/2007) of the last Bulletin of the year will appear on Friday 15 December and will cover events at CERN from 18 December 2006 to 19 January 2006. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate, by noon on Tuesday 12 December. The table below lists the 2007 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 noon on Tuesdays at the latest. Bulletin publication 2007 Bulletin No. (week No.) Publication date Submission of announcements (before 12:00 noon) 4-5 Monday 22 January Tuesday 16 January 6-7 Monday 5 February Tuesday 30 January 8-9 Monday 19 February Tuesday 13 February 10-11 Monday 5 March Tuesday 27 February 12-13 Monday 19 March Tuesday 13 March 14-15 Monday 2 April Tuesday 27 March 16-17 Monday 1...

  10. The NERC Vocabulary Server: Version 2.0

    Science.gov (United States)

    Leadbetter, A. M.; Lowry, R. K.

    2012-12-01

    The Natural Environment Research Council (NERC) Vocabulary Server (NVS) has been used to publish controlled vocabularies of terms relevant to marine environmental sciences since 2006 (version 0) with version 1 being introduced in 2007. It has been used for - metadata mark-up with verifiable content - populating dynamic drop down lists - semantic cross-walk between metadata schemata - so-called smart search - and the semantic enablement of Open Geospatial Consortium (OGC) Web Processing Services in the NERC Data Grid and the European Commission SeaDataNet, Geo-Seas, and European Marine Observation and Data Network (EMODnet) projects. The NVS is based on the Simple Knowledge Organization System (SKOS) model. SKOS is based on the "concept", which it defines as a "unit of thought", that is an idea or notion such as "oil spill". Following a version change for SKOS in 2009 there was a desire to upgrade the NVS to incorporate the changes. This version of SKOS introduces the ability to aggregate concepts in both collections and schemes. The design of version 2 of the NVS uses both types of aggregation: schemes for the discovery of content through hierarchical thesauri and collections for the publication and addressing of content. Other desired changes from version 1 of the NVS included: - the removal of the potential for multiple identifiers for the same concept to ensure consistent addressing of concepts - the addition of content and technical governance information in the payload documents to provide an audit trail to users of NVS content - the removal of XML snippets from concept definitions in order to correctly validate XML serializations of the SKOS - the addition of the ability to map into external knowledge organization systems in order to extend the knowledge base - a more truly RESTful approach URL access to the NVS to make the development of applications on top of the NVS easier - and support for multiple human languages to increase the user base of the NVS

  11. bulletin Publication 2009

    CERN Multimedia

    DSU Unit

    2008-01-01

    The table below lists the 2009 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Publication date 3-4 Tuesday 6 January Monday 12 January 5-6 Tuesday 20 January Monday 26 January 7-8 Tuesday 3 February Monday 9 February 9-10 Tuesday 17 February Monday 23 February 11-12 Tuesday 3 March Monday 9 March 13-14 Tuesday 17 March Monday 23 March 15-16-17 (Easter issue) Tuesday 31 March Monday 6 April 18-19 Tuesday 21 April Monday 27 April 20-21 Tuesday 5 May Monday 11 May 22-23 Tuesday 19 May Monday 25 May 24-25 ...

  12. Miniature Release Mechanism Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective is to design, build and functionally test a miniature release mechanism for CubeSats and other small satellites. The WFF 6U satellite structure will be...

  13. Public service motivation and job performance of public sector employees in the Netherlands

    NARCIS (Netherlands)

    Leisink, P.L.M.; Steijn, B.

    2009-01-01

    This article contributes in three ways to our understanding of public service motivation (PSM) and its effects. In the first place, it applies an abridged version of Perry's measurement scale in the Dutch public sector. Although the results of the analysis show that PSM is a valid concept in this co

  14. Publication of the bulletin in 2008

    CERN Multimedia

    DSU Department

    2008-01-01

    The table below lists the 2008 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin publication 2008 Bulletin N° 4-5 Publication: Monday 21 january Submission deadline for announcements: Tuesday 15 January Bulletin N° 6-7 Publication: Monday 4 february Submission deadline for announcements: Tuesday 29 January Bulletin N° 8-9 Publication: Monday 18 february Submission deadline for announcements: Tuesday 12 February Bulletin N° 10-11 Publication: Monday 3 march Submission deadline for announcements: Tuesday 26 February Bulletin N° 12-13 Publication: Monday 17 march Submission deadline for announcements: Tuesday 11 March Bulletin N° 14-15 Publication: Monday 31 march Submission deadline for announcements: Tuesday 25 March Bulletin N° 16-17 Publication: Monday 14 apri...

  15. Comparison of ibuprofen release from minitablets and capsules containing ibuprofen: β-Cyclodextrin complex

    OpenAIRE

    Salústio, Paulo; Marques, Helena Cabral; Costa, Paulo; Pinto, João

    2010-01-01

    NOTICE: this is the author’s version of a work that was accepted for publication in European Journal of Pharmaceutics and Biopharmaceutics. Changes resulting from the publishing process, such as peer review, editing, corrections, structural formatting, and other quality control mechanisms may not be reflected in this document. Changes may have been made to this work since it was submitted for publication. A definitive version was subsequently published in Eur J Pharm Biopharm. 2011 May;78(1):...

  16. Online Information Searching Strategy Inventory (OISSI): A Quick Version and a Complete Version

    Science.gov (United States)

    Tsai, Meng-Jung

    2009-01-01

    This study developed an instrument to evaluate student online information searching strategies based on a framework comprising three domains and seven aspects. Two versions of the Online Information Searching Strategies Inventory (OISSI), including both quick and complete versions, were finally established and exhibited good validities and…

  17. Spanish version of Colquitt's Organizational Justice Scale.

    Science.gov (United States)

    Díaz-Gracia, Liliana; Barbaranelli, Claudio; Moreno-Jiménez, Bernardo

    2014-01-01

    Organizational justice (OJ) is an important predictor of different work attitudes and behaviors. Colquitt's Organizational Justice Scale (COJS) was designed to assess employees' perceptions of fairness. This scale has four dimensions: distributive, procedural, informational, and interpersonal justice. The objective of this study is to validate it in a Spanish sample. The scale was administered to 460 Spanish employees from the service sector. 40.4% were men and 59.6% women. The Confirmatory Factor Analysis (CFA) supported the four dimensions structure for Spanish version of COJS. This model showed a better fit to data that the others models tested. Cronbach's alpha obtained for subscales ranged between .88 and .95. Correlations of the Spanish version of COJS with measures of incivility and job satisfaction were statistically significant and had a moderate to high magnitude, indicating a reasonable degree of construct validity. The Spanish version of COJS has adequate psychometric properties and may be of value in assessing OJ in Spanish setting.

  18. FEDIX: User`s guide, Version 5.0/Release 3.0

    Energy Technology Data Exchange (ETDEWEB)

    1994-09-01

    FEDIX is an on-line information service that links the education community and the federal government to facilitate research, education, and services. The system provides accurate, timely federal agency information to colleges, universities, and other research organizations. Participating agencies include DOE, FAA, NASA, ONR, AFOSR, DOC, HUD, AID, USDA, and DISA/DARIC. This guide is intended to help users access and utilize the FEDIX system. Because the system is frequently updated, some menus and tables in the text may not exactly match those displayed on the live system.

  19. Public Schools

    Data.gov (United States)

    Department of Homeland Security — This Public Schools feature dataset is composed of all Public elementary and secondary education in the United States as defined by the Common Core of Data, National...

  20. A kernel version of spatial factor analysis

    DEFF Research Database (Denmark)

    Nielsen, Allan Aasbjerg

    2009-01-01

    . Schölkopf et al. introduce kernel PCA. Shawe-Taylor and Cristianini is an excellent reference for kernel methods in general. Bishop and Press et al. describe kernel methods among many other subjects. Nielsen and Canty use kernel PCA to detect change in univariate airborne digital camera images. The kernel...... version of PCA handles nonlinearities by implicitly transforming data into high (even infinite) dimensional feature space via the kernel function and then performing a linear analysis in that space. In this paper we shall apply kernel versions of PCA, maximum autocorrelation factor (MAF) analysis...

  1. Self-consciousness Scale: a Brazilian version.

    Science.gov (United States)

    Teixeira, M A; Gomes, W B

    1995-10-01

    The aim of this study was to examine the applicability of a Brazilian version of the Self-consciousness Scale to university students. Factorial structure, subscale intercorrelations, and normative data obtained with 182 subjects are reported. These results suggest that the proposed model of self-consciousness is applicable in the Brazilian culture, although some significant sex differences were found for two of the scales. Reliability tests and the factorial validity of the scale showed that this version still needs refinement to be used as a reliable research tool.

  2. Concepts of incremental updating and versioning

    CSIR Research Space (South Africa)

    Cooper, Antony K

    2004-07-01

    Full Text Available . BACKGROUND TO THE PROBLEM OF INCREMENTAL UPDATING AND VERSIONING As well as a number of Commissions, the International Cartographic Association (ICA) had one Working Group, on Incremental Updating and Versioning, and this presentation describes some... of the work undertaken recently by the Working Group (WG). The WG was voted for a Commission by the General Assembly held at the 21st ICC in Durban, South Africa. The basic problem being addressed by the Commission is that a user compiles their data base...

  3. Simion 3D Version 6.0 User`s Manual

    Energy Technology Data Exchange (ETDEWEB)

    Dahl, D.A.

    1995-11-01

    The original SIMION was an electrostatic lens analysis and design program developed by D.C. McGilvery at Latrobe University, Bundoora Victoria, Australia, 1977. SIMION for the PC, developed at the Idaho National Engineering Laboratory, shares little more than its name with the original McGilvery version. INEL`s fifth major SIMION release, version 6.0, represents a quantum improvement over previous versions. This C based program can model complex problems using an ion optics workbench that can hold up to 200 2D and/or 3D electrostatic/magnetic potential arrays. Arrays can have up to 10,000,000 points. SIMION 3D`s 32 bit virtual Graphics User Interface provides a highly interactive advanced user environment. All potential arrays are visualized as 3D objects that the user can cut away to inspect ion trajectories and potential energy surfaces. User programs have been greatly extended in versatility and power. A new geometry file option supports the definition of highly complex array geometry. Extensive algorithm modifications have dramatically improved this version`s computational speed and accuracy.

  4. DOE-2 supplement: Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch (James J.) and Associates, Camarillo, CA (United States)

    1993-11-01

    This publication updates the DOE-2 Supplement form version 2.1D to version to 2.1E. It contains detailed discussions and instructions for using the features and enhancements introduced into the 2.1B, 2.1C, 2.1D, and 2.1E versions of the program. The building description section contains information on input functions in loads and systems, hourly report frequencies, saving files of hourly output for post processing, sharing hourly report data among program modules, the metric option, and input macros and general library features. The loads section contains information on sunspaces, sunspace modeling, window management and solar radiation, daylighting, trombe walls, fixed shades, fins and overhangs, shade schedules, self shades, heat distribution from lights, the Sherman-Grimsrud infiltrations method. terrain and height modification to wind speed, floor multipliers and interior wall types, improved exterior infrared radiation loss calculation, improved outside air film conductance calculation, window library, window frames, and switchable glazing. The systems section contains information on energy end use and meters, powered induction units, a packaged variable volume -- variable temperature system, a residential variable volume -- variable temperature system, air source heat pump enhancements, water loop heat pump enhancements, variable speed electric heat pump, gas heat pumps, hot water heaters, evaporative cooling, total gas solid-desiccant systems, add on desiccant cooling, water cooled condensers, evaporative precoolers outside air economizer control, optimum fan start, heat recovery from refrigerated case work, night ventilation, baseboard heating, moisture balance calculations, a residential natural ventilation algorithm, improved cooling coil model, system sizing and independent cooling and heating sizing ratios. The plant section contains information on energy meters, gas fired absorption chillers, engine driven compressor chillers, and ice energy storage.

  5. Public lighting.

    NARCIS (Netherlands)

    2011-01-01

    Visual perception is very important for road users and in the dark it can be facilitated by public lighting. Public lighting has a mostly positive road safety effect. Installing public lighting on roads that were previously unlit generally results in fewer and less serious crashes. This effect seems

  6. A systematic comparison of sugar content in low-fat vs regular versions of food

    OpenAIRE

    Nguyen, P K; Lin, S.; Heidenreich, P

    2016-01-01

    Obesity remains a significant public health concern. One of the primary messages from providers and health-care organizations is to eat healthier foods with lower fat. Many in the lay press, however, have suggested that lower fat versions of foods contain more sugar. To our knowledge, a systematic comparison of the sugar content in food with lower fat alternatives has not been performed. In this study, we compared fat free, low fat and regular versions of the same foods using data collected f...

  7. Using Versions of Literary Texts to Improve Comprehension.

    Science.gov (United States)

    Samuel, Moses

    1995-01-01

    Discusses the use of the original text of Shakespeare's "Macbeth," a simplified version, and a comic-book version of the play in a college-level English-as-a-Second-Language (ESL) course. The results indicate that multiple versions of a text can help offset the shortcomings of using only the original text or a simplified version. (three…

  8. Environmental releases for calendar year 1994

    Energy Technology Data Exchange (ETDEWEB)

    Gleckler, B.P.

    1995-07-01

    This report fulfills the annual environmental release reporting requirements of US Department of Energy (DOE) Orders. This report provides supplemental information to the Hanford Site Environmental Report. The Hanford Site Environmental Report provides an update on the environmental status of the entire Hanford Site. The sitewide annual report summarizes the degree of compliance of the Hanford Site with applicable environmental regulations and informs the public about the impact of Hanford operations on the surrounding environment. Like the Hanford Site Environmental Report, this annual report presents a summary of the environmental releases from facilities managed by the Westinghouse Hanford Company (WHC) and monitored by Bechtel Hanford, Incorporated (BHI). In addition to the summary data, this report also includes detailed data on air emissions, liquid effluents, and hazardous substances released to the environment during calendar year 1994 from these facilities.

  9. A fluoride release-adsorption-release system applied to fluoride-releasing restorative materials.

    Science.gov (United States)

    Suljak, J P; Hatibovic-Kofman, S

    1996-09-01

    This investigation compared the initial fluoride release and release following refluoridation of three resin-modified glass-ionomer cements (Photac-Fil Applicap, Vitremer, and Fuji II LC) and a new polyacid-modified resin composite material (Dyract). After daily flouride release was measured for 8 days, specimens were refluoridated in 1,000-ppm solutions of fluoride ion for 10 minutes and fluoride release was measured for 5 days. Two further 5-day refluoridation-release periods were carried out. All materials released fluoride initially. Photac released the most; Dyract released the least. Initial release was greatest over the first few days. All materials released significantly more fluoride for 24 to 48 hours after refluoridation. Less fluoride was released with each successive refluoridation for the three glass-ionomer cements. The release from the Dyract compomer remained at a comparatively constant and significantly lower level following each refluoridation.

  10. Vienna VLBI Software - Current release and plans for the future

    Science.gov (United States)

    Madzak, M.; Böhm, J.; Böhm, S.; Krásná, H.; Nilsson, T.; Plank, L.; Tierno Ros, C.; Schuh, H.; Soja, B.; Sun, J.; Teke, K.

    2013-08-01

    The Vienna VLBI Software (VieVS) is a geodetic Very Long Baseline Interferometry (VLBI) data analysis software which has been developed at the Vienna University of Technology since 2008. This paper gives an overview about its capabilities, including scheduling and simulation of VLBI observations. The latest release, version 2.1 includes a a graphical user interface. A few results and planned future developments are presented as well.

