Sample records for publication 438-102 introduction
-
42 CFR 438.218 - Enrollee information.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee information. 438.218 Section 438.218 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and Operation Standards § 438.218 Enrollee information. The requirements that States must meet under...
-
42 CFR 438.236 - Practice guidelines.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Practice guidelines. 438.236 Section 438.236 Public... Improvement Standards § 438.236 Practice guidelines. (a) Basic rule: The State must ensure, through its...) Adoption of practice guidelines. Each MCO and, when applicable, each PIHP and PAHP adopts practice...
-
42 CFR 438.356 - State contract options.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false State contract options. 438.356 Section 438.356 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE External Quality Review § 438.356 State contract options...
-
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...
-
42 CFR 438.724 - Notice to CMS.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Notice to CMS. 438.724 Section 438.724 Public...) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Sanctions § 438.724 Notice to CMS. (a) The State must give the CMS Regional Office written notice whenever it imposes or lifts a sanction for one of the violations...
-
42 CFR 438.104 - Marketing activities.
2010-10-01
... State government, or similar entity. (c) State agency review. In reviewing the marketing materials... 42 Public Health 4 2010-10-01 2010-10-01 false Marketing activities. 438.104 Section 438.104... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Enrollee Rights and Protections § 438.104 Marketing...
-
42 CFR 438.100 - Enrollee rights.
2010-10-01
...) Basic requirement. The State must ensure that each managed care enrollee is guaranteed the rights as... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee rights. 438.100 Section 438.100 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...
-
42 CFR 438.242 - Health information systems.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Health information systems. 438.242 Section 438.242... Measurement and Improvement Standards § 438.242 Health information systems. (a) General rule. The State must ensure, through its contracts, that each MCO and PIHP maintains a health information system that collects...
-
42 CFR 438.58 - Conflict of interest safeguards.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Conflict of interest safeguards. 438.58 Section 438... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE State Responsibilities § 438.58 Conflict of interest... safeguards against conflict of interest on the part of State and local officers and employees and agents of...
-
42 CFR 438.230 - Subcontractual relationships and delegation.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Subcontractual relationships and delegation. 438... Improvement Structure and Operation Standards § 438.230 Subcontractual relationships and delegation. (a... delegation, each MCO, PIHP, and PAHP evaluates the prospective subcontractor's ability to perform the...
-
41 CFR 102-192.10 - What authority governs this part?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.10 What authority governs this part? This part is governed by... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What authority governs this part? 102-192.10 Section 102-192.10 Public Contracts and Property Management Federal Property...
-
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public Index. 102.9 Section 102.9 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY Disclosure of... latest edition of SOP 40 03 from SBA's Online Reading Room at http://www.sba.gov/library or by requesting...
-
41 CFR 101-1.102 - Federal Property Management Regulations.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Federal Property Management Regulations. 101-1.102 Section 101-1.102 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation...
-
41 CFR 102-192.25 - Does this part apply to me?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.25 Does this part apply to me? Yes, this part applies to you... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does this part apply to me? 102-192.25 Section 102-192.25 Public Contracts and Property Management Federal Property...
-
42 CFR 438.704 - Amounts of civil money penalties.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Amounts of civil money penalties. 438.704 Section... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Sanctions § 438.704 Amounts of civil money penalties. (a) General rule. The limit on, or the maximum civil money penalty the State may impose varies...
-
14 CFR 221.102 - Accessibility of tariffs to the public.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221.102 Section 221.102 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in complete...
-
41 CFR 105-1.102 - Relationship of GSPMR to FPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Relationship of GSPMR to FPMR. 105-1.102 Section 105-1.102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...
-
13 CFR 102.2 - Public reading rooms.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public reading rooms. 102.2 Section 102.2 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... described in paragraph (a) of this section are available in the SBA Online Reading Room at http://www.sba...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire protection engineering? 102-80.90 Section 102-80.90 Public Contracts and Property Management Federal Property Management Regulations System...
-
12 CFR 4.38 - Restrictions on dissemination of released information.
2010-01-01
... dissemination of released information. (a) Records. The OCC may condition a decision to release non-public OCC... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Restrictions on dissemination of released information. 4.38 Section 4.38 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY...
-
42 CFR 488.438 - Civil money penalties: Amount of penalty.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Civil money penalties: Amount of penalty. 488.438... Enforcement of Compliance for Long-Term Care Facilities with Deficiencies § 488.438 Civil money penalties... review authority) finds that the basis for imposing a civil money penalty exists, as specified in § 488...
-
41 CFR 102-37.520 - What is the authority for public airport donations?
2010-07-01
... for public airport donations? 102-37.520 Section 102-37.520 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Airports § 102-37.520 What is the authority for public airport donations? The authority for public airport donations is 49 U.S.C. 47151. 49 U...
-
41 CFR 102-192.30 - What types of mail does this part apply to?
2010-07-01
... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.30 What types of mail does this part apply to... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of mail does this part apply to? 102-192.30 Section 102-192.30 Public Contracts and Property Management Federal...
-
42 CFR 438.730 - Sanction by CMS: Special rules for MCOs
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Sanction by CMS: Special rules for MCOs 438.730... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Sanctions § 438.730 Sanction by CMS: Special rules for MCOs (a) Basis for sanction. (1) A State agency may recommend that CMS impose the denial of...
-
41 CFR 102-38.130 - Must we publicly advertise sales of Federal personal property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must we publicly advertise sales of Federal personal property? 102-38.130 Section 102-38.130 Public Contracts and Property... PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Advertising § 102-38.130 Must we publicly advertise...
-
41 CFR 102-37.565 - What is the authority for donations to public bodies?
2010-07-01
... for donations to public bodies? 102-37.565 Section 102-37.565 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.565 What is the authority for donations to public bodies? Section 527 of title 40, United...
-
41 CFR 102-192.40 - Where can we obtain more information about the classes of mail?
2010-07-01
... PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.40 Where can we obtain more information... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Where can we obtain more information about the classes of mail? 102-192.40 Section 102-192.40 Public Contracts and Property Management...
-
2010-04-01
... private sector. Recipient includes all contractors, subcontractors at any tier, and subgrantees at any... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Definitions. 438.105 Section 438.105 Employees' Benefits SOCIAL SECURITY ADMINISTRATION RESTRICTIONS ON LOBBYING General § 438.105 Definitions...
-
41 CFR 102-192.20 - How are “must” and “should” used in this part?
2010-07-01
... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.20 How are “must” and “should” used in this... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How are âmustâ and âshouldâ used in this part? 102-192.20 Section 102-192.20 Public Contracts and Property Management Federal...
-
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC438 (Link to dictyBase) - - - Contig-U10771-1 SLC438Z (Link... to Original site) - - SLC438Z 549 - - - - Show SLC438 Library SL (Link to library) Clone ID SLC438 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC438Q.Seq.d/ Representative seq. ID SLC43...8Z (Link to Original site) Representative DNA sequence >SLC438 (SLC438Q) /CSM/SL/SLC4-B/SLC438Q.Seq.d/ XXXXX...es producing significant alignments: (bits) Value SSM825 (SSM825Q) /CSM/SS/SSM8-B/SSM825Q.Seq.d/ 948 0.0 SLC438 (SLC4
-
41 CFR 102-37.560 - What is a public body?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a public body... PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.560 What is a public body? A public body is any department, agency, special purpose district, or other instrumentality of a...
-
38 CFR 18.438 - Adult education.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Adult education. 18.438 Section 18.438 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED... Adult Education § 18.438 Adult education. A recipient that provides adult education may not, on the...
-
Music and Public Health - An introduction
DEFF Research Database (Denmark)
Bonde, Lars Ole; Theorell, Töres
2018-01-01
Introduction to Music and Public Health as a new research field. The history of the field in the Nordic countries is presented, and the 13 contributions to the book are briefly reviewed.......Introduction to Music and Public Health as a new research field. The history of the field in the Nordic countries is presented, and the 13 contributions to the book are briefly reviewed....
-
41 CFR 102-38.135 - What constitutes a public advertisement?
2010-07-01
... enough in advance of the sale to ensure adequate notice, and to target your advertising efforts toward... OF PERSONAL PROPERTY Sales Process Advertising § 102-38.135 What constitutes a public advertisement... personal property to be sold is considered public advertising. You may also distribute mailings or flyers...
-
2010-07-01
... restrictions on Federal agencies concerning property donations to public bodies? 102-75.1015 Section 102-75... Donation to Public Bodies Restrictions § 102-75.1015 Are there any restrictions on Federal agencies concerning property donations to public bodies? Yes, Federal agencies must obtain prior concurrence of GSA...
-
48 CFR 30.102 - Cost Accounting Standards Board publication.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost Accounting Standards... REGULATION GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION General 30.102 Cost Accounting Standards Board publication. Copies of the CASB Standards and Regulations are printed in title 48...
-
44 CFR 206.438 - Project management.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project management. 206.438 Section 206.438 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Project management. (a) General. The State serving as grantee has primary responsibility for project...
-
41 CFR 102-192.35 - What definitions apply to this part?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.35 What definitions apply to this part? The following... responsible for mail policy implementation, operations, and financial management; the program level... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What definitions apply...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Executive agencies outlease space on major public access levels, courtyards and rooftops of public buildings? 102-79.65... Utilization of Space Outleasing § 102-79.65 May Executive agencies outlease space on major public access...
-
13 CFR 102.23 - Publication in the Federal Register-Notices of systems of records.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Publication in the Federal Register-Notices of systems of records. 102.23 Section 102.23 Business Credit and Assistance SMALL BUSINESS... Federal Register upon establishment or revision a notice of the existence and character of any new or...