  11. RAVEN Beta Release

    Energy Technology Data Exchange (ETDEWEB)

    Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Alfonsi, Andrea [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mandelli, Diego [Idaho National Lab. (INL), Idaho Falls, ID (United States); Kinoshita, Robert Arthur [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wang, Congjian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Maljovec, Daniel Patrick [Idaho National Lab. (INL), Idaho Falls, ID (United States); Talbot, Paul William [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-02-01

    This documents the release of the Risk Analysis Virtual Environment (RAVEN) code. A description of the RAVEN code is provided, and discussion of the release process for the M2LW-16IN0704045 milestone. The RAVEN code is a generic software framework to perform parametric and probabilistic analysis based on the response of complex system codes. RAVEN is capable of investigating the system response as well as the input space using Monte Carlo, Grid, or Latin Hyper Cube sampling schemes, but its strength is focused toward system feature discovery, such as limit surfaces, separating regions of the input space leading to system failure, using dynamic supervised learning techniques. RAVEN has now increased in maturity enough for the Beta 1.0 release.

  12. Controlled-release microchips.

    Science.gov (United States)

    Sharma, Sadhana; Nijdam, A Jasper; Sinha, Piyush M; Walczak, Robbie J; Liu, Xuewu; Cheng, Mark M-C; Ferrari, Mauro

    2006-05-01

    Efficient drug delivery remains an important challenge in medicine: continuous release of therapeutic agents over extended time periods in accordance with a predetermined temporal profile; local delivery at a constant rate to the tumour microenvironment to overcome much of the systemic toxicity and to improve antitumour efficacy; improved ease of administration, and increasing patient compliance required are some of the unmet needs of the present drug delivery technology. Microfabrication technology has enabled the development of novel controlled-release microchips with capabilities not present in the current treatment modalities. In this review, the current status and future prospects of different types of controlled-release microchips are summarised and analysed with reference to microneedle-based microchips, as well as providing an in-depth focus on microreservoir-based and nanoporous microchips.

  13. The version 3 OMI NO2 standard product

    Science.gov (United States)

    Krotkov, Nickolay A.; Lamsal, Lok N.; Celarier, Edward A.; Swartz, William H.; Marchenko, Sergey V.; Bucsela, Eric J.; Chan, Ka Lok; Wenig, Mark; Zara, Marina

    2017-09-01

    We describe the new version 3.0 NASA Ozone Monitoring Instrument (OMI) standard nitrogen dioxide (NO2) products (SPv3). The products and documentation are publicly available from the NASA Goddard Earth Sciences Data and Information Services Center (https://disc.gsfc.nasa.gov/datasets/OMNO2_V003/summary/). The major improvements include (1) a new spectral fitting algorithm for NO2 slant column density (SCD) retrieval and (2) higher-resolution (1° latitude and 1.25° longitude) a priori NO2 and temperature profiles from the Global Modeling Initiative (GMI) chemistry-transport model with yearly varying emissions to calculate air mass factors (AMFs) required to convert SCDs into vertical column densities (VCDs). The new SCDs are systematically lower (by ˜ 10-40 %) than previous, version 2, estimates. Most of this reduction in SCDs is propagated into stratospheric VCDs. Tropospheric NO2 VCDs are also reduced over polluted areas, especially over western Europe, the eastern US, and eastern China. Initial evaluation over unpolluted areas shows that the new SPv3 products agree better with independent satellite- and ground-based Fourier transform infrared (FTIR) measurements. However, further evaluation of tropospheric VCDs is needed over polluted areas, where the increased spatial resolution and more refined AMF estimates may lead to better characterization of pollution hot spots.

  14. The version 3 OMI NO2 standard product

    Directory of Open Access Journals (Sweden)

    N. A. Krotkov

    2017-09-01

    Full Text Available We describe the new version 3.0 NASA Ozone Monitoring Instrument (OMI standard nitrogen dioxide (NO2 products (SPv3. The products and documentation are publicly available from the NASA Goddard Earth Sciences Data and Information Services Center (https://disc.gsfc.nasa.gov/datasets/OMNO2_V003/summary/. The major improvements include (1 a new spectral fitting algorithm for NO2 slant column density (SCD retrieval and (2 higher-resolution (1° latitude and 1.25° longitude a priori NO2 and temperature profiles from the Global Modeling Initiative (GMI chemistry–transport model with yearly varying emissions to calculate air mass factors (AMFs required to convert SCDs into vertical column densities (VCDs. The new SCDs are systematically lower (by ∼ 10–40 % than previous, version 2, estimates. Most of this reduction in SCDs is propagated into stratospheric VCDs. Tropospheric NO2 VCDs are also reduced over polluted areas, especially over western Europe, the eastern US, and eastern China. Initial evaluation over unpolluted areas shows that the new SPv3 products agree better with independent satellite- and ground-based Fourier transform infrared (FTIR measurements. However, further evaluation of tropospheric VCDs is needed over polluted areas, where the increased spatial resolution and more refined AMF estimates may lead to better characterization of pollution hot spots.

  15. Chronic Condition Public Use File (PUF)

    Data.gov (United States)

    U.S. Department of Health & Human Services — This release contains the Chronic Conditions Public Use Files (PUF) with information from Medicare claims. The CMS Chronic Conditions PUF is an aggregated file in...

  16. ICRAF Species Switchboard. Version 1.2

    DEFF Research Database (Denmark)

    Kindt, R.; Ordonez, J.; Smith, E.;

    2015-01-01

    The current version of the Agroforestry Species Switchboard documents the presence of a total of 26,135 plant species (33,813 species including synonyms) across 19 web-based databases. When available, hyperlinks to information on the selected species in particular databases are provided. In total...

  17. Version Control in Project-Based Learning

    Science.gov (United States)

    Milentijevic, Ivan; Ciric, Vladimir; Vojinovic, Oliver

    2008-01-01

    This paper deals with the development of a generalized model for version control systems application as a support in a range of project-based learning methods. The model is given as UML sequence diagram and described in detail. The proposed model encompasses a wide range of different project-based learning approaches by assigning a supervisory…

  18. UGV Control Interoperability Profile (IOP), Version 0

    Science.gov (United States)

    2011-12-21

    sections provide best practice information (articles, papers , website, etc.) 5.1.1 OCU Physical Attributes 5.1.1.1 Standards Number Document...information (articles, papers , website, etc.). In future versions of this document, additional tables will be developed, containing standards and guidelines...Mounted Display ICD Interface Control Document IEC International Electrotechnical Commission IMS Intelligent Munitions Systems IOP Interoperability

  19. ICRAF Species Switchboard. Version 1.2

    DEFF Research Database (Denmark)

    Kindt, R.; Ordonez, J.; Smith, E.

    2015-01-01

    The current version of the Agroforestry Species Switchboard documents the presence of a total of 26,135 plant species (33,813 species including synonyms) across 19 web-based databases. When available, hyperlinks to information on the selected species in particular databases are provided. In total...

  20. Versioning for CMIP6 in the Earth System Grid Federation

    Science.gov (United States)

    Weigel, Tobias; Kindermann, Stephan; Lautenschlager, Michael

    2015-04-01

    The Earth System Grid Federation (ESGF) has been used as the e-infrastructure to provide access to CMIP5 data and is expected to serve CMIP6 data as well. 2015 marks the year of continued planning and preparation where new concepts can still be implemented for the operational phase of CMIP6. A particular concern within ESGF operations is the versioning and automated replication of data. From CMIP5 experience we know that the pathway between initial submission of modelling data to the ESGF data space and quality-controlled long-term archival of the final products is long and far from linear. Data may be retracted, amended and updated, and metadata may accumulate at different stages. It is unrealistic to assume that a simple and straightforward process can be used as a role model to build ESGF services around the different stages data will pass through during the active phase of CMIP6. Nonetheless, at the technical level ESGF requires some form of automated control and management. At the same time, the accountability of data products must be made transparent to guard against misinterpretation, increase user experience and promote open and reproducible science. To address the challenges, first some essential versioning policies must be agreed upon and enforced through technical means and organizational processes. The volatile readiness state of CMIP data cannot be changed as it is given by the users; however its management can be improved. A promising approach is to embed persistent identifiers in all CMIP6 data objects and register them so they can be globally resolved by any user and used as reference points within ESGF management processes. A specific conceptual interpretation and management of such identifiers can ensure that they remain valid and useful even if the data objects change or become unavailable. For this, identifiers must be assigned to individual versions and aggregations, connected with each other and integrated in the existing ESGF publication

  1. Release of OLe peanut

    Science.gov (United States)

    OLe is a high oleic Spanish-type peanut that has excellent yield and enhanced Sclerotinia blight and pod rot resistance when compared to other high oleic Spanish cultivars. The purpose for releasing OLe is to provide peanut producers with a true Spanish peanut that is high oleic and has enhanced yi...

  2. Border cell release

    DEFF Research Database (Denmark)

    Mravec, Jozef

    2017-01-01

    Plant border cells are specialised cells derived from the root cap with roles in the biomechanics of root growth and in forming a barrier against pathogens. The mechanism of highly localised cell separation which is essential for their release to the environment is little understood. Here I present...

  3. Judicial Independence Versus Public Supervision

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    At the annual Supreme People's Court conference on publicity work held in early September, Deputy Chief Justice Cao Jianming announced a few new measures to limit the media's access to several news sources, setting a future tone for releasing news of China's judicial system.

  4. 42 CFR 412.616 - Release of information collected using the patient assessment instrument.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Release of information collected using the patient... Release of information collected using the patient assessment instrument. (a) General. An inpatient rehabilitation facility may release information from the patient assessment instrument only as specified in §...

  5. Description and evaluation of the Community Multiscale Air Quality (CMAQ) modeling system version 5.1

    Science.gov (United States)

    Wyat Appel, K.; Napelenok, Sergey L.; Foley, Kristen M.; Pye, Havala O. T.; Hogrefe, Christian; Luecken, Deborah J.; Bash, Jesse O.; Roselle, Shawn J.; Pleim, Jonathan E.; Foroutan, Hosein; Hutzell, William T.; Pouliot, George A.; Sarwar, Golam; Fahey, Kathleen M.; Gantt, Brett; Gilliam, Robert C.; Heath, Nicholas K.; Kang, Daiwen; Mathur, Rohit; Schwede, Donna B.; Spero, Tanya L.; Wong, David C.; Young, Jeffrey O.

    2017-04-01

    The Community Multiscale Air Quality (CMAQ) model is a comprehensive multipollutant air quality modeling system developed and maintained by the US Environmental Protection Agency's (EPA) Office of Research and Development (ORD). Recently, version 5.1 of the CMAQ model (v5.1) was released to the public, incorporating a large number of science updates and extended capabilities over the previous release version of the model (v5.0.2). These updates include the following: improvements in the meteorological calculations in both CMAQ and the Weather Research and Forecast (WRF) model used to provide meteorological fields to CMAQ, updates to the gas and aerosol chemistry, revisions to the calculations of clouds and photolysis, and improvements to the dry and wet deposition in the model. Sensitivity simulations isolating several of the major updates to the modeling system show that changes to the meteorological calculations result in enhanced afternoon and early evening mixing in the model, periods when the model historically underestimates mixing. This enhanced mixing results in higher ozone (O3) mixing ratios on average due to reduced NO titration, and lower fine particulate matter (PM2. 5) concentrations due to greater dilution of primary pollutants (e.g., elemental and organic carbon). Updates to the clouds and photolysis calculations greatly improve consistency between the WRF and CMAQ models and result in generally higher O3 mixing ratios, primarily due to reduced cloudiness and attenuation of photolysis in the model. Updates to the aerosol chemistry result in higher secondary organic aerosol (SOA) concentrations in the summer, thereby reducing summertime PM2. 5 bias (PM2. 5 is typically underestimated by CMAQ in the summer), while updates to the gas chemistry result in slightly higher O3 and PM2. 5 on average in January and July. Overall, the seasonal variation in simulated PM2. 5 generally improves in CMAQv5.1 (when considering all model updates), as simulated PM2. 5

  6. GHCN Version 3 Land Temperature and Version 2 Land Precipitation Dataset

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains gridded mean temperature anomalies from the Global Historical Climatology Network-Monthly (GHCN-M) version 3.3.0 temperature data set. The...

  7. Major Upgrades to the AIRS Version-6 Ozone Profile Methodology

    Science.gov (United States)

    Susskind, Joel; Blaisdell, John; Iredell, Lena

    2015-01-01

    This research is a continuation of part of what was shown at the last AIRS Science Team Meeting in the talk Improved Water Vapor and Ozone Profiles in SRT AIRS Version-6.X and the AIRS February 11, 2015 NetMeeting Further improvements in water vapor and ozone profiles compared to Version-6.AIRS Version-6 was finalized in late 2012 and is now operational. Version-6 contained many significant improvements in retrieval methodology compared to Version-5. However, Version-6 retrieval methodology used for the water vapor profile q(p) and ozone profile O3(p) retrievals is basically unchanged from Version-5, or even from Version-4. Subsequent research has made significant improvements in both water vapor and O3 profiles compared to Version-6. This talk will concentrate on O3 profile retrievals. Improvements in water vapor profile retrievals are given in a separate presentation.

  8. A version management model of PDM system and its realization

    Institute of Scientific and Technical Information of China (English)

    ZHONG Shi-sheng; LI Tao

    2008-01-01

    Based on the key function of version management in PDM system, this paper discusses the function and the realization of version management and the transitions of version states with a workflow. A directed acy-clic graph is used to describe a version model. Three storage modes of the directed acyclic graph version model in the database, the bumping block and the PDM working memory are presented and the conversion principle of these three modes is given. The study indicates that building a dynamic product structure configuration model based on versions is the key to resolve the problem. Thus a version model of single product object is built. Then the version management model in product structure configuration is built and the apphcation of version manage-ment of PDM syste' is presented as a case.

  9. Validation of the Italian version of the Non-Communicating Children's Pain Checklist-Postoperative Version.

    Science.gov (United States)

    Zanchi, C; Massaro, M; Ferrara, G; Montico, M; D'Osualdo, F; Rutigliano, R; Taddio, A; Vecchi Brumatti, L; Cozzi, G; Barbi, E

    2017-08-22

    This study evaluated the validity and reliability of the Italian version of the Non-Communicating Children's Pain Checklist-Postoperative version (I-NCCPC-PV). The original NCCPC-PV version was translated into Italian following the guidelines for "the translation, adaptation, and validation of instruments or scales for cross-cultural healthcare research". We tested the Italian NCCPC-PV version (I-NCCPC-PV) in 40 children (3-18 years of age) with severe to profound Intellectual Disability and no verbal communication. Each child's behavior was observed by a parent or caregiver and by an external observer in a quiet situation and a painful one. They independently assessed the child's level of pain using the translated Italian version of the NCCPCPV (I-NCCPC-PV). The results from 80 assessments showed that children's behavioral signs differed significantly between painful and calm situations (p Italian version of the NCCPC-PV (I-NCCPC-PV) can be used for pain assessment in children with Intellectual Disability who lack verbal communication.