-
2010-10-01
... appeal and the State fair hearing are pending. 438.420 Section 438.420 Public Health CENTERS FOR MEDICARE... fair hearing are pending. (a) Terminology. As used in this section, “timely” filing means filing on or... continues or reinstates the enrollee's benefits while the appeal is pending, the benefits must be continued...
-
45 CFR 2104.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...
-
45 CFR 1706.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...
-
45 CFR 1214.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...
-
45 CFR 2490.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...
-
45 CFR 2301.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...
-
20 CFR 438.205 - Professional and technical services.
2010-04-01
... advice and analysis directly applying any professional or technical discipline. For example, drafting of... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Professional and technical services. 438.205... Own Employees § 438.205 Professional and technical services. (a) The prohibition on the use of...
-
[On peculiarities of introduction of HACCP in public catering].
Matison, V A; Ktiukova, E V; Shilov, G Iu
2006-01-01
The article deals with the introduction of HACCP system (Hazard Analysis and Critical Control Points) in cooking food in public catering facilities: restaurant, dining-room, cafe and others. The article considers the advantages of this system and results of its introduction.
-
20 CFR 438.300 - Professional and technical services.
2010-04-01
... analysis directly applying any professional or technical discipline. For example, drafting of a legal... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Professional and technical services. 438.300... Other Than Own Employees § 438.300 Professional and technical services. (a) The prohibition on the use...
-
2010-07-01
... SPACE Assignment and Utilization of Space Public Access Defibrillation Programs § 102-79.115 What... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What guidelines must an agency follow if it elects to establish a public access defibrillation program in a Federal facility? 102...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What information must FAA provide to GSA on its administration of the public airport donation program? 102-37.535 Section... Donations to Public Airports § 102-37.535 What information must FAA provide to GSA on its administration of...
-
41 CFR 51-10.102 - Application.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...
-
42 CFR 93.102 - Applicability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
-
Beck Jørgensen, T.; Rutgers, M.R.
2015-01-01
This article provides the introduction to a symposium on contemporary public values research. It is argued that the contribution to this symposium represent a Public Values Perspective, distinct from other specific lines of research that also use public value as a core concept. Public administration
-
2010-01-01
... of the People's Republic of China under Public Law 102-404. 1245.9 Section 1245.9 Aliens and Nationality EXECUTIVE OFFICE FOR IMMIGRATION REVIEW, DEPARTMENT OF JUSTICE IMMIGRATION REGULATIONS ADJUSTMENT... nationals of the People's Republic of China under Public Law 102-404. (a) Principal applicant status. All...
-
2010-01-01
... of the People's Republic of China under Public Law 102-404. 245.9 Section 245.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON... of China under Public Law 102-404. (a) Principal applicant status. All nationals of the People's...
-
42 CFR 102.74 - Disapproval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...
-
46 CFR 116.438 - Stairtowers, stairways, ladders, and elevators.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Stairtowers, stairways, ladders, and elevators. 116.438 Section 116.438 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS CONSTRUCTION AND ARRANGEMENT Fire Protection §...
-
41 CFR 102-192.45 - How can we request a deviation from these requirements, and who can approve it?
2010-07-01
... and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.45 How can we... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How can we request a...
-
41 CFR 109-27.102-1 - Applicability.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...
-
41 CFR 109-27.102-51 - Policy.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...
-
41 CFR 101-27.102-2 - Guidelines.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...
-
42 CFR 84.102 - Man test 6; requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test 6; requirements. 84.102 Section 84.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.102 Man test 6; requirements....
-
2010-01-01
... INFORMATION Introduction § 1201.102 Functions. In order to carry out the purpose of the Act, NASA is... utilization of the scientific and engineering resources of the United States with other nations engaged in...
-
42 CFR 102.73 - Approval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are FAA's... § 102-37.530 What are FAA's responsibilities in the donation of surplus property to public airports? In the donation of surplus property to public airports, the Federal Aviation Administration (FAA), acting...
-
41 CFR 109-27.102-50 - Systems contracting.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...
-
25 CFR 11.438 - Flight to avoid prosecution or judicial process.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Flight to avoid prosecution or judicial process. 11.438... OFFENSES AND LAW AND ORDER CODE Criminal Offenses § 11.438 Flight to avoid prosecution or judicial process... Offenses exercises jurisdiction for the purpose of avoiding arrest, prosecution or other judicial process...
-
41 CFR 102-117.200 - What is HAZMAT?
2010-07-01
... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...
-
Publications | Page 438 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 4371 - 4380 of 6341 ... Through books, articles, research publications, and studies, we aim to widen the ... coverage rates is human resources and its management. ... Each month, at the Lifeline Rape Crisis. ... This document presents the findings from the South African component of a five-country case study on the role ...
-
18 CFR 4.38 - Consultation requirements.
2010-04-01
... conclusion of the last joint meeting held pursuant to paragraph (c)(6) of this section in cases where a... such application documents with the Commission, or promptly after receipt in the case of documents... OF PROJECT COSTS Application for Preliminary Permit, License or Exemption: General Provisions § 4.38...
-
27 CFR 4.38 - General requirements.
2010-04-01
... mandatory information required on labels by this part, except the alcoholic content statement, shall be in... OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE Labeling Requirements for Wine § 4.38... descriptive or explanatory information, the script, type, or printing of the mandatory information shall be of...
-
23 CFR 810.102 - Eligible projects.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...
-
42 CFR 422.102 - Supplemental benefits.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...
-
41 CFR 102-76.50 - What is sustainable development?
2010-07-01
... and Construction Sustainable Development § 102-76.50 What is sustainable development? Sustainable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is sustainable development? 102-76.50 Section 102-76.50 Public Contracts and Property Management Federal Property Management...
-
41 CFR 102-117.5 - What is transportation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...
-
41 CFR 109-27.102 - Economic order quantity principle.
2010-07-01
... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...
-
Introduction to “International Broadcasting and Public Diplomacy in the 21st Century”
Directory of Open Access Journals (Sweden)
Gary D. Rawnsley
2016-05-01
Full Text Available International broadcasting remains a key activity in public diplomacy. In this Introduction I discuss how international broadcasting has long been associated with the projection of foreign policy interests, from an instrument of empire building in the 1920s and 1930s, through the Cold War and beyond. In particular, the Introduction evaluates how modern Information Communications Technologies, especially the internet and social media, have transformed the way international broadcasting contributes to public diplomacy.
-
41 CFR 101-27.102-1 - Applicability.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...
-
41 CFR 102-74.40 - What are concession services?
2010-07-01
... Management Concession Services § 102-74.40 What are concession services? Concession services are any food or... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are concession services? 102-74.40 Section 102-74.40 Public Contracts and Property Management Federal Property Management...
-
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...
-
41 CFR 102-192.15 - How are “I”, “you”, “me”, “we”, and “us” used in this part?
2010-07-01
... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.15 How are “I”, “you”, “me”, “we... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How are âIâ, âyouâ, âmeâ...
-
41 CFR 102-72.40 - What are facility management delegations?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are facility management delegations? 102-72.40 Section 102-72.40 Public Contracts and Property Management Federal Property... AUTHORITY Delegation of Authority § 102-72.40 What are facility management delegations? Facility management...
-
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...
-
42 CFR 413.102 - Compensation of owners.
2010-10-01
...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...
-
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...
-
45 CFR 96.102 - Carryover of unobligated funds.
2010-10-01
... reason or if the State has determined that program objectives would be better served by deferring... 45 Public Welfare 1 2010-10-01 2010-10-01 false Carryover of unobligated funds. 96.102 Section 96.102 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Primary...
-
The public and private history of eugenics: an introduction.
Burke, Chloe S; Castaneda, Christopher J
2007-01-01
Inspired by our experience addressing the legacy of eugenics at California State University, Sacramento, this special issue presents an array of articles representative of diverse approaches to the historical investigation of eugenics. This article provides an introduction to the history of eugenics and explores the ways in which public history is particularly well suited to shape the historical memory of eugenics and encourage dialogue about contemporary biotechnologies.
-
24 CFR 984.102 - Program objectives.
2010-04-01
... education, employment, and business and social skills necessary to achieve self-sufficiency, as defined in... 984.102 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... SECTION 8 AND PUBLIC HOUSING FAMILY SELF-SUFFICIENCY PROGRAM General § 984.102 Program objectives. The...
-
42 CFR 102.80 - Calculation of medical benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of medical benefits. 102.80 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.80 Calculation of medical benefits. In calculating medical benefits, the Secretary will take into consideration all reasonable costs for those...
-
41 CFR 102-35.25 - What management reports must we provide?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What management reports must we provide? 102-35.25 Section 102-35.25 Public Contracts and Property Management Federal Property... PERSONAL PROPERTY § 102-35.25 What management reports must we provide? (a) There are three reports that...
-
41 CFR 102-83.85 - What is a central business area?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a central business area? 102-83.85 Section 102-83.85 Public Contracts and Property Management Federal Property... Location of Space Urban Areas § 102-83.85 What is a central business area? Central business area (CBA...
-
41 CFR 102-85.95 - Who pays for the TI allowance?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who pays for the TI allowance? 102-85.95 Section 102-85.95 Public Contracts and Property Management Federal Property Management... GSA SPACE Tenant Improvement Allowance § 102-85.95 Who pays for the TI allowance? The customer agency...
-
41 CFR 102-117.110 - What is satisfactory service?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...
-
7 CFR 90.102 - Quality assurance review.
2010-01-01
... procedures; (3) A review of records for the calibration and maintenance of equipment; (4) A review of records..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY LABORATORY TESTING PROGRAMS INTRODUCTION Quality Assurance § 90.102 Quality assurance review. (a) Each laboratory performing tests and...