  10. Kernel versions of some orthogonal transformations

    DEFF Research Database (Denmark)

    Nielsen, Allan Aasbjerg

    Kernel versions of orthogonal transformations such as principal components are based on a dual formulation also termed Q-mode analysis in which the data enter into the analysis via inner products in the Gram matrix only. In the kernel version the inner products of the original data are replaced...... by inner products between nonlinear mappings into higher dimensional feature space. Via kernel substitution also known as the kernel trick these inner products between the mappings are in turn replaced by a kernel function and all quantities needed in the analysis are expressed in terms of this kernel...... function. This means that we need not know the nonlinear mappings explicitly. Kernel principal component analysis (PCA) and kernel minimum noise fraction (MNF) analyses handle nonlinearities by implicitly transforming data into high (even infinite) dimensional feature space via the kernel function...

  11. A kernel version of spatial factor analysis

    DEFF Research Database (Denmark)

    Nielsen, Allan Aasbjerg

    2009-01-01

    of PCA and related techniques. An interesting dilemma in reduction of dimensionality of data is the desire to obtain simplicity for better understanding, visualization and interpretation of the data on the one hand, and the desire to retain sufficient detail for adequate representation on the other hand......Based on work by Pearson in 1901, Hotelling in 1933 introduced principal component analysis (PCA). PCA is often used for general feature generation and linear orthogonalization or compression by dimensionality reduction of correlated multivariate data, see Jolliffe for a comprehensive description...... version of PCA handles nonlinearities by implicitly transforming data into high (even infinite) dimensional feature space via the kernel function and then performing a linear analysis in that space. In this paper we shall apply kernel versions of PCA, maximum autocorrelation factor (MAF) analysis...

  12. EJSCREEN National Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The USA table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the national...

  13. EJSCREEN States Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The States table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the state...

  14. EJSCREEN Regions Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Regions table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the EPA...

  15. EJSCREEN Regions Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Regions table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the EPA...

  16. EJSCREEN National Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The USA table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the national...

  17. EJSCREEN States Percentiles Lookup Table--2015 Public Release

    Data.gov (United States)

    U.S. Environmental Protection Agency — The States table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the state...

  18. Retracted Publications Within Radiology Journals.

    Science.gov (United States)

    Rosenkrantz, Andrew B

    2016-02-01

    The purpose of this study was to characterize trends related to retracted publications within radiology journals. PubMed was queried to identify all articles with the publication type "retracted publication" or "notification of retraction." Articles published within radiology journals were identified using Journal Citation Reports' journal categories. Available versions of original articles and publication notices were accessed from journal websites. Citations to retracted publications were identified using Web of Science. Overall trends were assessed. Forty-eight retracted original research articles were identified within radiology journals since 1983, which included 1.1% of all PubMed "retracted publication" entries. Distinct PubMed entries were available for the retracted publication and retraction notification in 39 of 48 articles. The original PDF was available for 37 articles, although the articles were not watermarked as retracted in 23 cases. In six cases with a watermarked PDF, further searches identified nonwatermarked versions. Original HTML versions were available for 13 articles but 11 were not watermarked. The mean (± SD) delay between publication and retraction was 2.7 ± 2.8 years (range, 0-16 years). The mean number of citations to retracted articles was 10.9 ± 17.1 (range, 0-94 citations). Reasons for retraction included problematic or incorrect methods or results (although it typically was unclear whether these represented honest errors or misconduct) in 33.3% of cases, complete or partial duplicate publication in 33.3% of cases, plagiarism in 14.6% of cases, a permission issue in 8.3% of cases, the publisher's error in 6.3% of cases, and no identified reason in 6.3% of cases. One or no retractions occurred annually from 1986 to 2001, although two or more retractions occurred annually in nine of the 12 years from 2002 through 2013. Retraction represents an uncommon, yet potentially increasing, issue within radiology journals that publishers

  19. New Version of the COCO Program

    Directory of Open Access Journals (Sweden)

    F. Fencl

    1994-09-01

    Full Text Available The new version of the COCO program enables the analysis of linear circuits in symbolical, symbolic numerical or in semi-symbolical form. Simple synthesis problems can also be solved with the aid of this program. Several examples illustrate the use of the program for circuit analysis and synthesis. Modern network elements (trans-impedance operational amplifier, current conveyors are built in the program.

  20. The limits of mathematics tutorial version

    CERN Document Server

    Chaitin, G J

    1995-01-01

    The latest in a series of reports presenting the information-theoretic incompleteness theorems of algorithmic information theory via algorithms written in specially designed versions of LISP. Previously in this LISP code only one-character identifiers were allowed, and arithmetic had to be programmed out. Now identifiers can be many characters long, and arithmetic with arbitrarily large unsigned decimal integers is built in. This and many other changes in the software have made this material much easier to understand and to use.

  1. Original article Validation of the Polish version of the Collective Self-Esteem Scale

    Directory of Open Access Journals (Sweden)

    Róża Bazińska

    2015-07-01

    Full Text Available Background The aim of this article is to present research on the validity and reliability of the Collective Self-Esteem Scale (CSES for the Polish population. The CSES is a measure of individual differences in collective self-esteem, understood as the global evaluation of one’s own social (collective identity. Participants and procedure Participants from two samples (n = 466 and n = 1,009 completed a paper-pencil set of questionnaires which contained the CSES and the Rosenberg Self-Esteem Scale (RSES, and subsets of participants completed scales related to a sense of belonging, well-being and psychological distress (anxiety and depression. Results Like the original version, the Polish version of the CSES comprises 16 items which form the four dimensions of collective self-esteem: Public collective self-esteem, Private collective self-esteem, Membership esteem and Importance of Identity. The results confirm the four-factor structure of the Polish version of the CSES, support the whole Polish version of the CSES as well as its subscales, which represent satisfactory reliability and stability, and provide initial evidence of construct validity. Conclusions As the results of the study indicate, the Polish version of the CSES is a valid and reliable self-report measure for assessing the global self-esteem derived from membership of a group and has proved to be useful in the Polish context.

  2. Development of the Thai version of Mini-Cog, a brief cognitive screening test.

    Science.gov (United States)

    Trongsakul, Supaporn; Lambert, Rod; Clark, Allan; Wongpakaran, Nahathai; Cross, Jane

    2015-05-01

    Cognitive impairment, such as dementia, has emerged as the leading public health problem among the elderly. Therefore, early detection of the disorder and providing appropriate healthcare and management is important, particularly, for the patients with comorbid diabetes who require long-term treatment strategies. In Thailand, because of a large number of elderly patients with diabetes, and time constraints in primary care settings, a short and effective cognitive screening test is required. The Mini-Cog is a short and valid cognitive screening test that was specifically designed for use in primary care settings. The present study translated the English language version into a Thai language version, and then measured the interrater reliability and concurrent validity. The processes of cross-language translation were carried out to develop a Thai language version of the Mini-Cog. A total of 21 Thai older adults with type 2 diabetes with a mean aged of 69 ± 7 years were recruited into a study investigating the interrater reliability and concurrent validity of the Mini-Cog Thai version in one primary care center in Thailand. The Mini-Cog Thai version showed a good interrater reliability (K = 0.80, P cognitive function in primary care settings in Thailand. It is recommended that it could be used as a new cognitive screening test for the aging population in the Thai community. © 2014 Japan Geriatrics Society.

  3. Development of polygonal-surface version of ICRP reference phantoms: Lymphatic node modeling

    Energy Technology Data Exchange (ETDEWEB)

    Thang, Ngyen Tat; Yeom, Yeon Soo; Han, Min Cheol; Kim, Chan Hyeong [Hanyang University, Seoul (Korea, Republic of)

    2014-04-15

    Among radiosensitive organs/tissues considered in ICRP Publication 103, lymphatic nodes are many small size tissues and widely distributed in the ICRP reference phantoms. It is difficult to directly convert lymphatic nodes of ICRP reference voxel phantoms to polygonal surfaces. Furthermore, in the ICRP reference phantoms lymphatic nodes were manually drawn only in six lymphatic node regions and the reference number of lymphatic nodes reported in ICRP Publication 89 was not considered. To address aforementioned limitations, the present study developed a new lymphatic node modeling method for the polygonal-surface version of ICRP reference phantoms. By using the developed method, lymphatic nodes were modelled in the preliminary version of ICRP male polygonal-surface phantom. Then, lymphatic node dose values were calculated and compared with those of the ICRP reference male voxel phantom to validate the developed modeling method. The present study developed the new lymphatic node modeling method and successfully modeled lymphatic nodes in the preliminary version of the ICRP male polygonal-surface phantom. From the results, it was demonstrated that the developed modeling method can be used to model lymphatic nodes in polygonal-surface version of ICRP reference phantoms.

  4. Geophysics publications honored

    Science.gov (United States)

    Geophysics and geology publications by the U.S. Geological Survey were awarded one first- and two third-place prizes at the ‘Blue Pencil’ ceremony last month, sponsored by the National Association of Government Communicators.First place in the news release category went to Frank Forrester, an AGU member and recently retired USGS information officer. Editors and artists of the bimonthly USGS Earthquake Information Bulletin were awarded third place in the category for technical magazines using at least two colors.

  5. Mission Data System Java Edition Version 7

    Science.gov (United States)

    Reinholtz, William K.; Wagner, David A.

    2013-01-01

    The Mission Data System framework defines closed-loop control system abstractions from State Analysis including interfaces for state variables, goals, estimators, and controllers that can be adapted to implement a goal-oriented control system. The framework further provides an execution environment that includes a goal scheduler, execution engine, and fault monitor that support the expression of goal network activity plans. Using these frameworks, adapters can build a goal-oriented control system where activity coordination is verified before execution begins (plan time), and continually during execution. Plan failures including violations of safety constraints expressed in the plan can be handled through automatic re-planning. This version optimizes a number of key interfaces and features to minimize dependencies, performance overhead, and improve reliability. Fault diagnosis and real-time projection capabilities are incorporated. This version enhances earlier versions primarily through optimizations and quality improvements that raise the technology readiness level. Goals explicitly constrain system states over explicit time intervals to eliminate ambiguity about intent, as compared to command-oriented control that only implies persistent intent until another command is sent. A goal network scheduling and verification process ensures that all goals in the plan are achievable before starting execution. Goal failures at runtime can be detected (including predicted failures) and handled by adapted response logic. Responses can include plan repairs (try an alternate tactic to achieve the same goal), goal shedding, ignoring the fault, cancelling the plan, or safing the system.

  6. EPICS Version 4 - Implementing Complex Data Types

    Energy Technology Data Exchange (ETDEWEB)

    Marty Kraimer,; John dalesio

    2012-11-27

    Through phase 1 and phase 2 SBIR grants, s fully functional I/O Controller and communication protocol for version 4 of EPICS is completed. This new software architecture provides a flexible and extendible architecture. Version 4 is implemented fully in Java. The performance metrics look promising. The final portion of phase 2 is to optimize the communication mechanisms. Subsequent work on different aspects of this are required to provide a viable solutions in various areas. Version 3 of EPICS is able to provide a platform for implementing channel based control, because the channel and attributes for time stamping, alarm, display and control were narrow, well defined, and complete. To extend EPICS functionality beyond this, it is necessary to define attributes needed for archive data, array, image data, and directory services. The proper handling of several array types enables the development of middle layer servers such as orbit and bump control in accelerators. Phase 1 should produce a well defined, reviewed, and agreed upon definition of the metadata required for these services. A Phase 2 grant would provide tools that implemented archiving, general array, imaging, and directory applications.

  7. Merged Sounding VAP Version 2.0

    Energy Technology Data Exchange (ETDEWEB)

    Troyan, D.; Jensen, M.; Turner, D.; Miloshevich, L.

    2010-03-15

    The Merged Sounding Value-Added Product (VAP) has been in the ARM and ASR pipeline since 2001. Output data streams have been added to the Evaluation Products section of the ARM website for the past five years. Currently, there are data for all of the ACRF fixed sites and all deployments of the Mobile Facility. Fifty-three years of Merged Sounding data is available as an evaluation product. The process of moving all to the ARM Data Archive has been started and will be completed shortly. A second version of the Merged Sounding VAP was developed to address several concerns: (1) Vaisala radiosondes have inherent problems obtaining an accurate measurement of relative humidity, (2) the profile can be extended from 20 km to 60 km above ground level based upon the height achieved by ECMWF profiles, and (3) ECMWF temperatures require adjustments at high altitude (between 1mb and 100 mb). Solutions to these issues have been incorporated in the new version of this VAP. Along with producing that second version of Merged Sounding, a secondary data stream - Sonde Adjust - was created. This VAP incorporates any humidity corrections to the Vaisala RS-80, RS-90, and RS-92 radiosondes. The algorithms used to perform these corrections are documented by Wang et. al. (2002), Turner et. al. (2003), and Miloshevich et. al. (2004, 2009).

  8. Carpal tunnel release

    DEFF Research Database (Denmark)

    Larsen, Morten Bo; Sørensen, A I; Crone, K L;

    2013-01-01

    A single-blind, randomized, controlled trial was done to compare the results of carpal tunnel release using classic incision, short incision, or endoscopic technique. In total, 90 consecutive cases were included. Follow-up was 24 weeks. We found a significantly shorter sick leave in the endoscopi...... incision could be found. There were no serious complications in either group. The results indicate that the endoscopic procedure is safe and has the benefit of faster rehabilitation and return to work....

  9. Cryogenic hydrogen release research.

    Energy Technology Data Exchange (ETDEWEB)

    LaFleur, Angela Christine [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The objective of this project was to devolop a plan for modifying the Turbulent Combustion Laboratory (TCL) with the necessary infrastructure to produce a cold (near liquid temperature) hydrogen jet. The necessary infrastructure has been specified and laboratory modifications are currently underway. Once complete, experiments from this platform will be used to develop and validate models that inform codes and standards which specify protection criteria for unintended releases from liquid hydrogen storage, transport, and delivery infrastructure.

  10. EIA new releases

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-01

    This report was prepared by the Energy Information Administration. It contains news releases on items of interest to the petroleum, coal, nuclear, electric and alternate fuels industries ranging from economic outlooks to environmental concerns. There is also a listing of reports by industry and an energy education resource listing containing sources for free or low-cost energy-related educational materials for educators and primary and secondary students.

  11. An accuracy assessment of the CALIOP/CALIPSO version 2/version 3 daytime aerosol extinction product based on a detailed multi-sensor, multi-platform case study

    Directory of Open Access Journals (Sweden)

    M. Kacenelenbogen

    2011-04-01

    Full Text Available The Cloud Aerosol LIdar with Orthogonal Polarization (CALIOP, on board the CALIPSO platform, has measured profiles of total attenuated backscatter coefficient (level 1 products since June 2006. CALIOP's level 2 products, such as the aerosol backscatter and extinction coefficient profiles, are retrieved using a complex succession of automated algorithms. The goal of this study is to help identify potential shortcomings in the CALIOP version 2 level 2 aerosol extinction product and to illustrate some of the motivation for the changes that have been introduced in the next version of CALIOP data (version 3, released in June 2010. To help illustrate the potential factors contributing to the uncertainty of the CALIOP aerosol extinction retrieval, we focus on a one-day, multi-instrument, multiplatform comparison study during the CALIPSO and Twilight Zone (CATZ validation campaign on 4 August 2007. On that day, we observe a consistency in the Aerosol Optical Depth (AOD values recorded by four different instruments (i.e. space-borne MODerate Imaging Spectroradiometer, MODIS: 0.67 and POLarization and Directionality of Earth's Reflectances, POLDER: 0.58, airborne High Spectral Resolution Lidar, HSRL: 0.52 and ground-based AErosol RObotic NETwork, AERONET: 0.48 to 0.73 while CALIOP AOD is a factor of two lower (0.32 at 532 nm. This case study illustrates the following potential sources of uncertainty in the CALIOP AOD: (i CALIOP's low signal-to-noise ratio (SNR leading to the misclassification and/or lack of aerosol layer identification, especially close to the Earth's surface; (ii the cloud contamination of CALIOP version 2 aerosol backscatter and extinction profiles; (iii potentially erroneous assumptions of the aerosol extinction-to-backscatter ratio (Sa used in CALIOP's extinction retrievals; and (iv calibration coefficient biases in the CALIOP daytime attenuated backscatter coefficient profiles. The use of version 3 CALIOP extinction

  12. An accuracy assessment of the CALIOP/CALIPSO version 2/version 3 daytime aerosol extinction product based on a detailed multi-sensor, multi-platform case study

    Science.gov (United States)

    Kacenelenbogen, M.; Vaughan, M. A.; Redemann, J.; Hoff, R. M.; Rogers, R. R.; Ferrare, R. A.; Russell, P. B.; Hostetler, C. A.; Hair, J. W.; Holben, B. N.