-
42 CFR 102.33 - Death benefits.
2010-10-01
... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM... are described in § 102.82. As provided in § 102.84, the Secretary retains the right to recover death... secondary to disability benefits under the PSOB Program. Any death benefit paid under the standard...
-
42 CFR 102.82 - Calculation of death benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of death benefits. 102.82 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.82 Calculation of death benefits. (a... paragraph (d) of this section for the death benefit available to dependents. (2) Deceased person means an...
-
41 CFR 102-33.65 - What is the process for acquiring Government aircraft?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for acquiring Government aircraft? 102-33.65 Section 102-33.65 Public Contracts and Property Management Federal... process; planning, budgeting, and contracting, as described in §§ 102-33.70 through 102-33.105. Planning...
-
42 CFR 102.32 - Benefits for lost employment income.
2010-10-01
... 102.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... pay for lost employment income or to provide disability or retirement benefits to the requester. As provided in § 102.84, the Secretary retains the right to recover benefits for lost employment income paid...
-
42 CFR 102.83 - Payment of all benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Payment of all benefits. 102.83 Section 102.83... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.83 Payment of all benefits. (a) The Secretary may pay any benefits under this Program through lump-sum payments. If the Secretary determines that...
-
41 CFR 102-192.170 - What are GSA's responsibilities in mail management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities in mail management? 102-192.170 Section 102-192.170 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT GSA's Responsibilities and Services § 102-192.170 What are GSA's...
-
41 CFR 102-118.10 - What is a transportation audit?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation audit? 102-118.10 Section 102-118.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
-
41 CFR 102-118.15 - What is a transportation payment?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation payment? 102-118.15 Section 102-118.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
-
41 CFR 102-2.5 - What is the Federal Management Regulation (FMR)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Federal Management Regulation (FMR)? 102-2.5 Section 102-2.5 Public Contracts and Property Management Federal... MANAGEMENT REGULATION SYSTEM Regulation System General § 102-2.5 What is the Federal Management Regulation...
-
41 CFR 102-37.580 - Who is responsible for costs associated with the donation?
2010-07-01
... costs associated with the donation? 102-37.580 Section 102-37.580 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.580 Who is responsible for costs associated with the donation? The recipient public body...
-
41 CFR 102-192.5 - What does this part cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does this part cover? 102-192.5 Section 102-192.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT...
-
18 CFR 367.4380 - Account 438, Dividends declared-common stock.
2010-04-01
... GAS ACT Retained Earnings Accounts § 367.4380 Account 438, Dividends declared—common stock. (a) This account must include amounts declared payable out of retained earnings as dividends on actually...
-
41 CFR 102-34.345 - What records do we need to keep?
2010-07-01
... MANAGEMENT Federal Fleet Report § 102-34.345 What records do we need to keep? You are responsible for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What records do we need to keep? 102-34.345 Section 102-34.345 Public Contracts and Property Management Federal Property...
-
42 CFR 438.208 - Coordination and continuity of care.
2010-10-01
... Improvement Access Standards § 438.208 Coordination and continuity of care. (a) Basic requirement—(1) General... MCO must meet the primary care coordination, identification, assessment, and treatment planning... those activities. (4) Ensure that in the process of coordinating care, each enrollee's privacy is...
-
The Introduction of New Public Management Principles in the Italian Public Sector
Directory of Open Access Journals (Sweden)
Marino CALOGERO
2010-06-01
Full Text Available Over the last few decades, the Italian public administration has undergone significant reform, which aimed to rectify the structural defects in the system, leading to inefficiency in public management and an improper allocation and utilization of resources. The Italian legislator, following the New Public Management (NPM guidelines, introduced private principles and instruments in the public field to improve the efficiency, effectiveness and financial stability of state enterprise. In particular, one of the main innovations introduced in this field regarded the recognition of the principle of distinction between politics and administration and the transfer from a bureaucratic model based on norms to a managerial model based on performance. The reform has the aim of changing the traditional “weberian bureaucratic” approach of the Italian public administration, in accordance with the NPM principles. This reform process regarded also other European countries that have undergone profound changes. As well as Italy, the reform process in these countries was based on the principles of NPM which proclaims: an increased focus on results in terms of efficiency, effectiveness and quality of service by setting standards of productivity; an orientation towards citizens-consumers in terms of service quality and customer satisfaction; the introduction of market mechanisms; a more strategic focus on the reinforcement of strategic capacity. This paper is underpinned by an analysis of the regulation introduced by the reform of the Italian public administration to observe whether its main objectives have been really achieved. It is also based on a comparative analysis of the effects produced by reforms in Italy and in other European Countries. Lastly this work aims to verify if it is possible to individuate a framework of convergence based on the principles of new public management.
-
41 CFR 102-33.40 - What are GSA's responsibilities for Federal aviation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities for Federal aviation management? 102-33.40 Section 102-33.40 Public Contracts and Property... PROPERTY 33-MANAGEMENT OF GOVERNMENT AIRCRAFT How These Rules Apply Responsibilities § 102-33.40 What are...
-
41 CFR 102-83.80 - What is an urban area?
2010-07-01
... defined by the Office of Management and Budget (OMB) in OMB Bulletin No. 99-04, or succeeding OMB Bulletin... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is an urban area? 102-83.80 Section 102-83.80 Public Contracts and Property Management Federal Property Management...
-
41 CFR 102-118.20 - Who is subject to this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who is subject to this part? 102-118.20 Section 102-118.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
-
41 CFR 102-41.235 - May we sell forfeited drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we sell forfeited drug paraphernalia? 102-41.235 Section 102-41.235 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
-
41 CFR 102-79.105 - What is the Integrated Workplace?
2010-07-01
... changing needs of the occupants and the organization. Integrated Workplace concepts support the objectives... Workplace? 102-79.105 Section 102-79.105 Public Contracts and Property Management Federal Property... UTILIZATION OF SPACE Assignment and Utilization of Space Integrated Workplace § 102-79.105 What is the...
-
42 CFR 489.102 - Requirements for providers.
2010-10-01
..., nursing facilities, home health agencies, providers of home health care (and for Medicaid purposes... individual's admission as a resident. (3)(i) In the case of a home health agency, in advance of the... 42 Public Health 5 2010-10-01 2010-10-01 false Requirements for providers. 489.102 Section 489.102...
-
22 CFR 102.25 - Submission of comments.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Submission of comments. 102.25 Section 102.25 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION Recommendations to the... confidential in the interest of national defense or foreign policy, are to be placed in a public docket and...
-
42 CFR 438.700 - Basis for imposition of sanctions.
2010-10-01
... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Sanctions § 438.700 Basis for imposition of... among enrollees on the basis of their health status or need for health care services. This includes termination of enrollment or refusal to reenroll a recipient, except as permitted under the Medicaid program...
-
41 CFR 102-74.15 - What are the facility management responsibilities of occupant agencies?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the facility management responsibilities of occupant agencies? 102-74.15 Section 102-74.15 Public Contracts and Property... PROPERTY 74-FACILITY MANAGEMENT Facility Management § 102-74.15 What are the facility management...
-
42 CFR 438.52 - Choice of MCOs, PIHPs, PAHPs, and PCCMs.
2010-10-01
... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE State Responsibilities § 438.52 Choice of... circumstances: (A) The service or type of provider (in terms of training, experience, and specialization) is not...
-
41 CFR 102-33.130 - If we hire CAS, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we hire CAS, what are our management responsibilities? 102-33.130 Section 102-33.130 Public Contracts and Property... § 102-33.130 If we hire CAS, what are our management responsibilities? If you hire CAS, you are...
-
41 CFR 102-194.5 - What is the Standard and Optional Forms Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Standard and Optional Forms Management Program? 102-194.5 Section 102-194.5 Public Contracts and Property Management... PROGRAMS 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.5 What is the Standard and Optional...
-
41 CFR 102-42.25 - Who retains custody of gifts and decorations pending disposal?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who retains custody of gifts and decorations pending disposal? 102-42.25 Section 102-42.25 Public Contracts and Property..., Handling and Disposition § 102-42.25 Who retains custody of gifts and decorations pending disposal? (a) The...
-
41 CFR 102-2.140 - What elements of plain language appear in the FMR?
2010-07-01
... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.140 What elements of plain language... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What elements of plain language appear in the FMR? 102-2.140 Section 102-2.140 Public Contracts and Property Management Federal...
-
41 CFR 102-118.30 - Are Government corporations bound by this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Government corporations bound by this part? 102-118.30 Section 102-118.30 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118...
-
41 CFR 102-118.5 - What is the purpose of this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the purpose of this part? 102-118.5 Section 102-118.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
-
41 CFR 102-41.210 - What are some examples of drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are some examples of drug paraphernalia? 102-41.210 Section 102-41.210 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
-
41 CFR 102-34.85 - What motor vehicles require motor vehicle identification?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What motor vehicles require motor vehicle identification? 102-34.85 Section 102-34.85 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Identifying and Registering Motor Vehicles Motor Vehicle Identification...
-
41 CFR Appendix A to Part 102 - 37-Miscellaneous Donation Statutes
2010-07-01
... Donation Statutes A Appendix A to Part 102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Pt. 102-37, App. A Appendix A to Part 102-37—Miscellaneous Donation Statutes The...
-
41 CFR 102-192.155 - What should our agency-wide mail management policy statement cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What should our agency-wide mail management policy statement cover? 102-192.155 Section 102-192.155 Public Contracts and... REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Other Agency Responsibilities § 102-192.155 What...
-
41 CFR 102-192.120 - Must we have an agency mail manager?
2010-07-01
... mail manager? 102-192.120 Section 102-192.120 Public Contracts and Property Management Federal Property... MANAGEMENT Agency Mail Manager Requirements § 102-192.120 Must we have an agency mail manager? Yes, every Federal agency as defined in § 102-192.35 must have an agency mail manager. Agencies that are not “large...
-
41 CFR 102-34.330 - What is the Federal Fleet Report?
2010-07-01
... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...
-
41 CFR 102-85.20 - What does an Occupancy Agreement (OA) do?
2010-07-01
... defines GSA's relationship with each customer agency and: (a) Establishes specific financial terms... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does an Occupancy Agreement (OA) do? 102-85.20 Section 102-85.20 Public Contracts and Property Management Federal Property...
-
41 CFR 102-74.395 - What is the policy concerning gambling?
2010-07-01
... concerning gambling? 102-74.395 Section 102-74.395 Public Contracts and Property Management Federal Property... Conduct on Federal Property Gambling § 102-74.395 What is the policy concerning gambling? (a) Except for... games for money or other personal property; (2) Operating gambling devices; (3) Conducting a lottery or...
-
41 CFR 102-80.30 - What are Federal agencies' responsibilities concerning lead?
2010-07-01
... agencies' responsibilities concerning lead? 102-80.30 Section 102-80.30 Public Contracts and Property... PROPERTY 80-SAFETY AND ENVIRONMENTAL MANAGEMENT Safety and Environmental Management Lead § 102-80.30 What are Federal agencies' responsibilities concerning lead? Federal agencies have the following...
-
41 CFR 102-33.125 - If we use Federal aircraft, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we use Federal aircraft, what are our management responsibilities? 102-33.125 Section 102-33.125 Public Contracts and... Parts Overview § 102-33.125 If we use Federal aircraft, what are our management responsibilities? If you...
-
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false May a tribe integrate Job Placement and Training funds... THE INTERIOR HUMAN SERVICES JOB PLACEMENT AND TRAINING PROGRAM General Applicability § 26.22 May a tribe integrate Job Placement and Training funds into its Public Law 102-477 Plan? Yes, Indian tribes...
-
41 CFR 102-2.145 - To what do pronouns refer when used in the FMR?
2010-07-01
... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.145 To what do pronouns refer when used... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false To what do pronouns refer when used in the FMR? 102-2.145 Section 102-2.145 Public Contracts and Property Management Federal...
-
41 CFR 102-74.10 - What is the basic facility management policy?
2010-07-01
... facility management policy? 102-74.10 Section 102-74.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT General Provisions § 102-74.10 What is the basic facility management policy? Executive agencies...
-
41 CFR 102-74.330 - What smoking restrictions apply to outside areas under Executive branch control?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What smoking restrictions apply to outside areas under Executive branch control? 102-74.330 Section 102-74.330 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Smoking § 102-74.330 What...
-
41 CFR 102-41.170 - Is unclaimed personal property available for donation?
2010-07-01
... property available for donation? 102-41.170 Section 102-41.170 Public Contracts and Property Management... Personal Property § 102-41.170 Is unclaimed personal property available for donation? No, unclaimed personal property is not available for donation because reimbursement at fair market value is required. ...
-
41 CFR 102-37.30 - When does property become available for donation?
2010-07-01
... become available for donation? 102-37.30 Section 102-37.30 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.30 When does property become available for donation? Excess personal property becomes available for donation the day...
-
41 CFR 102-77.15 - Who funds the Art-in-Architecture efforts?
2010-07-01
...-Architecture efforts? 102-77.15 Section 102-77.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.15 Who funds the Art-in-Architecture efforts? To the extent not...
-
41 CFR 102-37.575 - Is there a special form for holding agencies to process donations?
2010-07-01
... for holding agencies to process donations? 102-37.575 Section 102-37.575 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.575 Is there a special form for holding agencies to process donations? There is no...
-
29 CFR 102.132 - Reporting of prohibited communications; penalties.
2010-07-01
... communication shall place or cause to be placed on the public record of the proceeding: (1) The communication... 29 Labor 2 2010-07-01 2010-07-01 false Reporting of prohibited communications; penalties. 102.132 Section 102.132 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS...
-
13 CFR 102.36 - Privacy Act standards of conduct.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Privacy Act standards of conduct. 102.36 Section 102.36 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE... existence or development of any system of records that is not the subject of a current or planned public...
-
22 CFR 102.15 - Protection and preservation of wreckage.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Protection and preservation of wreckage. 102.15 Section 102.15 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION United... constitutes a public hazard. When under the latter conditions the wreckage and contents of the aircraft must...
-
41 CFR 102-36.45 - What are our responsibilities in the management of excess personal property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are our responsibilities in the management of excess personal property? 102-36.45 Section 102-36.45 Public Contracts and... § 102-36.45 What are our responsibilities in the management of excess personal property? (a) Agency...
-
41 CFR 102-33.70 - What directives must we follow when planning to acquire Government aircraft?
2010-07-01
... Parts Planning to Acquire Government Aircraft § 102-33.70 What directives must we follow when planning... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What directives must we follow when planning to acquire Government aircraft? 102-33.70 Section 102-33.70 Public Contracts and...
-
41 CFR 102-36.450 - Do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.450 Section 102-36.450 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.450 Do we report excess shelf-life items? (a) When there are quantities on hand, that...
-
41 CFR 102-193.20 - What are the specific agency responsibilities for records management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the specific agency responsibilities for records management? 102-193.20 Section 102-193.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
-
41 CFR 102-75.320 - Does appraisal information need to be kept confidential?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does appraisal information need to be kept confidential? 102-75.320 Section 102-75.320 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 75-REAL PROPERTY DISPOSAL Surplus Real...
-
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Introduction. 413.1 Section 413.1 Public Health... PROSPECTIVELY DETERMINED PAYMENT RATES FOR SKILLED NURSING FACILITIES Introduction and General Rules § 413.1 Introduction. (a) Basis, scope, and applicability—(1) Statutory basis—(i) Basic provisions. (A) Section 1815 of...
-
41 CFR 302-9.102 - How many POV's may I transport to a post of duty?
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false How many POV's may I transport to a post of duty? 302-9.102 Section 302-9.102 Public Contracts and Property Management Federal... TRANSPORTATION AND EMERGENCY STORAGE OF A PRIVATELY OWNED VEHICLE Transportation General § 302-9.102 How many POV...
-
41 CFR 102-192.100 - How do we submit our annual mail management report to GSA?
2010-07-01
... management report to GSA? If your agency is a large agency, as defined in § 102-192.35, you must submit... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we submit our annual mail management report to GSA? 102-192.100 Section 102-192.100 Public Contracts and Property...
-
41 CFR 102-75.900 - What is a negotiated sale for economic development purposes?
2010-07-01
... sale for economic development purposes? 102-75.900 Section 102-75.900 Public Contracts and Property... negotiated sale for economic development purposes? A negotiated sale for economic development purposes means... community's economic benefit. This type of negotiated sale is acceptable where the expected public benefits...
-
Cheng, X.; Degryse, H.A.
2010-01-01
We provide the first evidence on how the introduction of information sharing via a public credit registry affects banks’ lending decisions. We employ a unique dataset containing detailed information on credit card applications and decisions from one of the leading banks in China. While we do not
-
2010-07-01
... Management Risks and Risk Reduction Strategies § 102-80.55 Are Federal agencies responsible for managing the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Federal agencies responsible for managing the execution of risk reduction projects? 102-80.55 Section 102-80.55 Public...
-
41 CFR 102-37.45 - How long is property available for donation screening?
2010-07-01
... available for donation screening? 102-37.45 Section 102-37.45 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.45 How long is property available for donation screening? Entities authorized to participate in the donation program may...
-
41 CFR 102-75.765 - What does the term “law enforcement” mean?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does the term âlaw enforcementâ mean? 102-75.765 Section 102-75.765 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 75-REAL PROPERTY DISPOSAL Surplus Real Property Disposal...
-
41 CFR 102-33.30 - What are the duties of an agency's Senior Aviation Management Official (SAMO)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the duties of an agency's Senior Aviation Management Official (SAMO)? 102-33.30 Section 102-33.30 Public Contracts... § 102-33.30 What are the duties of an agency's Senior Aviation Management Official (SAMO)? The SAMO's...
-
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1219.1 Section 1219.1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE COMPETITIVE SERVICE ELIGIBILITY § 1219.1 Introduction. Section 415(d), Title IV, of the Domestic Volunteer Service Act...
-
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1218.1 Section 1218.1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE VISTA VOLUNTEERS-HEARING OPPORTUNITY § 1218.1 Introduction. Section 104(d) of the Domestic Volunteer Service Act of...
-
2010-01-01
... INFORMATION MEDIA § 1213.102 Policy. (a) NASA, a scientific and technical Agency, is committed to a culture of... culture of openness, NASA employees may, consistent with this policy, speak to the press and the public... Policy Directives). Examples of information not releasable under this policy include, without limitation...
-
41 CFR 102-117.105 - What does best value mean when routing a shipment?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does best value mean when routing a shipment? 102-117.105 Section 102-117.105 Public Contracts and Property Management... 117-TRANSPORTATION MANAGEMENT Business Rules To Consider Before Shipping Freight or Household Goods...
-
41 CFR 102-79.20 - What standard must Executive agencies promote when assigning space?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What standard must Executive agencies promote when assigning space? 102-79.20 Section 102-79.20 Public Contracts and Property... PROPERTY 79-ASSIGNMENT AND UTILIZATION OF SPACE Assignment and Utilization of Space Assignment of Space...
-
41 CFR 102-33.95 - What is the process for budgeting to acquire commercial aviation services (CAS)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for budgeting to acquire commercial aviation services (CAS)? 102-33.95 Section 102-33.95 Public Contracts and... Parts The Process for Budgeting to Acquire Government Aircraft § 102-33.95 What is the process for...