    2011-04-01

    The Cloud Aerosol LIdar with Orthogonal Polarization (CALIOP), on board the CALIPSO platform, has measured profiles of total attenuated backscatter coefficient (level 1 products) since June 2006. CALIOP's level 2 products, such as the aerosol backscatter and extinction coefficient profiles, are retrieved using a complex succession of automated algorithms. The goal of this study is to help identify potential shortcomings in the CALIOP version 2 level 2 aerosol extinction product and to illustrate some of the motivation for the changes that have been introduced in the next version of CALIOP data (version 3, released in June 2010). To help illustrate the potential factors contributing to the uncertainty of the CALIOP aerosol extinction retrieval, we focus on a one-day, multi-instrument, multiplatform comparison study during the CALIPSO and Twilight Zone (CATZ) validation campaign on 4 August 2007. On that day, we observe a consistency in the Aerosol Optical Depth (AOD) values recorded by four different instruments (i.e. space-borne MODerate Imaging Spectroradiometer, MODIS: 0.67 and POLarization and Directionality of Earth's Reflectances, POLDER: 0.58, airborne High Spectral Resolution Lidar, HSRL: 0.52 and ground-based AErosol RObotic NETwork, AERONET: 0.48 to 0.73) while CALIOP AOD is a factor of two lower (0.32 at 532 nm). This case study illustrates the following potential sources of uncertainty in the CALIOP AOD: (i) CALIOP's low signal-to-noise ratio (SNR) leading to the misclassification and/or lack of aerosol layer identification, especially close to the Earth's surface; (ii) the cloud contamination of CALIOP version 2 aerosol backscatter and extinction profiles; (iii) potentially erroneous assumptions of the aerosol extinction-to-backscatter ratio (Sa) used in CALIOP's extinction retrievals; and (iv) calibration coefficient biases in the CALIOP daytime attenuated backscatter coefficient profiles. The use of version 3 CALIOP extinction retrieval for our case

  13. An Accuracy Assessment of the CALIOP/CALIPSO Version 2/Version 3 Daytime Aerosol Extinction Product Based on a Detailed Multi-Sensor, Multi-Platform Case Study

    Science.gov (United States)

    Kacenelenbogen, M.; Vaughan, M. A.; Redemann, J.; Hoff, R. M.; Rogers, R. R.; Ferrare, R. A.; Russell, P. B.; Hostetler, C. A.; Hair, J. W.; Holben, B. N.

    2011-01-01

    The Cloud Aerosol LIdar with Orthogonal Polarization (CALIOP), on board the CALIPSO platform, has measured profiles of total attenuated backscatter coefficient (level 1 products) since June 2006. CALIOP s level 2 products, such as the aerosol backscatter and extinction coefficient profiles, are retrieved using a complex succession of automated algorithms. The goal of this study is to help identify potential shortcomings in the CALIOP version 2 level 2 aerosol extinction product and to illustrate some of the motivation for the changes that have been introduced in the next version of CALIOP data (version 3, released in June 2010). To help illustrate the potential factors contributing to the uncertainty of the CALIOP aerosol extinction retrieval, we focus on a one-day, multi-instrument, multiplatform comparison study during the CALIPSO and Twilight Zone (CATZ) validation campaign on 4 August 2007. On that day, we observe a consistency in the Aerosol Optical Depth (AOD) values recorded by four different instruments (i.e. spaceborne MODerate Imaging Spectroradiometer, MODIS: 0.67 and POLarization and Directionality of Earth s Reflectances, POLDER: 0.58, airborne High Spectral Resolution Lidar, HSRL: 0.52 and ground-based AErosol RObotic NETwork, AERONET: 0.48 to 0.73) while CALIOP AOD is a factor of two lower (0.32 at 532 nm). This case study illustrates the following potential sources of uncertainty in the CALIOP AOD: (i) CALIOP s low signal-to-noise ratio (SNR) leading to the misclassification and/or lack of aerosol layer identification, especially close to the Earth s surface; (ii) the cloud contamination of CALIOP version 2 aerosol backscatter and extinction profiles; (iii) potentially erroneous assumptions of the aerosol extinction-to-backscatter ratio (Sa) used in CALIOP s extinction retrievals; and (iv) calibration coefficient biases in the CALIOP daytime attenuated backscatter coefficient profiles. The use of version 3 CALIOP extinction retrieval for our case

  14. Mechanisms of HSP72 release

    Indian Academy of Sciences (India)

    Alexzander Asea

    2007-04-01

    Currently two mechanisms are recognized by which heat shock proteins (HSP) are released from cells; a passive release mechanism, including necrotic cell death, severe blunt trauma, surgery and following infection with lytic viruses, and an active release mechanism which involves the non classical protein release pathway. HSPs are released both as free HSP and within exosomes. This review covers recent findings on the mechanism by which stress induces the release of HSP72 into the circulation and the biological significance of circulating HSP72 to host defense against disease.

  15. Triggered Release from Polymer Capsules

    Energy Technology Data Exchange (ETDEWEB)

    Esser-Kahn, Aaron P. [Univ. of Illinois, Urbana, IL (United States). Beckman Inst. for Advanced Science and Technology and Dept. of Chemistry; Odom, Susan A. [Univ. of Illinois, Urbana, IL (United States). Beckman Inst. for Advanced Science and Technology and Dept. of Chemistry; Sottos, Nancy R. [Univ. of Illinois, Urbana, IL (United States). Beckman Inst. for Advanced Science and Technology and Dept. of Materials Science and Engineering; White, Scott R. [Univ. of Illinois, Urbana, IL (United States). Beckman Inst. for Advanced Science and Technology and Dept. of Aerospace Engineering; Moore, Jeffrey S. [Univ. of Illinois, Urbana, IL (United States). Beckman Inst. for Advanced Science and Technology and Dept. of Chemistry

    2011-07-06

    Stimuli-responsive capsules are of interest in drug delivery, fragrance release, food preservation, and self-healing materials. Many methods are used to trigger the release of encapsulated contents. Here we highlight mechanisms for the controlled release of encapsulated cargo that utilize chemical reactions occurring in solid polymeric shell walls. Triggering mechanisms responsible for covalent bond cleavage that result in the release of capsule contents include chemical, biological, light, thermal, magnetic, and electrical stimuli. We present methods for encapsulation and release, triggering methods, and mechanisms and conclude with our opinions on interesting obstacles for chemically induced activation with relevance for controlled release.

  16. Protecting privacy in data release

    CERN Document Server

    Livraga, Giovanni

    2015-01-01

    This book presents a comprehensive approach to protecting sensitive information when large data collections are released by their owners. It addresses three key requirements of data privacy: the protection of data explicitly released, the protection of information not explicitly released but potentially vulnerable due to a release of other data, and the enforcement of owner-defined access restrictions to the released data. It is also the first book with a complete examination of how to enforce dynamic read and write access authorizations on released data, applicable to the emerging data outsou

  17. Reliability and validity of the Japanese version of the Resilience Scale and its short version

    Directory of Open Access Journals (Sweden)

    Kondo Maki

    2010-11-01

    Full Text Available Abstract Background The clinical relevance of resilience has received considerable attention in recent years. The aim of this study is to demonstrate the reliability and validity of the Japanese version of the Resilience Scale (RS and short version of the RS (RS-14. Findings The original English version of RS was translated to Japanese and the Japanese version was confirmed by back-translation. Participants were 430 nursing and university psychology students. The RS, Center for Epidemiologic Studies Depression Scale (CES-D, Rosenberg Self-Esteem Scale (RSES, Social Support Questionnaire (SSQ, Perceived Stress Scale (PSS, and Sheehan Disability Scale (SDS were administered. Internal consistency, convergent validity and factor loadings were assessed at initial assessment. Test-retest reliability was assessed using data collected from 107 students at 3 months after baseline. Mean score on the RS was 111.19. Cronbach's alpha coefficients for the RS and RS-14 were 0.90 and 0.88, respectively. The test-retest correlation coefficients for the RS and RS-14 were 0.83 and 0.84, respectively. Both the RS and RS-14 were negatively correlated with the CES-D and SDS, and positively correlated with the RSES, SSQ and PSS (all p Conclusions This study demonstrates that the Japanese version of RS has psychometric properties with high degrees of internal consistency, high test-retest reliability, and relatively low concurrent validity. RS-14 was equivalent to the RS in internal consistency, test-retest reliability, and concurrent validity. Low scores on the RS, a positive correlation between the RS and perceived stress, and a relatively low correlation between the RS and depressive symptoms in this study suggest that validity of the Japanese version of the RS might be relatively low compared with the original English version.

  18. Public knowledge and public trust.

    Science.gov (United States)

    Cunningham-Burley, Sarah

    2006-01-01

    As health care applications derived from human genetics research are likely to move increasingly from 'clinic to community', there is growing interest not just in how patients understand and take up health-related genetic information but also in the views of the wider population, as well as a range of professional groups. In this paper, issues relating public knowledge and public trust are raised and discussed in an attempt to move forward debates about public involvement in genomic research and the role of sociologists within interdisciplinary teams. As the field of public understanding of science has developed, we have seen a shift from a focus on the lack of scientific literacy as problem to a recognition of the range of different knowledges that people have and use as they confront science and technology in their everyday lives. As a mood for dialogue pervades many institutions in their relations with 'publics', attention must now be paid to the way in which knowledge and expertise is expressed, heard and acted upon in dialogic encounters. There is increasing concern about public trust in science and calls to increase public confidence, particularly through more open engagement with a range of publics. However, lack of trust or loss of confidence may be constructed as problems rather than reflecting empirical reality, where more complex relationships and attitudes prevail. Lack of trust is often privatized, deeply rooted in lived experience and routinely managed. Trust relations are generally characterized by ambivalence, uncertainty and risk, and are always provisional. Drawing on selected literature and empirical research to review and illustrate this field, this paper argues that scepticism or ambivalence on the part of publics are not necessarily problems to be overcome in the interest of scientific progress, but rather should be mobilized to enhance open and public debates about the nature and direction of genomics research, medicine, and the related

  19. Publications of LASL research, 1978

    Energy Technology Data Exchange (ETDEWEB)

    Willis, J.K.; Salazar, C.A. (comps.)

    1980-04-01

    This bibliography is a compilation of unclassified publications of work done at the Los Alamos Scientific Laboratory for 1978. Papers published in 1978 are included regardless of when they were actually written. Publications received too late for inclusion in earlier compilations are also listed. Declassification of previously classified reports is considered to constitute publication. All classified issuances are omitted. If a paper was published more than once, all places of publication are included. The bibliography includes Los Alamos Scientific Laboratory reports, papers released as non-LASL reports, journal articles, books, chapters of books, conference papers (whether published separately or as part of conference proceedings issued as books or reports), papers published in congressional hearings, theses, and US patents. Publications by LASL authors that are not records of Laboratory-sponsored work are also included.

  20. Bullying Prevention for Public Health Practitioners

    Centers for Disease Control (CDC) Podcasts

    2012-01-19

    This podcast discusses bullying as a public health problem, and provides information and resources for public health practitioners.  Created: 1/19/2012 by National Center for Injury Prevention and Control (NCIPC).   Date Released: 1/19/2012.

  1. Pig genome sequence - analysis and publication strategy

    DEFF Research Database (Denmark)

    Archibald, Alan L.; Bolund, Lars; Churcher, Carol

    2010-01-01

    preferentially selected for sequencing. In accordance with the Bermuda and Fort Lauderdale agreements and the more recent Toronto Statement the data have been released into public sequence repositories (Genbank/EMBL, NCBI/Ensembl trace repositories) in a timely manner and in advance of publication. CONCLUSIONS...

  2. First Release of Gauss-Legendre Sky Pixelization (GLESP) software package for CMB analysis

    CERN Document Server

    Doroshkevich, A G; Verkhodanov, O V; Novikov, D I; Turchaninov, V I; Novikov, I D; Christensen, P R; Chiang, L Y

    2005-01-01

    We report the release of the Gauss--Legendre Sky Pixelization (GLESP) software package version 1.0. In this report we present the main features and functions for processing and manipulation of sky signals. Features for CMB polarization is underway and to be incorporated in a future release. Interested readers can visit http://www.glesp.nbi.dk (www.glesp.nbi.dk) and register for receiving the package.

  3. SCAMPI Upgrade Team: Scoping and Sampling in SCAMPI Version 1.3

    Science.gov (United States)

    2016-06-07

    2010 Carnegie Mellon University SCAMPI Upgrade Team: Scoping and Sampling in SCAMPI Version 1.3 Software Engineering Institute Carnegie Mellon...PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Carnegie Mellon University , Software ... University Pittsburgh, PA 15213 Webinar - May 25, 2010 Report Documentation Page Form ApprovedOMB No. 0704-0188 Public reporting burden for the

  4. Distributed Nonlinear MPC of Multi-Agent Systems with Data Compression and Random Delays - Extended Version

    OpenAIRE

    El-Ferik, Sami; Siddiqui, Bilal A.; Frank L. Lewis

    2015-01-01

    This is an extended version of a technical note accepted for publication in IEEE Transactions on Automatic Control. The note proposes an Input to State practically Stable (ISpS) formulation of distributed nonlinear model predictive controller (NMPC) for formation control of constrained autonomous vehicles in presence of communication bandwidth limitation and transmission delays. Planned trajectories are compressed using neural networks resulting in considerable reduction of data packet size, ...

  5. Public opinion on public services

    NARCIS (Netherlands)

    Evelien Eggink; Debbie Verbeek-Oudijk; Evert Pommer

    2013-01-01

    Original titel: Burgers over de kwaliteit van publieke diensten Most citizens come into contact with public services, for example as a patient, as a student or pupil, as a passenger on public transport or as a museum visitor. More and more importance is being attached to the quality of those service

  6. Interactive tag cloud visualization of software version control repositories

    CSIR Research Space (South Africa)

    Greene, GJ

    2015-09-01

    Full Text Available Visualization of Software: Version Control Repositories Gillian J. Greene and Bernd Fischer Abstract: Version control repositories contain a wealth of implicit information that can be used to answer many questions about a project’s development process...

  7. Global Historical Climatology Network - Monthly (GHCN-M), Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Please note, the temperature portion of this dataset has been superseded by a newer version. Users should not use this version except in rare cases (e.g., when...

  8. National Land Cover Database 2001 Version 2: 1985-2006

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The National Land Cover Database 2001 Version 2 (NLCD 2001 Version 2) is being compiled across all 50 states and Puerto Rico as a cooperative mapping effort of the...