-
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1217.1 Section 1217.1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE VISTA VOLUNTEER LEADER § 1217.1 Introduction. Section 105(a)(1), Part A, of the Domestic Volunteer Service Act of...
-
41 CFR 102-34.340 - Do we need a fleet management information system?
2010-07-01
... management information system? 102-34.340 Section 102-34.340 Public Contracts and Property Management Federal... VEHICLE MANAGEMENT Federal Fleet Report § 102-34.340 Do we need a fleet management information system? Yes, you must have a fleet management information system at the department or agency level that — (a...
-
41 CFR 102-36.455 - How do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.455 Section 102-36.455 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.455 How do we report excess shelf-life items? You must identify the property as shelf...
-
41 CFR 301-75.102 - What pre-employment interview travel expenses are not payable?
2010-07-01
... interview travel expenses are not payable? 301-75.102 Section 301-75.102 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75-PRE-EMPLOYMENT INTERVIEW TRAVEL Travel Expenses § 301-75.102 What pre-employment interview travel...
-
41 CFR 102-193.10 - What are the goals of the Federal Records Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the goals of the Federal Records Management Program? 102-193.10 Section 102-193.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION...
-
42 CFR 102.2 - Summary of available benefits.
2010-10-01
... Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... benefits paid under § 102.82(c) are secondary to death and disability benefits under the PSOB Program. The... potential third-party payor makes a determination on the availability of similar benefits and has the right...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the responsibilities and functions of an agency Committee Management Officer (CMO)? 102-3.115 Section 102-3.115 Public...? § 102-3.115 What are the responsibilities and functions of an agency Committee Management Officer (CMO...
-
41 CFR 102-37.40 - What type of surplus property is available for donation?
2010-07-01
... property is available for donation? 102-37.40 Section 102-37.40 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.40 What type of surplus property is available for donation? All surplus property (including property held by...
-
41 CFR 102-34.300 - How do we dispose of a domestic fleet motor vehicle?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we dispose of a domestic fleet motor vehicle? 102-34.300 Section 102-34.300 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...
-
41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?
2010-07-01
...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...
-
2010-07-01
... Parts Planning to Acquire Government Aircraft § 102-33.75 What other guidance is available to us in... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What other guidance is available to us in planning to acquire Government aircraft? 102-33.75 Section 102-33.75 Public Contracts and...
-
41 CFR 102-76.60 - To which facilities does the Architectural Barriers Act apply?
2010-07-01
... PROPERTY 76-DESIGN AND CONSTRUCTION Architectural Barriers Act § 102-76.60 To which facilities does the Architectural Barriers Act apply? (a) The Architectural Barriers Act applies to any facility that is intended... the Architectural Barriers Act apply? 102-76.60 Section 102-76.60 Public Contracts and Property...
-
41 CFR 102-34.230 - How am I responsible for protecting Government motor vehicles?
2010-07-01
... theft or damage; and (b) Lock the unattended Government motor vehicle. (The only exception to this... protecting Government motor vehicles? 102-34.230 Section 102-34.230 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.230 How am I...
-
41 CFR 102-74.500 - Can Federal agencies disapprove permit applications or cancel issued permits?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can Federal agencies disapprove permit applications or cancel issued permits? 102-74.500 Section 102-74.500 Public Contracts and... cancel issued permits? Yes, Federal agencies may disapprove any permit application or cancel an issued...
-
Nemec, Antonia A; Bush, Korie B; Towle-Weicksel, Jamie B; Taylor, B Frazier; Schulz, Vincent; Weidhaas, Joanne B; Tuck, David P; Sweasy, Joann B
2016-11-01
Repair of DNA damage is critical for maintaining the genomic integrity of cells. DNA polymerase lambda (POLL/Pol λ) is suggested to function in base excision repair (BER) and nonhomologous end-joining (NHEJ), and is likely to play a role in damage tolerance at the replication fork. Here, using next-generation sequencing, it was discovered that the POLL rs3730477 single-nucleotide polymorphism (SNP) encoding R438W Pol λ was significantly enriched in the germlines of breast cancer patients. Expression of R438W Pol λ in human breast epithelial cells induces cellular transformation and chromosomal aberrations. The role of estrogen was assessed as it is commonly used in hormone replacement therapies and is a known breast cancer risk factor. Interestingly, the combination of estrogen treatment and the expression of the R438W Pol λ SNP drastically accelerated the rate of transformation. Estrogen exposure produces 8-oxoguanine lesions that persist in cells expressing R438W Pol λ compared with wild-type (WT) Pol λ-expressing cells. Unlike WT Pol λ, which performs error-free bypass of 8-oxoguanine lesions, expression of R438W Pol λ leads to an increase in mutagenesis and replicative stress in cells treated with estrogen. Together, these data suggest that individuals who carry the rs3730477 POLL germline variant have an increased risk of estrogen-associated breast cancer. The Pol λ R438W mutation can serve as a biomarker to predict cancer risk and implicates that treatment with estrogen in individuals with this mutation may further increase their risk of breast cancer. Mol Cancer Res; 14(11); 1068-77. ©2016 AACR. ©2016 American Association for Cancer Research.
-
DEFF Research Database (Denmark)
Andersen, Jacob; Taboureau, Olivier; Hansen, Kasper B.
2009-01-01
antidepressants, including the selective serotonin reuptake inhibitor citalopram and the tricyclic antidepressants imipramine, clomipramine, and amitriptyline. A conservative mutation of Ser-438 to threonine (S438T) selectively increased the K-i values for these antidepressants up to 175-fold. The effects...
-
41 CFR 102-118.60 - To what extent must my agency use electronic commerce?
2010-07-01
... agency use electronic commerce? 102-118.60 Section 102-118.60 Public Contracts and Property Management... Services § 102-118.60 To what extent must my agency use electronic commerce? Your agency must use electronic commerce in all areas of your transportation program. This includes the use of electronic systems...
-
41 CFR 102-73.70 - Are Executive agencies required to acquire leased space by negotiation?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Executive agencies required to acquire leased space by negotiation? 102-73.70 Section 102-73.70 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 73-REAL ESTATE ACQUISITION...
-
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Introduction. 292.11 Section 292.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE NATIONAL RECREATION AREAS Whiskeytown-Shasta-Trinity National Recreation Area § 292.11 Introduction. (a...
-
42 CFR 493.1200 - Introduction.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Introduction. 493.1200 Section 493.1200 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Introduction. (a) Each laboratory that performs nonwaived testing must establish and maintain written policies...
-
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Introduction. 25.1 Section 25.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC PARTICIPATION IN PROGRAMS UNDER THE... Introduction. This part sets forth minimum requirements and suggested program elements for public participation...
-
Matsukawa, Jun; Hori, Yasunobu; Nishida, Haruyuki; Kajino, Masahiro; Inatomi, Nobuhiro
2011-05-01
TAK-438 is a novel potassium-competitive acid blocker (P-CAB) type antisecretory agent that reversibly inhibits gastric H+, K+-ATPase. Previously, we showed that TAK-438 has superior efficacy compared to lansoprazole, a proton pump inhibitor, in the inhibition of acid secretion in vivo. In this study, we investigated the differences in the mode of actions of the two drugs using primary cultured rabbit gastric glands. TAK-438 and lansoprazole inhibited gastric acid formation in acutely isolated gastric glands (IC₅₀) values, 0.30 and 0.76 μM, respectively). In cultured gastric glands that were preincubated with TAK-438, the inhibitory effect on forskolin-stimulated acid formation was augmented over the incubation period, whereas the inhibitory effect of lansoprazole was not affected by time of incubation. Next, we evaluated the durations of the actions of TAK-438 and lansoprazole after gastric glands were incubated with either drug for 2h followed by washout. Even 8h after the drug washout, TAK-438 at higher concentrations inhibited acid formation, but the inhibitory effect of lansoprazole disappeared immediately after washout. Additionally, only a small amount of [¹⁴C] lansoprazole accumulated in resting glands, and this accumulation was enhanced by treatment with 1 μM of forskolin. In contrast, high levels of [¹⁴C] TAK-438 accumulated in both resting and forskolin-treated glands. Furthermore, a 2-h preincubation followed by washout demonstrated a slow clearance of [¹⁴C] TAK-438 from the glands. These findings suggest that TAK-438 exerts a longer and more potent antisecretory effect than lansoprazole as a result of its high accumulation and slow clearance from the gastric glands. Copyright © 2011 Elsevier Inc. All rights reserved.
-
42 CFR 405.1801 - Introduction.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Introduction. 405.1801 Section 405.1801 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM....1801 Introduction. (a) Definitions. As used in this subpart: Administrator means the Administrator or...
-
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Introduction. 292.14 Section 292.14 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE NATIONAL RECREATION AREAS Sawtooth National Recreation Area-Private Lands § 292.14 Introduction. (a) Purpose. In...
-
41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?
2010-07-01
... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...
-
45 CFR 1220.1-1 - Introduction.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1220.1-1 Section 1220.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE PAYMENT OF VOLUNTEER LEGAL EXPENSES General § 1220.1-1 Introduction. Section 419 of the Domestic Volunteer...
-
41 CFR 102-85.40 - What are the major components of the pricing policy?
2010-07-01
... components of the pricing policy? 102-85.40 Section 102-85.40 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.40 What are the major components of the pricing policy? The major components of the pricing policy are: (a) An OA between a customer...
-
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Introduction. 301.1 Section 301.1 Foreign Relations PEACE CORPS PUBLIC ACCESS TO CLASSIFIED MATERIAL § 301.1 Introduction. The following regulations implement Executive Order 12356 and provide guidance for members of the public desiring a review for...
-
Beatty, Michael J.
1988-01-01
Examines the choice-making processes of students engaged in the selection of speech introduction strategies. Finds that the frequency of students making decision-making errors was a positive function of public speaking apprehension. (MS)
-
41 CFR 102-72.45 - What are the different types of delegations related to facility management?
2010-07-01
... different types of delegations related to facility management? The principal types of delegations involved... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the different types of delegations related to facility management? 102-72.45 Section 102-72.45 Public Contracts and...
-
41 CFR 102-80.135 - Who is a qualified fire protection engineer?
2010-07-01
... protection engineer? 102-80.135 Section 102-80.135 Public Contracts and Property Management Federal Property... qualified fire protection engineer? A qualified fire protection engineer is defined as an individual with a thorough knowledge and understanding of the principles of physics and chemistry governing fire growth...
-
42 CFR 482.102 - Condition of participation: Patient and living donor rights.
2010-10-01
... health, disability, or life insurance may be affected; (8) The donor's right to opt out of donation at... donor rights. 482.102 Section 482.102 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) STANDARDS AND CERTIFICATION CONDITIONS OF PARTICIPATION FOR...
-
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
-
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 32.1 Section 32.1 Public Lands: Interior Office of the Secretary of the Interior GRANTS TO STATES FOR ESTABLISHING YOUNG ADULT CONSERVATION CORPS (YACC) PROGRAM § 32.1 Introduction. (a) The Young Adult Conservation Corps (YACC) is...
-
42 CFR 102.31 - Medical benefits.
2010-10-01
... Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION... covered injury, or to give relief, reduce the degree or the period of disability, or aid in lessening the... provided in § 102.84, the Secretary retains the right to recover medical benefits paid to requesters by...
-
Klag, Elizabeth A; McNamara, Kelly; Geraghty, Sheela R; Keim, Sarah A
2015-10-01
Breast milk feeding and solid food introduction can influence infant growth, but are rarely examined together. The objectives were to describe relationships between feeding practices, feeding practices and weight gain, and how the relationship of breast milk feeding and growth may change when breastfed infants start solid foods before 6 months. Data were analyzed on 438 infants from the Moms2Moms Study (2011-2012, Ohio), using multivariable linear and logistic regression models to explore each of the relationships. For each additional month of breast milk feeding, solid food introduction was delayed by 1.32 days (95% CI 0.11 to 2.53) and average weight gain per month decreased by 5.05 g (95% CI 7.39 to 2.17). There was no association between solid food introduction and growth. Longer breastfeeding duration was associated with slower growth regardless of solid food introduction. Age at solid food introduction was not associated with growth. © The Author(s) 2015.
-
41 CFR 101-29.102 - Use of metric system of measurement in Federal product descriptions.
2010-07-01
... PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.1-General § 101-29.102 Use of metric system of measurement in... measurement in Federal product descriptions. 101-29.102 Section 101-29.102 Public Contracts and Property... Federal agencies to: (a) Maintain close liaison with other Federal agencies, State and local governments...
-
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 26.1 Section 26.1 Public Lands: Interior Office of the Secretary of the Interior GRANTS TO STATES FOR ESTABLISHING YOUTH CONSERVATION CORPS PROGRAMS § 26.1 Introduction. (a) The Youth Conservation Corps (YCC) is a program of summer...
-
41 CFR 102-118.65 - Can my agency receive electronic billing for payment of transportation services?
2010-07-01
... electronic billing for payment of transportation services? 102-118.65 Section 102-118.65 Public Contracts and... Transportation Services § 102-118.65 Can my agency receive electronic billing for payment of transportation... to use electronic billing for the procurement and billing of transportation services. ...
-
2010-07-01
... environmental issues in Federal construction and lease construction projects? 102-80.75 Section 102-80.75 Public... Management Assessment of Environmental Issues § 102-80.75 Who assesses environmental issues in Federal construction and lease construction projects? Federal agencies must assess required environmental issues...
-
41 CFR 102-38.105 - Under what conditions may we negotiate sales of personal property?
2010-07-01
... property when— (a) The personal property has an estimated fair market value that does not exceed $15,000... may we negotiate sales of personal property? 102-38.105 Section 102-38.105 Public Contracts and... REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Negotiated Sales § 102-38.105 Under...
-
41 CFR 102-192.130 - What are your general responsibilities as an agency mail manager?
2010-07-01
... responsibilities as an agency mail manager? 102-192.130 Section 102-192.130 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.130 What are your general responsibilities as an agency mail manager? In addition to carrying out the responsibilities in Subparts B, C, D...
-
41 CFR 102-192.135 - Must we have a mail center manager at our facility?
2010-07-01
... center manager at our facility? 102-192.135 Section 102-192.135 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.135 Must we have a mail center manager at our facility? Yes, every facility that has more than two full time people dedicated to...
-
41 CFR 102-34.70 - What do we do with completed calculations of our fleet vehicle acquisitions?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What do we do with completed calculations of our fleet vehicle acquisitions? 102-34.70 Section 102-34.70 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
-
41 CFR 102-117.285 - What are my choices if a TSP's performance is not satisfactory?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are my choices if a TSP's performance is not satisfactory? 102-117.285 Section 102-117.285 Public Contracts and Property... are my choices if a TSP's performance is not satisfactory? You may choose to place a TSP in temporary...
-
2010-07-01
... estimated fair market value. Where hazardous substance activity is identified, see §§ 102-75.340 and 102-75... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are disposal....255 Public Contracts and Property Management Federal Property Management Regulations System (Continued...
-
41 CFR 102-37.55 - Who pays for transportation and other costs associated with a donation?
2010-07-01
... transportation and other costs associated with a donation? 102-37.55 Section 102-37.55 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.55 Who pays for transportation and other costs associated with a donation? The receiving...
-
41 CFR 102-37.80 - What happens to surplus property that isn't transferred for donation?
2010-07-01
... property that isn't transferred for donation? 102-37.80 Section 102-37.80 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.80 What happens to surplus property that isn't transferred for donation? Surplus property not transferred for...
-
41 CFR 102-37.50 - What is the general process for requesting surplus property for donation?
2010-07-01
... process for requesting surplus property for donation? 102-37.50 Section 102-37.50 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.50 What is the general process for requesting surplus property for donation? The process for...
-
41 CFR 102-84.15 - Why must I provide information for the Annual Real Property Inventory?
2010-07-01
...; and (2) Establish information systems, implement inventory controls and conduct surveys, in accordance... information for the Annual Real Property Inventory? 102-84.15 Section 102-84.15 Public Contracts and Property... PROPERTY 84-ANNUAL REAL PROPERTY INVENTORIES § 102-84.15 Why must I provide information for the Annual Real...
-
41 CFR 102-192.125 - What is the appropriate managerial level for an agency mail manager?
2010-07-01
... managerial level for an agency mail manager? 102-192.125 Section 102-192.125 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.125 What is the appropriate managerial level for an agency mail manager? The agency mail manager should be at a managerial...
-
41 CFR 102-117.255 - What actions may I take if the TSP's performance is not satisfactory?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What actions may I take if the TSP's performance is not satisfactory? 102-117.255 Section 102-117.255 Public Contracts and... may I take if the TSP's performance is not satisfactory? If the TSP's performance is not satisfactory...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May SASPs pick up or store donated drug paraphernalia in their distribution centers? 102-41.230 Section 102-41.230 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL...
-
41 CFR 109-27.102-52 - Implementation.
2010-07-01
... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...
-
41 CFR 102-85.5 - By what authority is the pricing policy in this part prescribed?
2010-07-01
... pricing policy in this part prescribed? 102-85.5 Section 102-85.5 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.5 By what authority is the pricing policy in this part prescribed? (a) General authority is granted in the Federal Property and...
-
41 CFR 102-192.140 - What are your general responsibilities as a Federal mail center manager?
2010-07-01
... responsibilities as a Federal mail center manager? 102-192.140 Section 102-192.140 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.140 What are your general responsibilities as a Federal mail center manager? A Federal mail center manager should— (a) Implement policies and...
-
41 CFR 301-11.102 - What is the applicable M&IE rate?
2010-07-01
... 24 hours or more, and you are traveling to a new TDY site or stopover point at midnight The M&IE rate applicable to the new TDY site or stopover point. Travel is 24 hours or more, and you are returning to your...&IE rate? 301-11.102 Section 301-11.102 Public Contracts and Property Management Federal Travel...
-
Statistics a biomedical introduction
Brown, Byron Wm
2009-01-01
CHAPTER 1: Introduction 1 CHAPTER 2: Elementary Rules of Probability 13 CHAPTER 3: Populations, Samples, and the Distribution of the Sample Mean 37 1. Populations and Distributions 38 2. Sampling from Finite Populations 64 3. The Distribution of the Sample Mean 72 CHAPTER 4: Analysis of Matched Pairs Using Sample Means 85 1. A Confidence Interval for the Treatment Effect 86 2. A Hypothesis Test for the Treatment Effect 96 3. Determining the Sample Size 102 CHAPTER 5: Analysis of the Two-Sample Location Problem Using Sample Means 109 1. A Confidence Interval for the Diffe
-
2010-07-01
... concerning photographs for news, advertising or commercial purposes? 102-74.420 Section 102-74.420 Public..., Advertising Or Commercial Purposes § 102-74.420 What is the policy concerning photographs for news, advertising or commercial purposes? Except where security regulations, rules, orders, or directives apply or a...
-
2010-07-01
... safety and environmental management policies for real property? 102-80.10 Section 102-80.10 Public... MANAGEMENT REGULATION REAL PROPERTY 80-SAFETY AND ENVIRONMENTAL MANAGEMENT General Provisions § 102-80.10 What are the basic safety and environmental management policies for real property? The basic safety and...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are there special provisions to reporting and transferring drug paraphernalia forfeited under 21 U.S.C. 863? 102-41.225 Section 102-41.225 Public Contracts and Property Management Federal Property Management Regulations System...