  9. National Land Cover Database 2001 Version 2: 1985-2006

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The National Land Cover Database 2001 Version 2 (NLCD 2001 Version 2) is being compiled across all 50 states and Puerto Rico as a cooperative mapping effort of the...

  10. Progress Towards AIRS Science Team Version-7 at SRT

    Science.gov (United States)

    Susskind, Joel; Blaisdell, John; Iredell, Lena; Kouvaris, Louis

    2016-01-01

    The AIRS Science Team Version-6 retrieval algorithm is currently producing level-3 Climate Data Records (CDRs) from AIRS that have been proven useful to scientists in understanding climate processes. CDRs are gridded level-3 products which include all cases passing AIRS Climate QC. SRT has made significant further improvements to AIRS Version-6. At the last Science Team Meeting, we described results using SRT AIRS Version-6.22. SRT Version-6.22 is now an official build at JPL called 6.2.4. Version-6.22 results are significantly improved compared to Version-6, especially with regard to water vapor and ozone profiles. We have adapted AIRS Version-6.22 to run with CrIS/ATMS, at the Sounder SIPS which processed CrIS/ATMS data for August 2014. JPL AIRS Version-6.22 uses the Version-6 AIRS tuning coefficients. AIRS Version-6.22 has at least two limitations which must be improved before finalization of Version-7: Version-6.22 total O3 has spurious high values in the presence of Saharan dust over the ocean; and Version-6.22 retrieved upper stratospheric temperatures are very poor in polar winter. SRT Version-6.28 addresses the first concern. John Blaisdell ran the analog of AIRS Version-6.28 in his own sandbox at JPL for the 14th and 15th of every month in 2014 and all of July and October for 2014. AIRS Version-6.28a is hot off the presses and addresses the second concern.

  11. Version 3 of the GEOMAGIA50 Paleomagnetic Database

    Science.gov (United States)

    Brown, M. C.; Donadini, F.; Nilsson, A.; Korte, M. C.; Panovska, S.; Frank, U.; Korhonen, K.; Lodge, A.; Lengyel, S. N.; Schuberth, M.; Constable, C.

    2015-12-01

    Version 3 of GEOMAGIA50 is the product of an international collaboration to develop a comprehensive online database that allows easy access to published paleomagnetic and chronological data from the past 50 ka. The overarching scientific goal is to improve our understanding of changes in the geomagnetic field, with applications ranging from the deep Earth, to past environments and climate, to the interaction of the geomagnetic field with the space environment. We present the large range of modifications made to the database since its initial release in 2006. The most significant is the addition of paleomagnetic, rock magnetic and chronological data obtained from lake and marine sediments. An emphasis has been placed on geochronological data from sediments and the database includes comprehensive radiocarbon age data, oxygen isotope data, varve ages and tephra ages. In the archeomagnetic and volcanic database, the amount of declination, inclination and paleointensity data has been increased greatly and now exceeds 15,000. In addition, a number of new metadata fields have been added, e.g., more specific information about the archaeological or volcanic sites the data were obtained from. Finally, the web interface has been updated. This includes a new query form for the sediment database and improved functionality of the archeomagnetic and volcanic query form. The webpage can be found at found at http://geomagia.gfz-potsdam.de.

  12. SCOR: Structural Classification of RNA, version 2.0.

    Science.gov (United States)

    Tamura, Makio; Hendrix, Donna K; Klosterman, Peter S; Schimmelman, Nancy R B; Brenner, Steven E; Holbrook, Stephen R

    2004-01-01

    SCOR, the Structural Classification of RNA (http://scor.lbl.gov), is a database designed to provide a comprehensive perspective and understanding of RNA motif three-dimensional structure, function, tertiary interactions and their relationships. SCOR 2.0 represents a major expansion and introduces a new classification organization. The new version represents the classification as a Directed Acyclic Graph (DAG), which allows a classification node to have multiple parents, in contrast to the strictly hierarchical classification used in SCOR 1.2. SCOR 2.0 supports three types of query terms in the updated search engine: PDB or NDB identifier, nucleotide sequence and keyword. We also provide parseable XML files for all information. This new release contains 511 RNA entries from the PDB as of 15 May 2003. A total of 5880 secondary structural elements are classified: 2104 hairpin loops and 3776 internal loops. RNA motifs reported in the literature, such as 'Kink turn' and 'GNRA loops', are now incorporated into the structural classification along with definitions and descriptions.

  13. SCOR: Structural classification of RNA, Version 2.0

    Energy Technology Data Exchange (ETDEWEB)

    Tamura, Makio; Hendrix, Donna K.; Klosterman, Peter

    2003-10-03

    SCOR (http://scor.lbl.gov), the Structural Classification of RNA, is a database designed to provide a comprehensive perspective and understanding of RNA motif three-dimensional structure, function, tertiary interactions, and their relationships. SCOR 2.0 represents a major expansion and introduces a wholly new classification system. The new version represents the classification as a Directed Acyclic Graph (DAG), which allows a classification node to have multiple parents, in contrast to the strictly hierarchical classification used in SCOR 1.2. SCOR 2.0 supports three types of query terms in the updated search engine: PDB or NDB identifier, nucleotide sequence, and keyword. We also provide parseable XML files for all information. This new release contains 511RNA entries from the PDB as of 15 May 2003. A total of 5,880 secondary structural elements are classified; 2,104 hairpin loops and 3,776 internal loops. RNA motifs reported in the literature, such as ''Kinkturn'' and ''GNRA loops,'' are now incorporated into the structural classification along with definitions and descriptions.

  14. MESOI Version 2. 0: an interactive mesoscale Lagrangian puff dispersion model with deposition and decay

    Energy Technology Data Exchange (ETDEWEB)

    Ramsdell, J.V.; Athey, G.F.; Glantz, C.S.

    1983-11-01

    MESOI Version 2.0 is an interactive Lagrangian puff model for estimating the transport, diffusion, deposition and decay of effluents released to the atmosphere. The model is capable of treating simultaneous releases from as many as four release points, which may be elevated or at ground-level. The puffs are advected by a horizontal wind field that is defined in three dimensions. The wind field may be adjusted for expected topographic effects. The concentration distribution within the puffs is initially assumed to be Gaussian in the horizontal and vertical. However, the vertical concentration distribution is modified by assuming reflection at the ground and the top of the atmospheric mixing layer. Material is deposited on the surface using a source depletion, dry deposition model and a washout coefficient model. The model also treats the decay of a primary effluent species and the ingrowth and decay of a single daughter species using a first order decay process. This report is divided into two parts. The first part discusses the theoretical and mathematical bases upon which MESOI Version 2.0 is based. The second part contains the MESOI computer code. The programs were written in the ANSI standard FORTRAN 77 and were developed on a VAX 11/780 computer. 43 references, 14 figures, 13 tables.

  15. Allegheny County Toxics Release Inventory

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The Toxics Release Inventory (TRI) data provides information about toxic substances released into the environment or managed through recycling, energy recovery, and...

  16. A Comparative Analysis of English and Chinese Versions of Twilight from the Perspective of Three Metafunctions

    Institute of Scientific and Technical Information of China (English)

    邓雪莹

    2013-01-01

    The Twilight Saga written by American novelist Stephenie Meyer, tells the love story about an ordinary girl, Bella, and a handsome vampire, Edward. The novel sales hit the one hundred million mark from its release. And its Chinese version also gains much popularity among Chinese readers. Up to now, fantasy novel and its translation have drawn increasing attention of scholars from home and abroad. This paper focuses on a fantasy novel which has never been analyzed from this perspective. The paper makes a comparison between the English and Chinese versions of the novel Twilight from the perspective of Halliday’s three metafunctions, interpersonal function, ideational function and textual function, to give an in-depth study on the similarities and differences of two different languages and then put forward some beneficial suggestions for translators to understand and trans-late fantasy novel comprehensively.

  17. Toxics Release Inventory reporting: Focus on the electric utility industry

    Energy Technology Data Exchange (ETDEWEB)

    Biden, D.; Cain, R.D.; Hoone, D.; Duncan, M.F.; O' Reilly, M.J.; Dodson, S.; Koch, L.L.; Novitsky, W.M.; Ogitis, R.S.; Farkas, S.M.

    1999-07-01

    The look of EPA's annual Toxics Release Inventory Report (TRI) is about to change. Starting in the 1998 reporting year seven new industries are required to report TRI releases. The electric utility industry will join the chemical industry and others who have reported under TRI rules for the last ten years. A major change to EPA's report will be the top ten chemical list. The TRI releases that the electric utility sector will report are of a different chemical composition than those from manufacturing. Because of the layout of the TRI database, the large quantities of utility releases will shift the public focus away from organic constituents to that of less familiar combustion by-products. The resulting shift of reported chemicals could rekindle and intensify interest in air related issues such as acid rain, global warming, and deforestation, and result in public confusion over the health and safety implications associated with releases generated by coal combustion. The nature of the electric generation marketplace will also make year-to-year and company-to-company chemical release comparisons difficult with the present framework of EPA's publication of TRI data.

  18. Public Sociology

    DEFF Research Database (Denmark)

    What is the role of sociology in society? How can - and should - sociology contribute with insights relevant and useful to the outside world? Is sociology attuned to accommodate the demands of the wider public and of surrounding society? Who benefits from the knowledge produced and provided...... by sociology? What are the social implications and cultural effects of the knowledge sociology provides and creates? All of these questions, and many others, concern and centre on sociology's relationship to the surrounding society, in short to the ‘public'. All of these questions - and many others...... irrelevance and introversion and the Charybdis of public relevancy and extroversion. But what does it mean to be a ‘public sociologist' in contemporary society and are there really any other ways of doing sociology? What are the requirements of sociologists in a social world increasingly informed and shaped...

  19. Miscellaneous Publications

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Late 19th century Weather Bureau publications and Congressional reports pertaining to weather. Set of Weather Bureau Snowfall Bulletins for Rocky Mountain states...

  20. Public Airports

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This data set is a vector point digital data structure that contains the locations of General Public Use Airports in the State of New Mexico. It only contains those...

  1. The SAMI Galaxy Survey: Early Data Release

    CERN Document Server

    Allen, J T; Konstantopoulos, I S; Bryant, J J; Sharp, R; Cecil, G N; Fogarty, L M R; Foster, C; Green, A W; Ho, I -T; Owers, M S; Schaefer, A L; Scott, N; Bauer, A E; Baldry, I; Barnes, L A; Bland-Hawthorn, J; Bloom, J V; Brough, S; Colless, M; Cortese, L; Couch, W J; Drinkwater, M J; Driver, S P; Goodwin, M; Gunawardhana, M L P; Hampton, E J; Hopkins, A M; Kewley, L J; Lawrence, J S; Leon-Saval, S G; Liske, J; López-Sánchez, Á R; Lorente, N P F; Medling, A M; Mould, J; Norberg, P; Parker, Q A; Power, C; Pracy, M B; Richards, S N; Robotham, A S G; Sweet, S M; Taylor, E N; Thomas, A D; Tonini, C; Walcher, C J

    2014-01-01

    We present the Early Data Release of the Sydney-AAO Multi-object Integral field spectrograph (SAMI) Galaxy Survey. The SAMI Galaxy Survey is an ongoing integral field spectroscopic survey of ~3400 low-redshift (z<0.12) galaxies, covering galaxies in the field and in groups within the Galaxy And Mass Assembly (GAMA) survey regions, and a sample of galaxies in clusters. In the Early Data Release, we publicly release the fully calibrated datacubes for a representative selection of 107 galaxies drawn from the GAMA regions, along with information about these galaxies from the GAMA catalogues. All datacubes for the Early Data Release galaxies can be downloaded individually or as a set from the SAMI Galaxy Survey website. In this paper we also assess the quality of the pipeline used to reduce the SAMI data, giving metrics that quantify its performance at all stages in processing the raw data into calibrated datacubes. The pipeline gives excellent results throughout, with typical sky subtraction residuals of 0.9-1...

  2. 16 CFR 460.7 - Which test version to use.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Which test version to use. 460.7 Section 460.7 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES LABELING AND ADVERTISING OF HOME INSULATION § 460.7 Which test version to use. Use the version of the ASTM test method that was...

  3. Geant4 - Towards major release 10

    Science.gov (United States)

    Cosmo, G.; Geant4 Collaboration

    2014-06-01

    The Geant4 simulation toolkit has reached maturity in the middle of the previous decade, providing a wide variety of established features coherently aggregated in a software product, which has become the standard for detector simulation in HEP and is used in a variety of other application domains. We review the most recent capabilities introduced in the kernel, highlighting those, which are being prepared for the next major release (version 10.0) that is scheduled for the end of 2013. A significant new feature contained in this release will be the integration of multi-threading processing, aiming at targeting efficient use of modern many-cores system architectures and minimization of the memory footprint for exploiting event-level parallelism. We discuss its design features and impact on the existing API and user-interface of Geant4. Revisions are made to balance the need for preserving backwards compatibility and to consolidate and improve the interfaces; taking into account requirements from the multithreaded extensions and from the evolution of the data processing models of the LHC experiments.

  4. Heat release mechanism of energetics

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, N. [Third Research Center, Technical Research and development Institute (Japan)

    1996-12-31

    Determination of the heat release mechanism of energetic materials is a major subject of combustion study. In order to elucidate the combustion process of various types of energetic materials a generalized combustion wave structure was proposed and the heat release process was discussed. The heat release process was significantly different between the physical structures of the materials: homogeneous and heterogeneous materials. The thermal structure of an azide polymer was evaluated to demonstrate the heat release mechanism. (author) 6 refs.

  5. Public meetings

    CERN Multimedia

    Staff Association

    2017-01-01

    Do you have questions about the elections to the Staff Council, 2017 MERIT exercise, EVE and School, LD to IC exercise, CHIS, the Pension Fund… Come get informed and ask your questions at our public meetings. These public meetings are also an opportunity to get the more information on current issues. Benefit from this occasion to get the latest news and to discuss with the representatives of the statutory body that is the Staff Association!

  6. DOE-2 sample run book: Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch (James J.) and Associates, Camarillo, CA (United States)

    1993-11-01

    The DOE-2 Sample Run Book shows inputs and outputs for a variety of building and system types. The samples start with a simple structure and continue to a high-rise office building, a medical building, three small office buildings, a bar/lounge, a single-family residence, a small office building with daylighting, a single family residence with an attached sunspace, a ``parameterized`` building using input macros, and a metric input/output example. All of the samples use Chicago TRY weather. The main purpose of the Sample Run Book is instructional. It shows the relationship of LOADS-SYSTEMS-PLANT-ECONOMICS inputs, displays various input styles, and illustrates many of the basic and advanced features of the program. Many of the sample runs are preceded by a sketch of the building showing its general appearance and the zoning used in the input. In some cases we also show a 3-D rendering of the building as produced by the program DrawBDL. Descriptive material has been added as comments in the input itself. We find that a number of users have loaded these samples onto their editing systems and use them as ``templates`` for creating new inputs. Another way of using them would be to store various portions as files that can be read into the input using the {number_sign}{number_sign} include command, which is part of the Input Macro feature introduced in version DOE-2.lD. Note that the energy rate structures here are the same as in the DOE-2.lD samples, but have been rewritten using the new DOE-2.lE commands and keywords for ECONOMICS. The samples contained in this report are the same as those found on the DOE-2 release files. However, the output numbers that appear here may differ slightly from those obtained from the release files. The output on the release files can be used as a check set to compare results on your computer.