-
2010-07-01
... in mail management and mail operations; (b) Identifying better business practices and sharing them... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of support does GSA offer to Federal agency mail management programs? 102-192.175 Section 102-192.175 Public...
-
41 CFR 102-192.145 - Which program levels should have a mail manager?
2010-07-01
... should have a mail manager? 102-192.145 Section 102-192.145 Public Contracts and Property Management... have a mail manager? Every program level within a Federal agency that generates a significant quantity of outgoing mail should have its own mail manager. Each agency must decide which programs will have a...
-
2010-07-01
... the Department of the Interior have if it determines that minerals in the land are unsuitable for disposition under the public land mining and mineral leasing laws? 102-75.105 Section 102-75.105 Public... Interior have if it determines that minerals in the land are unsuitable for disposition under the public...
-
41 CFR 102-72.30 - What are the different types of delegations related to real estate leasing?
2010-07-01
... types of delegations related to real estate leasing? 102-72.30 Section 102-72.30 Public Contracts and... REGULATION REAL PROPERTY 72-DELEGATION OF AUTHORITY Delegation of Authority § 102-72.30 What are the different types of delegations related to real estate leasing? Delegations related to real estate leasing...
-
2010-07-01
... Hazardous Substances Pollution Contingency Plan and initiating or cooperating with others in the actions... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who must perform the... disposal? 102-75.965 Section 102-75.965 Public Contracts and Property Management Federal Property...
-
41 CFR 102-73.170 - What types of special purpose space may the Department of Agriculture lease?
2010-07-01
... purpose space may the Department of Agriculture lease? 102-73.170 Section 102-73.170 Public Contracts and... § 102-73.170 What types of special purpose space may the Department of Agriculture lease? The Department of Agriculture is delegated the authority to lease the following types of special purpose space: (a...
-
41 CFR 102-37.540 - What is the authority for donations to the American National Red Cross?
2010-07-01
... for donations to the American National Red Cross? 102-37.540 Section 102-37.540 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to the American National Red Cross § 102-37.540 What is the authority for donations to the American National Red Cross? Section 551...
-
41 CFR 102-74.425 - What is the policy concerning dogs and other animals on Federal property?
2010-07-01
... concerning dogs and other animals on Federal property? 102-74.425 Section 102-74.425 Public Contracts and... REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Conduct on Federal Property Dogs and Other Animals § 102-74.425 What is the policy concerning dogs and other animals on Federal property? No person may bring dogs...
-
2010-07-01
... responsibilities to provide national visibility for Art-in-Architecture? 102-77.25 Section 102-77.25 Public... MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.25 Do Federal agencies have responsibilities to provide national visibility for Art-in-Architecture? Yes, Federal...
-
2010-07-01
... policy must Federal agencies follow in the management of facilities? 102-74.155 Section 102-74.155 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Energy Conservation § 102-74.155 What energy conservation policy must Federal agencies follow in the management of facilities...
-
41 CFR 102-2.30 - Where and in what formats is the FMR published?
2010-07-01
... formats is the FMR published? 102-2.30 Section 102-2.30 Public Contracts and Property Management Federal... published? Proposed rules are published in the Federal Register. FMR bulletins are published in looseleaf format. FMR interim and final rules are published in the following formats— (a) Federal Register under...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Do we report to GSA all forfeited, voluntarily abandoned, or unclaimed drug paraphernalia not required for official use? 102-41.215 Section 102-41.215 Public Contracts and Property Management Federal Property Management Regulations System...
-
40 CFR 180.438 - Lambda-cyhalothrin and an isomer gamma-cyhalothrin; tolerances for residues.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Lambda-cyhalothrin and an isomer gamma... FOOD Specific Tolerances § 180.438 Lambda-cyhalothrin and an isomer gamma-cyhalothrin; tolerances for residues. (a) General. (1) Tolerances are established for the combined residues of the pyrethroid lambda...
-
2010-07-01
... being offered for sale be withdrawn and approved for donation? 102-37.85 Section 102-37.85 Public... MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.85 Can surplus property being offered for sale be withdrawn and approved for donation...
-
41 CFR 105-64.102 - What is GSA's policy on disclosure of information in a system of records?
2010-07-01
... disclosure of information in a system of records? 105-64.102 Section 105-64.102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION... Responsibilities § 105-64.102 What is GSA's policy on disclosure of information in a system of records? No...
-
2010-07-01
... consideration should be given to designating items having possible historical or artistic value as personal... related personal property in a structure scheduled for demolition? 102-75.170 Section 102-75.170 Public... As Personal Property § 102-75.170 What happens to the related personal property in a structure...
-
41 CFR 102-118.130 - Must my agency use a GBL for express, courier, or small package shipments?
2010-07-01
... package express delivery, the terms and conditions of that contract are binding. ... for express, courier, or small package shipments? 102-118.130 Section 102-118.130 Public Contracts and... Transportation Services § 102-118.130 Must my agency use a GBL for express, courier, or small package shipments...
-
41 CFR 102-37.465 - May a SASP modify or release any of the terms and conditions of donation?
2010-07-01
... release any of the terms and conditions of donation? 102-37.465 Section 102-37.465 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Agencies, Service... SASP modify or release any of the terms and conditions of donation? You may alter or grant releases...
-
41 CFR 102-75.145 - Is GSA required to review each report of excess?
2010-07-01
... landholding agency, in writing, whether the report is acceptable or other information is needed within 15... review each report of excess? 102-75.145 Section 102-75.145 Public Contracts and Property Management... Is GSA required to review each report of excess? Yes, GSA must review each report of excess to...
-
2010-07-01
... medical shelf-life items held for national emergency purposes? 102-36.460 Section 102-36.460 Public... Disposal Requires Special Handling Shelf-Life Items § 102-36.460 Do we report excess medical shelf-life items held for national emergency purposes? When the remaining shelf life of any medical materials or...
-
2010-07-01
... assignments. However, provisions are necessary to cover the GSA and customer relationship if an OA expires... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What happens if a customer agency continues occupancy after the expiration of an OA? 102-85.205 Section 102-85.205 Public...
-
2010-07-01
... What role does my agency play in the Standard and Optional Forms Management Program? Your agency head... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What role does my agency play in the Standard and Optional Forms Management Program? 102-194.30 Section 102-194.30 Public...
-
29 CFR 102.143 - “Adversary adjudication” defined; entitlement to award; eligibility for award.
2010-07-01
...; eligibility for award. 102.143 Section 102.143 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS... Marketing Act (12 U.S.C. 1141j(a)) with not more than 500 employees; and (5) Any other partnership, corporation, association, unit of local government, or public or private organization with a net worth of not...
-
41 CFR 102-74.135 - Who selects construction and alteration projects that are to be performed?
2010-07-01
... and alteration projects that are to be performed? 102-74.135 Section 102-74.135 Public Contracts and... construction and alteration projects that are to be performed? The Administrator of General Services selects construction and alteration projects to be performed. ...
-
2010-07-01
... applicability of antitrust laws? 102-75.280 Section 102-75.280 Public Contracts and Property Management Federal... PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.280 What... the applicability of antitrust laws? The disposal agency must promptly provide the Attorney General...
-
41 CFR 102-37.115 - May a holding agency be reimbursed for costs incurred incident to a donation?
2010-07-01
... reimbursed for costs incurred incident to a donation? 102-37.115 Section 102-37.115 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Holding Agency § 102-37.115 May a holding agency be reimbursed for costs incurred incident to a donation? Yes, you, as a holding agency, may...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there any additional personal property sales information that we must submit to the General Services Administration? 102-38.335 Section 102-38.335 Public Contracts and Property Management Federal Property Management Regulations System...
-
41 CFR 102-34.290 - What forms do I use to report a crash involving a domestic fleet motor vehicle?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What forms do I use to report a crash involving a domestic fleet motor vehicle? 102-34.290 Section 102-34.290 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
-
2010-07-01
... FSCAP on non-military FAA-type certificated Government aircraft? 102-33.230 Section 102-33.230 Public... Aircraft Parts Managing Aircraft Parts § 102-33.230 May we use military FSCAP on non-military FAA-type... installation by the FAA. See detailed guidance in FAA Advisory Circular 20-142, “Eligibility and Evaluation of...
-
41 CFR 102-33.190 - What are the aircraft operations and ownership costs for which we must account?
2010-07-01
... operations and ownership costs for which we must account? 102-33.190 Section 102-33.190 Public Contracts and... Parts Accounting for the Cost of Government Aircraft § 102-33.190 What are the aircraft operations and ownership costs for which we must account? You must account for the operations and ownership costs of your...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can the Administrator of General Services waive the postpayment auditing provisions of this subpart? 102-118.420 Section 102-118... Transportation Audits § 102-118.420 Can the Administrator of General Services waive the postpayment auditing...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What information must a Federal agency submit to GSA after the agency has identified a need for construction or alteration of a public building? 102-74.145 Section 102-74.145 Public Contracts and Property Management Federal Property Management Regulations System (Continued...
-
The ethical introduction of genome-based information and technologies into public health.