  7. Fuzzy Versions of Epistemic and Deontic Logic

    Science.gov (United States)

    Gounder, Ramasamy S.; Esterline, Albert C.

    1998-01-01

    Epistemic and deontic logics are modal logics, respectively, of knowledge and of the normative concepts of obligation, permission, and prohibition. Epistemic logic is useful in formalizing systems of communicating processes and knowledge and belief in AI (Artificial Intelligence). Deontic logic is useful in computer science wherever we must distinguish between actual and ideal behavior, as in fault tolerance and database integrity constraints. We here discuss fuzzy versions of these logics. In the crisp versions, various axioms correspond to various properties of the structures used in defining the semantics of the logics. Thus, any axiomatic theory will be characterized not only by its axioms but also by the set of properties holding of the corresponding semantic structures. Fuzzy logic does not proceed with axiomatic systems, but fuzzy versions of the semantic properties exist and can be shown to correspond to some of the axioms for the crisp systems in special ways that support dependency networks among assertions in a modal domain. This in turn allows one to implement truth maintenance systems. For the technical development of epistemic logic, and for that of deontic logic. To our knowledge, we are the first to address fuzzy epistemic and fuzzy deontic logic explicitly and to consider the different systems and semantic properties available. We give the syntax and semantics of epistemic logic and discuss the correspondence between axioms of epistemic logic and properties of semantic structures. The same topics are covered for deontic logic. Fuzzy epistemic and fuzzy deontic logic discusses the relationship between axioms and semantic properties for these logics. Our results can be exploited in truth maintenance systems.

  8. Brazilian version of the Berg balance scale

    Directory of Open Access Journals (Sweden)

    Miyamoto S.T.

    2004-01-01

    Full Text Available The purpose of the present study was to translate and adapt the Berg balance scale, an instrument for functional balance assessment, to Brazilian-Portuguese and to determine the reliability of scores obtained with the Brazilian adaptation. Two persons proficient in English independently translated the original scale into Brazilian-Portuguese and a consensus version was generated. Two translators performed a back translation. Discrepancies were discussed and solved by a panel. Forty patients older than 65 years and 40 therapists were included in the cultural adaptation phase. If more than 15% of therapists or patients reported difficulty in understanding an item, that item was reformulated and reapplied. The final Brazilian version was then tested on 36 elderly patients (over age 65. The average age was 72 years. Reliability of the measure was assessed twice by one physical therapist (1-week interval between assessments and once by one independent physical therapist. Descriptive analysis was used to characterize the patients. The intraclass correlation coefficient (ICC and Pearson's correlation coefficient were computed to assess intra- and interobserver reliability. Six questions were modified during the translation stage and cultural adaptation phase. The ICC for intra- and interobserver reliability was 0.99 (P < 0.001 and 0.98 (P < 0.001, respectively. The Pearson correlation coefficient for intra- and interobserver reliability was 0.98 (P < 0.001 and 0.97 (P < 0.001, respectively. We conclude that the Brazilian version of the Berg balance scale is a reliable instrument to be used in balance assessment of elderly Brazilian patients.

  9. Press releases — the new trend in science communication

    DEFF Research Database (Denmark)

    Autzen, Charlotte

    2014-01-01

    Scientific institutions have for a long time known the importance of framing and owning stories about science They also know the effective way of communicating science in a press release This is part of the institution’s public relations. Enhanced competition among research institutions has led...... releases from trustworthy scientific institutions into free and easily copied content for the editors. In this commentary I investigate and discuss the communicative ecosystem of the university press release. I especially take a close look at the role of the critical and independent science journalist...

  10. UQTk version 2.0 user manual.

    Energy Technology Data Exchange (ETDEWEB)

    Debusschere, Bert J.; Sargsyan, Khachik; Safta, Cosmin

    2013-10-01

    The UQ Toolkit (UQTk) is a collection of libraries and tools for the quanti cation of uncer- tainty in numerical model predictions. Version 2.0 o ers intrusive and non-intrusive methods for propagating input uncertainties through computational models, tools for sensitivity anal- ysis, methods for sparse surrogate construction, and Bayesian inference tools for inferring parameters from experimental data. This manual discusses the download and installation process for UQTk, provides pointers to the UQ methods used in the toolkit, and describes some of the examples provided with the toolkit.

  11. A GENERALIZED VERSION OF PLAY FAIR CIPHER

    Directory of Open Access Journals (Sweden)

    Jitendra Choudhary

    2013-06-01

    Full Text Available In this paper, we have generalized and modified the play fair cipher. We have introduced confusion and diffusion. The cryptanalysis carried out in this analysis has shown that the proposed play fair cipher is a strong one. The role of cryptography in today’s world is increasing day by day. Information is flowing from are place to another on the network. One most common cryptography technique is substitution cipher. Play fair is most common substitution cipher. In this paper, we present a generalized version of play fair ciphers. Encryption/decryption is a very popular task. We also explain the fundamentals of sequential cryptography.

  12. ALT-3 Target & CMU Version 4

    Energy Technology Data Exchange (ETDEWEB)

    Griego, Jeffrey R [Los Alamos National Laboratory; Atchison, Walter L. [Los Alamos National Laboratory; Holtkamp, David [Los Alamos National Laboratory; Oro, David M. [Los Alamos National Laboratory; Reinovsky, Robert E. [Los Alamos National Laboratory; Rousculp, Christopher L. [Los Alamos National Laboratory; Tabaka, Leonard J. [Los Alamos National Laboratory

    2012-06-11

    The third Advance Liner Technology (ALT-3) experiment is the next in a long tradition of collaborations between LANL and RFNC/VNIIEF in high-explosive pulsed-power. Here a VNIIEF provided Disk Explosive Magnetic Generator (DEMG) will drive a LANL provided experimental load and diagnostic package. The objective of the experiment is to explore the use of a cylindrical liner-ontarget in tera-Pascal equation of state measurement. This presentation will discuss version 4 of the experimental target and central measuring unit (CMU) along with R & D already performed in fabrication of the target.

  13. Python pocket reference, version 2.4

    CERN Document Server

    Lutz, Mark

    2005-01-01

    Python is optimized for quality, productivity, portability, and integration. Hundreds of thousands of Python developers around the world rely on Python for general-purpose tasks, Internet scripting, systems programming, user interfaces, and product customization. Available on all major computing platforms, including commercial versions of Unix, Linux, Windows, and Mac OS X, Python is portable, powerful and remarkable easy to use. With its convenient, quick-reference format, Python Pocket Reference, 3rd Edition is the perfect on-the-job reference. More importantly, it's now been refreshed

  14. A Functional Version of the ARCH Model

    CERN Document Server

    Hormann, Siegfried; Reeder, Ron

    2011-01-01

    Improvements in data acquisition and processing techniques have lead to an almost continuous flow of information for financial data. High resolution tick data are available and can be quite conveniently described by a continuous time process. It is therefore natural to ask for possible extensions of financial time series models to a functional setup. In this paper we propose a functional version of the popular ARCH model. We will establish conditions for the existence of a strictly stationary solution, derive weak dependence and moment conditions, show consistency of the estimators and perform a small empirical study demonstrating how our model matches with real data.

  15. Development of environmental dose assessment system (EDAS) code of PC version

    Energy Technology Data Exchange (ETDEWEB)

    Taki, Mitsumasa; Kikuchi, Masamitsu; Kobayashi, Hideo; Yamaguchi, Takenori [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2003-05-01

    A computer code (EDAS) was developed to assess the public dose for the safety assessment to get the license of nuclear reactor operation. This code system is used for the safety analysis of public around the nuclear reactor in normal operation and severe accident. This code was revised and composed for personal computer user according to the Nuclear Safety Guidelines reflected the ICRP1990 recommendation. These guidelines are revised by Nuclear Safety Commission on March, 2001, which are 'Weather analysis guideline for the safety assessment of nuclear power reactor', 'Public dose around the facility assessment guideline corresponding to the objective value for nuclear power light water reactor' and 'Public dose assessment guideline for safety review of nuclear power light water reactor'. This code has been already opened for public user by JAERI, and English version code and user manual are also prepared. This English version code is helpful for international cooperation concerning the nuclear safety assessment with JAERI. (author)

  16. PERCC Tools: Public Health Preparedness for Clinicians

    Centers for Disease Control (CDC) Podcasts

    2011-08-29

    CDC’s Office of Public Health Preparedness and Response funds Preparedness and Emergency Response Research Centers (PERRCs) to examine components of the public health system. This podcast is an overview of mental and behavioral health tools developed by the Johns Hopkins PERRC.  Created: 8/29/2011 by Emergency Risk Communication Branch (ERCB)/Joint Information Center (JIC); Office of Public Health Preparedness and Response (OPHPR).   Date Released: 8/30/2011.

  17. Casbar User’s Guide - Version 2

    Science.gov (United States)

    2013-05-01

    controls the order of time integra- tion accuracy: 1 Euler method of update (rst order). 2 (default) Predictor- corrector method (second or- der). cfl...grains and the gas phase. Hot gas will transfer energy to the cooler grains, which is released back into the gas phase when the solid combusts. Two heat

  18. TAE+ 5.1 - TRANSPORTABLE APPLICATIONS ENVIRONMENT PLUS, VERSION 5.1 (SUN3 VERSION WITH MOTIF)

    Science.gov (United States)

    TAE SUPPORT OFFICE

    1994-01-01

    workbench-generated resource files during each execution, details such as color, font, location, and object type remain independent from the application code, allowing changes to the user interface without recompiling and relinking. The Silicon Graphics version of TAE Plus now has a font caching scheme and a color caching scheme to make color allocation more efficient. In addition to WPTs, TAE Plus can control interaction of objects from the interpreted TAE Command Language. TCL provides an extremely powerful means for the more experienced developer to quickly prototype an application's use of TAE Plus interaction objects and add programming logic without the overhead of compiling or linking. TAE Plus requires MIT's X Window System, Version 11 Release 4, and the Open Software Foundation's Motif Toolkit 1.1 or 1.1.1. The Workbench and WPTs are written in C++ and the remaining code is written in C. TAE Plus is available by license for an unlimited time period. The licensed program product includes the TAE Plus source code and one set of supporting documentation. Additional documentation may be purchased separately at the price indicated below. The amount of disk space required to load the TAE Plus tar format tape is between 35Mb and 67Mb depending on the machine version. The recommended minimum memory is 12Mb. Each TAE Plus platform delivery tape includes pre-built libraries and executable binary code for that particular machine, as well as source code, so users do not have to do an installation. Users wishing to recompile the source will need both a C compiler and either GNU's C++ Version 1.39 or later, or a C++ compiler based on AT&T 2.0 cfront. TAE Plus comes with InterViews and idraw, two software packages developed by Stanford University and integrated in TAE Plus. TAE Plus was developed in 1989 and version 5.1 was released in 1991. TAE Plus is currently available on media suitable for eight different machine platforms: 1) DEC VAX computers running VMS 5.3 or higher (TK

  19. Digital Format for Depositary Part of Scientific Publications' Collection

    Science.gov (United States)

    Zemskov, Andrei; Evstigneeva, Galina

    As a rule, any large library has so called depositary part of collection. Specific circulation of these publications is not high, but preservation, conservation and provision of access to given collection need permanent efforts. The paper presents evaluation of expenses and centralized systems efficiency. These systems (e.g. JSTOR, Backfiles for Future) are publicly accessible collections of full text versions of scientific periodicals.

  20. 10 CFR 9.21 - Publicly available records.

    Science.gov (United States)

    2010-01-01

    ... available records. (a) Single copies of NRC publications in the NUREG series, NRC Regulatory Guides, and..., Documents Made Publicly Available (NUREG-0540) after March 1999. (d) The published versions of the records... Regulatory Issuances, NUREG-0750, for purchase through the National Technical Information Service....

  1. Is bioexsiccation releasing dioxins?

    Energy Technology Data Exchange (ETDEWEB)

    Benfenati, E.; Mariani, G.; Lodi, M.; Reitano, G.; Fanelli, R. [' ' Mario Negri' ' Institute for Pharmacological Research, Milan (Italy)

    2004-09-15

    Bioexsiccation is a relatively new process to treat urban solid wastes. We studied the possible release of dioxins from this process, measuring dioxin concentration in the emissions from a bioexsiccation plant. As a comparison, we measured atmospheric levels nearby the plant. The biofilter treating gaseous emissions was also evaluated to assess its efficiency. Dioxin concentrations in the biofilter effluent were lower than both those before the biofilter and the nearby atmosphere. In the last years the management and treatment of solid urban wastes produced some improved processes, in a general attempt to cope with the problem of the huge amount of wastes produced by the modern society. Bio-exsiccation of waste aims at affording a much more biologically inert and manageable material compared to the original waste. In this process the urban solid waste is kept under an air stream for about two weeks. The waste undergoes biological transformation, due to fermentation, which produces an increase of the temperature up to 60-70 C. At the end of the process the weight waste is typically reduced by one third, due to the loss of water and to the degradation of putrescible compounds. Since this is a relatively new industrial process, we studied the possible release of dioxins in the atmospheric emissions of the bioexsiccation plant.

  2. The Expanded Capabilities Of The Cementitious Barriers Partnership Software Toolbox Version 2.0 - 14331

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Heather; Flach, Greg; Smith, Frank; Langton, Christine; Brown, Kevin; Kosson, David; Samson, Eric; Mallick, Pramod

    2014-01-10

    The Cementitious Barriers Partnership (CBP) Project is a multi-disciplinary, multi-institutional collaboration supported by the U.S. Department of Energy (US DOE) Office of Tank Waste Management. The CBP program has developed a set of integrated tools (based on state-of-the-art models and leaching test methods) that help improve understanding and predictions of the long-term structural, hydraulic and chemical performance of cementitious barriers used in nuclear applications. The CBP Software Toolbox – “Version 1.0” was released early in FY2013 and was used to support DOE-EM performance assessments in evaluating various degradation mechanisms that included sulfate attack, carbonation and constituent leaching. The sulfate attack analysis predicted the extent and damage that sulfate ingress will have on concrete vaults over extended time (i.e., > 1000 years) and the carbonation analysis provided concrete degradation predictions from rebar corrosion. The new releaseVersion 2.0” includes upgraded carbonation software and a new software module to evaluate degradation due to chloride attack. Also included in the newer version are a dual regime module allowing evaluation of contaminant release in two regimes – both fractured and un-fractured. The integrated software package has also been upgraded with new plotting capabilities and many other features that increase the “user-friendliness” of the package. Experimental work has been generated to provide data to calibrate the models to improve the credibility of the analysis and reduce the uncertainty. Tools selected for and developed under this program have been used to evaluate and predict the behavior of cementitious barriers used in near-surface engineered waste disposal systems for periods of performance up to or longer than 100 years for operating facilities and longer than 1000 years for waste disposal. The CBP Software Toolbox is and will continue to produce tangible benefits to the working DOE

  3. DEMAID - A DESIGN MANAGER'S AID FOR INTELLIGENT DECOMPOSITION (SGI IRIS VERSION)

    Science.gov (United States)

    Rogers, J. L.

    1994-01-01

    effects of an output with respect to a change in a particular input. The second method traces backward to determine what modules must be re-executed if the output of a module must be recomputed. DeMAID is available in three machine versions: a Macintosh version which is written in Symantec's Think C 3.01, a Sun version, and an SGI IRIS version, both of which are written in C language. The Macintosh version requires system software 6.0.2 or later and CLIPS 4.3. The source code for the Macintosh version will not compile under version 4.0 of Think C; however, a sample executable is provided on the distribution media. QuickDraw is required for plotting. The Sun version requires GKS 4.1 graphics libraries, OpenWindows 3, and CLIPS 4.3. The SGI IRIS version requires CLIPS 4.3. Since DeMAID is not compatible with CLIPS 5.0 or later, the source code for CLIPS 4.3 is included on the distribution media; however, the documentation for CLIPS 4.3 is not included in the documentation package for DeMAID. It is available from COSMIC separately as the documentation for MSC-21208. The standard distribution medium for the Macintosh version of DeMAID is a set of four 3.5 inch 800K Macintosh format diskettes. The standard distribution medium for the Sun version of DeMAID is a .25 inch streaming magnetic tape cartridge (QIC-24) in UNIX tar format. The standard distribution medium for the IRIS version is a .25 inch IRIX compatible streaming magnetic tape cartridge in UNIX tar format. All versions include sample input. DeMAID was originally developed for use on VAX VMS computers in 1989. The Macintosh version of DeMAID was released in 1991 and updated in 1992. The Sun version of DeMAID was released in 1992 and updated in 1993. The SGI IRIS version was released in 1993.

  4. Pierre’s Rational and Public Beliefs

    Directory of Open Access Journals (Sweden)

    Victor M. Verdejo

    2012-12-01

    Full Text Available Paradigmatic cases of disagreement seem not to be compatible with a widespread kind of solution to Kripke’s celebrated Pierre puzzle. As a result, the classical puzzle about rational belief is shown to be also a puzzle about public disagreement/agreement phenomena. In this paper, I defend that the new public version of the puzzle is substantial and challenging and conclude that a full solution to Kripke’s considerations must offer a satisfactory account of both the rational and public character of belief attributions. I then argue that a notion of non-belief-individuating understanding is plausibly the key notion that would allow us to arrest both versions of the Pierre puzzle.

  5. An Introduction to Version Control Using GitHub Desktop

    Directory of Open Access Journals (Sweden)

    Daniel van Strien

    2016-06-01

    Full Text Available In this lesson you will be introduced to the basics of version control, understand why it is useful and implement basic version control for a plain text document using GitHub Desktop. By the end of this lesson you should understand: * what version control is and why it can be useful * the differences between Git and GitHub * how to implement version control using ‘GitHub Desktop,’ a Graphical User Interface for GitHub * be aware of other resources that will help you implement version control in your academic writing

  6. 76 FR 19023 - Commercial Driver's License Information System State Procedures Manual, Release 5.2.0

    Science.gov (United States)

    2011-04-06

    ... Information System State Procedures Manual, Release 5.2.0 AGENCY: Federal Motor Carrier Safety Administration... Driver's License Information System (CDLIS) State Procedures Manual (the Manual). All State driver licensing agencies would use this updated version of the Manual to develop the process required...

  7. PhosphoBase, a database of phosphorylation sites: release 2.0

    DEFF Research Database (Denmark)

    Kreegipuu, A.; Blom, Nikolaj; Brunak, Søren

    1999-01-01

    PhosphoBase contains information about phosphorylated residues in proteins and data about peptide phosphorylation by a variety of protein kinases. The data are collected from literature and compiled into a common format. The current release of PhosphoBase (October 1998, version 2.0) comprises 414...

  8. Release of the AKARI-FIS Bright Source Catalogue β-1

    NARCIS (Netherlands)

    Yamamura, I.; Makiuti, S.; Ikeda, N.; Fukuda, Y.; Yamauchi, C.; Hasegawa, S.; Nakagawa, T.; Narumi, H.; Baba, H.; Takagi, T.; Jeong, W.-S.; Oh, S. H.; Lee, H. M.; Savage, R.; Rahman, N.; Thomson, M.; Oliver, S.; Figueredo, E.; Serjeant, S.; White, G. J.; Pearson, C.; Wang, L.; Rowan-Robinson, M.; Kester, D.; van der Wolk, G.; Barthel, P.; Salama, A.; Alfageme, C.; García-Lario, P.; Stephenson, C.; Cohen, M.; Mueller, T. G.

    2009-01-01

    The AKARI; satellite has made an All-Sky Survey at six bands in the mid- and far-infrared spectral region. One of the primary goals of the AKARI survey is to produce all-sky infrared source catalogues. We report the release of the first version of the AKARI FIS Bright Source Catalogue (β-1) for four

  9. Acetylcholine Release in the Hippocampus and Striatum during Place and Response Training

    Science.gov (United States)

    Pych, Jason C.; Chang, Qing; Colon-Rivera, Cynthia; Haag, Renee; Gold, Paul E.

    2005-01-01

    These experiments examined the release of acetylcholine in the hippocampus and striatum when rats were trained, within single sessions, on place or response versions of food-rewarded mazes. Microdialysis samples of extra-cellular fluid were collected from the hippocampus and striatum at 5-min increments before, during, and after training. These…

  10. Two Mathematically Equivalent Versions of Maxwell's Equations

    Science.gov (United States)

    Gill, Tepper L.; Zachary, Woodford W.

    2011-01-01

    This paper is a review of the canonical proper-time approach to relativistic mechanics and classical electrodynamics. The purpose is to provide a physically complete classical background for a new approach to relativistic quantum theory. Here, we first show that there are two versions of Maxwell's equations. The new version fixes the clock of the field source for all inertial observers. However now, the (natural definition of the effective) speed of light is no longer an invariant for all observers, but depends on the motion of the source. This approach allows us to account for radiation reaction without the Lorentz-Dirac equation, self-energy (divergence), advanced potentials or any assumptions about the structure of the source. The theory provides a new invariance group which, in general, is a nonlinear and nonlocal representation of the Lorentz group. This approach also provides a natural (and unique) definition of simultaneity for all observers. The corresponding particle theory is independent of particle number, noninvariant under time reversal (arrow of time), compatible with quantum mechanics and has a corresponding positive definite canonical Hamiltonian associated with the clock of the source. We also provide a brief review of our work on the foundational aspects of the corresponding relativistic quantum theory. Here, we show that the standard square-root and Dirac equations are actually two distinct spin- 1/2 particle equations.

  11. Brazilian version of the Berg balance scale.

    Science.gov (United States)

    Miyamoto, S T; Lombardi Junior, I; Berg, K O; Ramos, L R; Natour, J

    2004-09-01

    The purpose of the present study was to translate and adapt the Berg balance scale, an instrument for functional balance assessment, to Brazilian-Portuguese and to determine the reliability of scores obtained with the Brazilian adaptation. Two persons proficient in English independently translated the original scale into Brazilian-Portuguese and a consensus version was generated. Two translators performed a back translation. Discrepancies were discussed and solved by a panel. Forty patients older than 65 years and 40 therapists were included in the cultural adaptation phase. If more than 15% of therapists or patients reported difficulty in understanding an item, that item was reformulated and reapplied. The final Brazilian version was then tested on 36 elderly patients (over age 65). The average age was 72 years. Reliability of the measure was assessed twice by one physical therapist (1-week interval between assessments) and once by one independent physical therapist. Descriptive analysis was used to characterize the patients. The intraclass correlation coefficient (ICC) and Pearson's correlation coefficient were computed to assess intra- and interobserver reliability. Six questions were modified during the translation stage and cultural adaptation phase. The ICC for intra- and interobserver reliability was 0.99 (P Berg balance scale is a reliable instrument to be used in balance assessment of elderly Brazilian patients.

  12. Bulletin publication 2007

    CERN Multimedia

    2007-01-01

    The table below lists the 2007 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 noon on Tuesdays at the latest. Bulletin No. (week No.) Publication date Submission of announcements (before 12:00 noon) 4-5 Monday 22 January Tuesday 16 January 6-7 Monday 5 February Tuesday 30 January 8-9 Monday 19 February Tuesday 13 February 10-11 Monday 5 March Tuesday 27 February 12-13 Monday 19 March Tuesday 13 March 14-15 Monday 2 April Tuesday 27 March 16-17 Monday 16 April Tuesday 10 April 18-19 Monday 30 April Tuesday 24 April 20-21 Monday 14 May Tuesday 8 May 22-23 Monday 28 May Tuesday 22 May 24-25 Monday 11 June Tuesday 5 June 26-27 Monday 25 June Tuesday 19 June 28-29 Monday 9 July Tuesday 3 July 30-31 Monday 23 July Tuesday 17 July 32-33-34 Monday 6 August Tuesday 31 July 35-36 Monday 27 August Tuesday 21 August...

  13. Bulletin publication 2007

    CERN Multimedia

    2006-01-01

    The table below lists the 2007 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 noon on Tuesdays at the latest. Bulletin No. (week No.) Publication date Submission of announcements (before 12:00 noon) 4-5 Monday 22 January Tuesday 16 January 6-7 Monday 5 February Tuesday 30 January 8-9 Monday 19 February Tuesday 13 February 10-11 Monday 5 March Tuesday 27 February 12-13 Monday 19 March Tuesday 13 March 14-15 Monday 2 April Tuesday 27 March 16-17 Monday 16 April Tuesday 10 April 18-19 Monday 30 April Tuesday 24 April 20-21 Monday 14 May Tuesday 8 May 22-23 Monday 28 May Tuesday 22 May 24-25 Monday 11 June Tuesday 5 June 26-27 Monday 25 June Tuesday 19 June 28-29 Monday 9 July Tuesday 3 July 30-31 Monday 23 July Tuesday 17 July 32-33-34 Monday 6 August Tuesday 31 July 35-36 Monday 27 August Tuesday 21 August...

  14. Is Julian Assange an International Version of Daniel Ellsberg and WikiLeaks the Modern Equivalent of the Pentagon Papers?

    Science.gov (United States)

    Freivogel, William H.

    2011-01-01

    History has placed the stamp of approval on the publication of the Pentagon Papers, the top-secret history of the Vietnam War. If WikiLeaks editor-in-chief Julian Assange is another Daniel Ellsberg, then it is possible the website's disclosures will be viewed over time as similarly in the public interest. A classroom discussion on the release of…

  15. Is Julian Assange an International Version of Daniel Ellsberg and WikiLeaks the Modern Equivalent of the Pentagon Papers?

    Science.gov (United States)

    Freivogel, William H.

    2011-01-01

    History has placed the stamp of approval on the publication of the Pentagon Papers, the top-secret history of the Vietnam War. If WikiLeaks editor-in-chief Julian Assange is another Daniel Ellsberg, then it is possible the website's disclosures will be viewed over time as similarly in the public interest. A classroom discussion on the release of…

  16. A new version of the ERICA tool to facilitate impact assessments of radioactivity on wild plants and animals.

    Science.gov (United States)

    Brown, J E; Alfonso, B; Avila, R; Beresford, N A; Copplestone, D; Hosseini, A

    2016-03-01

    A new version of the ERICA Tool (version 1.2) was released in November 2014; this constitutes the first major update of the Tool since release in 2007. The key features of the update are presented in this article. Of particular note are new transfer databases extracted from an international compilation of concentration ratios (CRwo-media) and the modification of 'extrapolation' approaches used to select transfer data in cases where information is not available. Bayesian updating approaches have been used in some cases to draw on relevant information that would otherwise have been excluded in the process of deriving CRwo-media statistics. All of these efforts have in turn led to the requirement to update Environmental Media Concentration Limits (EMCLs) used in Tier 1 assessments. Some of the significant changes with regard to EMCLs are highlighted.

  17. Going public

    DEFF Research Database (Denmark)

    Meyer, Gitte; Sandøe, Peter

    2012-01-01

    The paper addresses issues of scientific conduct regarding relations between science and the media, relations between scientists and journalists, and attitudes towards the public at large. In the large and increasing body of literature on scientific conduct and misconduct, these issues seem...... deal with ethical public relations issues, guided by a norm or maxim of openness. Drawing on and rethinking the CUDOS codification of the scientific ethos, as it was worked out by Robert K. Merton in 1942, we propose that this, which is echoed in current codifications of norms for good scientific...... conduct, contains a tacit maxim of openness which may naturally be extended to cover the public relations of science. Discussing openness as access, accountability, transparency and receptiveness, the argumentation concentrates on the possible prevention of misconduct with respect to, on the one hand...

  18. Going public

    DEFF Research Database (Denmark)

    Meyer, Gitte; Sandøe, Peter

    2012-01-01

    The paper addresses issues of scientific conduct regarding relations between science and the media, relations between scientists and journalists, and attitudes towards the public at large. In the large and increasing body of literature on scientific conduct and misconduct, these issues seem...... deal with ethical public relations issues, guided by a norm or maxim of openness. Drawing on and rethinking the CUDOS codification of the scientific ethos, as it was worked out by Robert K. Merton in 1942, we propose that this, which is echoed in current codifications of norms for good scientific...... conduct, contains a tacit maxim of openness which may naturally be extended to cover the public relations of science. Discussing openness as access, accountability, transparency and receptiveness, the argumentation concentrates on the possible prevention of misconduct with respect to, on the one hand...

  19. Public Sphere

    DEFF Research Database (Denmark)

    Trenz, Hans-Jörg

    2015-01-01

    of the collective will of the people in the act of democratic self-government. The concept of the public sphere is used across the fields of media and communication research, cultural studies and the humanities, the history of ideas, legal and constitutional studies as well as democracy studies. Historically......In modern societies, the public sphere represents the intermediary realm that supports the communication of opinions, the discovery of problems that need to be dealt with collectively, the channeling of these problems through the filter of the media and political institutions, and the realization......, public spheres have undergone structural transformations that were closely connected to the emergence of different mass media. More recently, they are subject to trends of transnationalization and digitalization in politics and society....

  20. Public Sphere

    DEFF Research Database (Denmark)

    Trenz, Hans-Jörg

    2015-01-01

    In modern societies, the public sphere represents the intermediary realm that supports the communication of opinions, the discovery of problems that need to be dealt with collectively, the channeling of these problems through the filter of the media and political institutions, and the realization......, public spheres have undergone structural transformations that were closely connected to the emergence of different mass media. More recently, they are subject to trends of transnationalization and digitalization in politics and society....... of the collective will of the people in the act of democratic self-government. The concept of the public sphere is used across the fields of media and communication research, cultural studies and the humanities, the history of ideas, legal and constitutional studies as well as democracy studies. Historically...

  1. Attentional priming releases crowding.

    Science.gov (United States)

    Kristjánsson, Arni; Heimisson, Pétur Rúnar; Róbertsson, Gunnar Freyr; Whitney, David

    2013-10-01

    Views of natural scenes unfold over time, and objects of interest that were present a moment ago tend to remain present. While visual crowding places a fundamental limit on object recognition in cluttered scenes, most studies of crowding have suffered from the limitation that they typically involved static scenes. The role of temporal continuity in crowding has therefore been unaddressed. We investigated intertrial effects upon crowding in visual scenes, showing that crowding is considerably diminished when objects remain constant on consecutive visual search trials. Repetition of both the target and distractors decreases the critical distance for crowding from flankers. More generally, our results show how object continuity through between-trial priming releases objects that would otherwise be unidentifiable due to crowding. Crowding, although it is a significant bottleneck on object recognition, can be mitigated by statistically likely temporal continuity of the objects. Crowding therefore depends not only on what is momentarily present, but also on what was previously attended.

  2. public spaces

    Directory of Open Access Journals (Sweden)

    Elena Grigoryeva

    2013-01-01

    Full Text Available The topic of this issue is PUBLIC SPACES. It is familiar and clear to every citizen. The streets and courtyards as childhood experiences remain with us forever. And these are the places where we come with our parents at weekends, where we meet friends, where we have dates and where we already come for a walk with our children.The history of public spaces is long and captivating. It was the main city squares where the most important events took place in history. The Agoras of Ancient Greece and the Roman Forums, the squares of Vatican, Paris and London, Moscow and Saint Petersburg… Greve, Trafalgar, Senate, Palace, Red, Bolotnaya – behind every name there is life of capitals, countries and nations.Public spaces, their shapes, image and development greatly influence the perception of the city as a whole. Both visitors and inhabitants can see in public spaces not only the visage but the heart, the soul and the mind of the city.Unfortunately, sometimes we have to prove the value of public spaces and defend them from those who consider them nothing but a blank space, nobody’s land destined for barbarous development.What should happen to make citizens perceive public spaces as their own and to make authorities consider development and maintenance of squares and parks their priority task against the  background of increasing competition between cities and the fight for human capital? Lately they more often say about “a high-quality human capital”. And now, when they say “the city should be liveable” they add “for all groups of citizens, including the creative class”.

  3. Fallout from atmospheric bomb tests and releases from nuclear installations

    Science.gov (United States)

    Völkle, H.; Murith, C.; Surbeck, H.

    This work presents the radioactivity monitoring programme in Switzerland. Environmental radioactivity measurements for atomic bomb test fallout are discussed together with the radiation doses to the public caused by fallout. In the second part the monitoring programme around nuclear power stations is presented. The radioactivity releases to the environment, the results of the monitoring programme and the radiation doses to the public in the vicinity of the plants are discussed.

  4. The Tenth Data Release of the sloan digital sky survey: first spectroscopic data from the SDSS-III Apache Point Observatory Galactic Evolution Experiment

    OpenAIRE

    Ahn, Christopher P.; Alexandroff, Rachael; Allende Prieto, Carlos; Anders, Friedrich; Anderson, Scott F.; Anderton, Timothy; Andrews, Brett H.; Aubourg, Eric; Bailey, Stephen; Bastien, Fabienne A.; Bautista, Julian E.; Beers, Timothy C.; Beifiori, Alessandra; Bender, Chad F.; Berlind, Andreas A.

    2014-01-01

    This is an author-created, un-copyedited version of an article accepted for publication in The Astrophysical Journal Supplement Series. The publisher is not responsible for any errors or omissions in this version of the manuscript or any version derived from it. The Version of Record is available online at http://dx.doi.org/10.1088/0067-0049/211/2/17. The accepted version will be under embargo until the 18th March 2015. The Sloan Digital Sky Survey (SDSS) has been in operation since 200...

  5. 42 CFR 35.13 - Entry for negotiation of release or settlement.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Entry for negotiation of release or settlement. 35.13 Section 35.13 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICAL CARE AND EXAMINATIONS HOSPITAL AND STATION MANAGEMENT General § 35.13 Entry for negotiation of...

  6. Ideological Manipulation of Controversial Information: The Unusual Case of the Chinese-subtitled Version of House of Cards

    Directory of Open Access Journals (Sweden)

    Dingkun Wang

    2016-02-01

    Full Text Available In recent years, owing to the spread of cultural and economic globalisation, Western values and ideologies have become increasingly accessible via media products to the general public in the People’s Republic of China (Mainland China, or China. Although translation enables the exchange of socio-cultural values and ideas across different languages and cultures, it is susceptible to manipulation in terms of political and ideological control. This paper examines interventions by Chinese authorities in the online distribution of foreign audio-visual products. Such interventions are undertaken to secure broadcasting and distribution rights of the government which also encompass more conventional media from other countries, such as television, in promoting mainstream ideological values and political agendas.  Censorship institutions supervise the selection of specific media products to be imported and translated for the Chinese market not only to ensure ease of comprehension but also for political correctness, with a view to avoid any clashes of cultures and ideologies. In the last decade, Chinese audiences have the rise of new media facilitating the wide-spread online viewing of foreign TV and thereby changing the dynamic of access and dissemination of foreign entertainment media in China. We argue that censorship institutions in China opt to adopt alternative strategies, or in many cases more relaxed criteria, in appraising foreign audiovisual products, in order to cater the demands of the new generation of Chinese audiences in those officially supervised media rather than suppressing their needs outright. We will dwell into the Chinese-subtitled version of the second season of the American political drama House of Cards (Netflix 2014, as released by Sohu, the largest online franchise in China. We consider the outcome of subtitling "honest" in terms of the exposure of sensitive information and controversial cultural and political allusions to the

  7. ATLAS and CMS Data Release and Tools

    CERN Document Server

    Socher, Felix; The ATLAS collaboration

    2016-01-01

    The data collected at the LHC has provided the basis for a vast body of scientific publications and the training of physicists. In light of these benefits it is desirable to also enable people outside the LHC collaborations to profit from the educational opportunities of the LHC data. The goal of the open data initiative is to provide these opportunities by making LHC data available to the general public. This talk will discuss the open data policies of both the ATLAS and CMS document and how these policies are implemented in practice. The open data portal will be presented and the contents made available by the collaborations reviewed emphasising possible use cases. The talk will be concluded with a summary of the plans for upcoming data releases.

  8. [French version of TASTE (test for the ability and evaluation)].

    Science.gov (United States)

    Masson, A M; Cadot, M; Pereira, A M; Depreeuw, E; Ansseau, M

    2001-01-01

    Ability to study and evaluation is only one example of performance among many others but research and publications concerning this issue for more than 50 years, especially in the context of test anxiety and need of achievement, conferred upon it a prototypical dimension. Investigations about motivation also stimulate many scientists and constitute another foundation of this study (13). The level of performance depends on knowledge and motivation (33). Time devoted to study is essential to succeed; so motivation and procrastination are in competition. The importance of reinforcement (extrinsical motivation) and the desire for learning and knowing (intrinsical motivation) are determinant. Other elements must be emphasized: guarantee of obtaining rewards, self efficacy and causal attribution. These considerations point out the multidimensional and interactive aspects of test anxiety (7, 31). The number of components is not described unanimously but experts agree with emotional, cognitive and behavioral dimensions (25). So, anxiety was approached in its motivational properties, and it was the case until the sixties, in terms of drive corresponding to a need like thirst or hunger (18); then it was conceptualized in a dynamic context broader than that of stress and coping (29, 30). Last, it constitutes the object of theories highlighting cognitive interference (9, 23, 26) or defective skills (8, 32). A lot of questionnaires were built without answering the different aspects and for instance without linking the theoretical and therapeutic components concerning this problem. Committed to the traditional fields of research (test anxiety and need of achievement), to Weiner's work about attribution theory (34) and that of Bandura in self efficacy (4, 5), E. Depreeuw (10) was particularly interested in Heckhausen's model (16, 17), trying to associate experimental conceptions with the clinical reality. On this basis, he elaborated the TASTE (10, 12, 20): test for ability to

  9. Psychometric Validation of the Bangla Version of the Patient-Doctor Relationship Questionnaire

    Directory of Open Access Journals (Sweden)

    S. M. Yasir Arafat

    2016-01-01

    Full Text Available Background. The patient-doctor relationship is an important issue in health care as it is linked to patient satisfaction, treatment adherence, and treatment outcome. The PDRQ-9 is brief instrument which has an excellent overall internal consistency to measure it. Objective. It was aimed at developing a culturally adapted and validated Bangla version of Patient-Doctor Relationship Questionnaire (PDRQ-9. Method. Data were collected during the period of May 2015 to July 2015 from 50 patients by interviewing with the final Bangla version of PDRQ-9 obtained by ideal translation-back translation procedure with nonprobability purposive consecutive sampling and analyzed by Statistical Package of Social Science (SPSS 16.0 and Microsoft Excel 2007 version software. Result. The internal consistency of Bangla PDRQ-9 was measured by Cronbach’s α which was 0.97. Only one factor was extracted from varimax rotation factor analysis with high commonalities between the items. Conclusion. Bangla version of PDRQ-9 is valid, accepted, and widely applicable in clinical practice, research, public health, and primary health care in Bangladesh.

  10. Electronic version of the third volume of the general catalogue of variable stars with improved coordinates

    Science.gov (United States)

    Samus', N. N.; Durlevich, O. V.; Zharova, A. V.; Kazarovets, E. V.; Kireeva, N. N.; Pastukhova, E. N.; Williams, D. B.; Hazen, M. L.

    2006-04-01

    We present a new electronic version of the third volume of the fourth edition of the General Catalogue of Variable Stars (GCVS) that contains data on 13 855 variables in the constellations Pavo-Vulpecula. The Name Lists of Variable Stars from no. 67 to no. 77 were included in the new version. The main distinctive feature of the new version is that improved J2000.0 equatorial coordinates (including those for 6163 stars corrected for the proper motions) based on the identifications with positional catalogues using finding charts and on our new measurements are presented for 13 812 stars. We searched for a number of stars on original plates from the plate stacks of several observatories and using images from digital sky surveys. Apart from the complete update of the positional information, we made several corrections that were found to be necessary after the publication of the GCVS Volume III (1985) and several corrections of the information about the variability features based on photometry from currently available automatic sky surveys. A number of problem identifications are described in detail. The new version completes our long-term work on the complete revision of the positional information in the GCVS. In the Conclusions, we give a list of references to new Internet resources.

  11. Public health

    NARCIS (Netherlands)

    Berg, van den A.E.

    2007-01-01

    Agnes van den Berg wrote an essay about human health and nature, establishing that subject as an important policy argument in developing (urban) nature in the Netherlands. She studied the public balance of fear and fascination for nature, summarising benefits on human health. In this chapter, she ad

  12. Public Affairs.

    Science.gov (United States)

    Snow, C. P.

    In this book effects of technological developments on world conditions are discussed on the basis of the author's public statements made between 1959-70. A total of seven pieces is presented under the headings: The Two Cultures and the Scientific Revolution, The Two Cultures: A Second Look, The Case of Leavis and the Serious Case, Science and…

  13. Public health

    NARCIS (Netherlands)

    Berg, van den A.E.

    2007-01-01

    Agnes van den Berg wrote an essay about human health and nature, establishing that subject as an important policy argument in developing (urban) nature in the Netherlands. She studied the public balance of fear and fascination for nature, summarising benefits on human health. In this chapter, she

  14. Publication Design.

    Science.gov (United States)

    Nelson, Roy Paul

    This book is designed to solve the problem of coordinating art and typography with content in publications. Through text and illustrations, this book suggests ways to make pages and spreads in magazines, newspapers, and books attractive and readable. As a book of techniques, it is directed at potential and practicing art directors, designers, and…

  15. Publication Design.

    Science.gov (United States)

    Nelson, Roy Paul

    This book is designed to solve the problem of coordinating art and typography with content in publications. Through text and illustrations, this book suggests ways to make pages and spreads in magazines, newspapers, and books attractive and readable. As a book of techniques, it is directed at potential and practicing art directors, designers, and…

  16. TOUGH2-GRS version 1. User manual

    Energy Technology Data Exchange (ETDEWEB)

    Navarro, Martin; Eckel, Jens

    2016-07-15

    TOUGH2 is a code for the simulation of multi-phase flow processes in porous media that has been developed by the Lawrence Berkeley National Laboratory, California, USA. Since 1991, GRS has been using the code for process analyses and safety assessments for deep geological repositories and has extended the code by several processes that are relevant for repository systems. The TOUGH2 source code that has been developed further by GRS is referred to as TOUGH2-GRS. The present report presents code version 1.1.g, which was developed in project UM13 A 03400 sponsored by the German Federal Ministry for the Environment, Nature Conservation, Building and Nuclear Safety (BMUB).

  17. FLEXAN (version 2.0) user's guide

    Science.gov (United States)

    Stallcup, Scott S.

    1989-01-01

    The FLEXAN (Flexible Animation) computer program, Version 2.0 is described. FLEXAN animates 3-D wireframe structural dynamics on the Evans and Sutherland PS300 graphics workstation with a VAX/VMS host computer. Animation options include: unconstrained vibrational modes, mode time histories (multiple modes), delta time histories (modal and/or nonmodal deformations), color time histories (elements of the structure change colors through time), and rotational time histories (parts of the structure rotate through time). Concurrent color, mode, delta, and rotation, time history animations are supported. FLEXAN does not model structures or calculate the dynamics of structures; it only animates data from other computer programs. FLEXAN was developed to aid in the study of the structural dynamics of spacecraft.

  18. Forsmark - site descriptive model version 0

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-10-01

    During 2002, the Swedish Nuclear Fuel and Waste Management Company (SKB) is starting investigations at two potential sites for a deep repository in the Precambrian basement of the Fennoscandian Shield. The present report concerns one of those sites, Forsmark, which lies in the municipality of Oesthammar, on the east coast of Sweden, about 150 kilometres north of Stockholm. The site description should present all collected data and interpreted parameters of importance for the overall scientific understanding of the site, for the technical design and environmental impact assessment of the deep repository, and for the assessment of long-term safety. The site description will have two main components: a written synthesis of the site, summarising the current state of knowledge, as documented in the databases containing the primary data from the site investigations, and one or several site descriptive models, in which the collected information is interpreted and presented in a form which can be used in numerical models for rock engineering, environmental impact and long-term safety assessments. The site descriptive models are devised and stepwise updated as the site investigations proceed. The point of departure for this process is the regional site descriptive model, version 0, which is the subject of the present report. Version 0 is developed out of the information available at the start of the site investigation. This information, with the exception of data from tunnels and drill holes at the sites of the Forsmark nuclear reactors and the underground low-middle active radioactive waste storage facility, SFR, is mainly 2D in nature (surface data), and is general and regional, rather than site-specific, in content. For this reason, the Forsmark site descriptive model, version 0, as detailed in the present report, has been developed at a regional scale. It covers a rectangular area, 15 km in a southwest-northeast and 11 km in a northwest-southeast direction, around the

  19. An approximate version of Sidorenko's conjecture

    CERN Document Server

    Conlon, David; Sudakov, Benny

    2010-01-01

    A beautiful conjecture of Erd\\H{o}s-Simonovits and Sidorenko states that if H is a bipartite graph, then the random graph with edge density p has in expectation asymptotically the minimum number of copies of H over all graphs of the same order and edge density. This conjecture also has an equivalent analytic form and has connections to a broad range of topics, such as matrix theory, Markov chains, graph limits, and quasirandomness. Here we prove the conjecture if H has a vertex complete to the other part, and deduce an approximate version of the conjecture for all H. Furthermore, for a large class of bipartite graphs, we prove a stronger stability result which answers a question of Chung, Graham, and Wilson on quasirandomness for these graphs.

  20. The Classical Version of Stokes' Theorem Revisited

    DEFF Research Database (Denmark)

    Markvorsen, Steen

    2005-01-01

    Using only fairly simple and elementary considerations - essentially from first year undergraduate mathematics - we prove that the classical Stokes' theorem for any given surface and vector field in $\\mathbb{R}^{3}$ follows from an application of Gauss' divergence theorem to a suitable modification...... of the vector field in a tubular shell around the given surface. The intuitive appeal of the divergence theorem is thus applied to bootstrap a corresponding intuition for Stokes' theorem. The two stated classical theorems are (like the fundamental theorem of calculus) nothing but shadows of the general version...... to above. Our proof that Stokes' theorem follows from Gauss' divergence theorem goes via a well known and often used exercise, which simply relates the concepts of divergence and curl on the local differential level. The rest of the paper uses only integration in $1$, $2$, and $3$ variables together...