Howard, H C; Swinnen, E; Douw, K; Vondeling, H; Cassiman, J-J; Cambon-Thomsen, A; Borry, P
2013-01-01
With the human genome project running from 1989 until its completion in 2003, and the incredible advances in sequencing technology and in bioinformatics during the last decade, there has been a shift towards an increase focus on studying common complex disorders which develop due to the interplay of many different genes as well as environmental factors. Although some susceptibility genes have been identified in some populations for disorders such as cancer, diabetes and cardiovascular diseases, the integration of this information into the health care system has proven to be much more problematic than for single gene disorders. Furthermore, with the 1000$ genome supposedly just around the corner, and whole genome sequencing gradually being integrated into research protocols as well as in the clinical context, there is a strong push for the uptake of additional genomic testing. Indeed, the advent of public health genomics, wherein genomics would be integrated in all aspects of health care and public health, should be taken seriously. Although laudable, these advances also bring with them a slew of ethical and social issues that challenge the normative frameworks used in clinical genetics until now. With this in mind, we highlight herein 5 principles that are used as a primer to discuss the ethical introduction of genome-based information and genome-based technologies into public health. Copyright © 2013 S. Karger AG, Basel.
-
2010-07-01
... exchange excess medical shelf-life items with other federal agencies? 102-36.465 Section 102-36.465 Public... Disposal Requires Special Handling Shelf-Life Items § 102-36.465 May we transfer or exchange excess medical shelf-life items with other federal agencies? Yes, you may transfer or exchange excess medical shelf...
-
41 CFR 102-118.260 - Must my agency send all quotations, tenders, or contracts with a TSP to GSA?
2010-07-01
... quotations, tenders, or contracts with a TSP to GSA? 102-118.260 Section 102-118.260 Public Contracts and... REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Use of Government Billing Documents Quotations, Tenders Or Contracts § 102-118.260 Must my agency send all quotations, tenders, or contracts with a TSP to...
-
41 CFR 102-38.315 - Are we required to use Alternative Disputes Resolution for sales contracts?
2010-07-01
... Alternative Disputes Resolution for sales contracts? 102-38.315 Section 102-38.315 Public Contracts and... required to use Alternative Disputes Resolution for sales contracts? No, you are not required to use Alternative Disputes Resolution (ADR) for sales contracts. However, you are encouraged to use ADR procedures...
-
41 CFR 102-34.65 - How may we request an exemption from the fuel economy standards?
2010-07-01
... exemption from the fuel economy standards? 102-34.65 Section 102-34.65 Public Contracts and Property... an exemption from the fuel economy standards? You must submit a written request for an exemption from the fuel economy standards to: Administrator, General Services Administration, ATTN: Deputy Associate...
-
41 CFR 102-75.1155 - May an acceptable gift of property be converted to money?
2010-07-01
... of property be converted to money? 102-75.1155 Section 102-75.1155 Public Contracts and Property...-75.1155 May an acceptable gift of property be converted to money? GSA can determine whether or not a gift of property can and should be converted to money. After conversion, GSA must deposit the funds...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who must the Office of Justice Programs (OJP) and the Federal Emergency Management Agency (FEMA) notify that surplus real property is available for correctional facility, law enforcement, or emergency management response purposes? 102-75.760 Section 102-75.760 Public...
-
29 CFR 4.102 - Administration of the Act.
2010-07-01
...'Hara Service Contract Act Introductory § 4.102 Administration of the Act. As provided by section 4 of the Act and under provisions of sections 4 and 5 of the Walsh-Healey Public Contracts Act (49 Stat... authorized and directed to administer and enforce the provisions of the McNamara-O'Hara Service Contract Act...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What source of information can my agency use to identify materials that describe how to do business with GSA? 102-2.125 Section 102-2.125 Public Contracts and Property Management Federal Property Management Regulations System...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the scope and philosophy of the General Services Administration's (GSA) real property policies? 102-71.5 Section 102-71.5...) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 71-GENERAL § 102-71.5 What is the scope and philosophy of the...
-
2010-07-01
... 32 National Defense 3 2010-07-01 2010-07-01 true Introduction. 516.69 Section 516.69 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY AID OF CIVIL AUTHORITIES AND PUBLIC RELATIONS LITIGATION Cooperation With the Office of Special Counsel § 516.69 Introduction. This subpart...
-
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Introduction. 66.1 Section 66.1 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES AVAILABILITY OF THE RECORDS OF THE NATIONAL ENDOWMENT FOR DEMOCRACY § 66.1 Introduction. These regulations amend the Code of Federal Regulations to...
-
41 CFR 102-192.150 - What are your general responsibilities as a program level mail manager?
2010-07-01
... responsibilities as a program level mail manager? 102-192.150 Section 102-192.150 Public Contracts and Property... general responsibilities as a program level mail manager? Your responsibilities at the program level include— (a) Working closely with the agency mail manager and mail center managers who handle significant...
-
41 CFR 101-27.102 - Economic order quantity principle.
2010-07-01
... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order quantity (EOQ) principle is a means for achieving economical inventory management. Application of the EOQ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity...
-
2010-07-01
... forfeited distilled spirits, wine, and beer to GSA for disposal? 102-41.205 Section 102-41.205 Public..., and Beer § 102-41.205 Do we report all forfeited distilled spirits, wine, and beer to GSA for disposal? (a) Yes, except do not report distilled spirits, wine, and beer not fit for human consumption or for...
-
2010-07-01
... sell tobacco products in vending machines in Government-owned and leased space? 102-74.75 Section 102... Services § 102-74.75 May Federal agencies sell tobacco products in vending machines in Government-owned and leased space? No. Section 636 of Public Law 104-52 prohibits the sale of tobacco products in vending...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there any other information that needs to accompany (or be submitted with) the Report of Excess Real Property (Standard Form 118)? 102-75.120 Section 102-75.120 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL...
-
2010-07-01
... a SASP make when requesting surplus property for donation? 102-37.200 Section 102-37.200 Public... MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY State Agency for Surplus... requesting surplus property for donation? When requesting or applying for property, you must certify that: (a...
-
Publications | Page 102 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the ... Mainstreaming climate change in state development planning : an analysis of ... cash transfers help Ghana address the widening gap between rich and poor ...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there a general hierarchy of consideration that agencies must follow in their utilization of space? 102-79.55 Section 102-79... Utilization of Space Utilization of Space § 102-79.55 Is there a general hierarchy of consideration that...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Competition in Contracting Act of 1984, as amended (CICA), applicable to lease acquisition? 102-73.100 Section 102-73.100... Contracting Act of 1984 § 102-73.100 Is the Competition in Contracting Act of 1984, as amended (CICA...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we transfer or donate canines that have been used in the performance of law enforcement duties? 102-36.365 Section 102-36.365 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL...
-
2010-07-01
... responsible party with respect to the hazardous substance activity? 102-75.345 Section 102-75.345 Public... Relating to Hazardous Substance Activity § 102-75.345 What is different about the statements in the offer... the hazardous substance activity? In the case where the purchaser or grantee is a potentially...
-
75 FR 47797 - Board of Visitors, Defense Language Institute Foreign Language Center
2010-08-09
... or speak to any issue under consideration by the Board. Although open to the public, gate access is... introduction, board purpose, operating procedures review, and oath. DLIFLC functional areas will be discussed. Public's Accessibility to the Meeting: Pursuant to 5 U.S.C. 552b and 41 CFR 102-3.140 through 102-3.165...
-
2010-07-01
... other hanging materials that are made of non-combustible or flame-resistant fabric; (f) Use only... resistant; (g) Cooperate with GSA to develop and maintain fire prevention programs that provide the maximum... accident and fire prevention responsibilities of occupant agencies? 102-74.360 Section 102-74.360 Public...
-
41 CFR 102-117.55 - What are the advantages and disadvantages of using a rate tender?
2010-07-01
... and disadvantages of using a rate tender? 102-117.55 Section 102-117.55 Public Contracts and Property... the advantages and disadvantages of using a rate tender? (a) Using a rate tender is an advantage when... volume to obtain favorable rates. (b) Using a rate tender may be a disadvantage when: (1) You have...
-
41 CFR 102-3.185 - What does this subpart require agencies to do?
2010-07-01
... National Academy of Sciences or the National Academy of Public Administration? § 102-3.185 What does this... recommendation provided to an agency by the National Academy of Sciences (NAS) or the National Academy of Public Administration (NAPA) under an agreement between the agency and an academy, if such advice or recommendation was...
-
2010-07-01
... consider in determining whether to establish a home marketing incentive payment program? 302-14.102 Section 302-14.102 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RESIDENCE TRANSACTION ALLOWANCES 14-HOME MARKETING INCENTIVE PAYMENTS Agency Responsibilities...
-
41 CFR 101-39.102-2 - Effective date of determination.
2010-07-01
... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102-2 Effective date of determination. Unless a longer time is... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effective date of...
-
41 CFR 102-37.175 - How does a SASP find out what property is potentially available for donation?
2010-07-01
... what property is potentially available for donation? 102-37.175 Section 102-37.175 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY State Agency for Surplus Property (SASP... available for donation? A SASP may conduct onsite screening at various Federal facilities, contact or submit...
-
41 CFR 102-117.35 - What are the advantages and disadvantages of using GSA's tender of service?
2010-07-01
... and disadvantages of using GSA's tender of service? 102-117.35 Section 102-117.35 Public Contracts and...-117.35 What are the advantages and disadvantages of using GSA's tender of service? (a) It is an... damage claims. (b) It is a disadvantage to use GSA's tender of service when: (1) You want an agreement...
-
Introduction of EDI in the public sector
DEFF Research Database (Denmark)
Falch, Morten
1997-01-01
Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed.......Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed....
-
41 CFR 102-33.370 - What must we do to dispose of military FSCAP or life-limited parts?
2010-07-01
... before you exchange or sell the aircraft or engine (see rules for disposing of uninstalled life-limited... dispose of military FSCAP or life-limited parts? 102-33.370 Section 102-33.370 Public Contracts and... Aircraft Parts Special Requirements for Disposing of Flight Safety Critical Aircraft Parts (fscap) and Life...
-
2010-07-01
... either the fair market value or the fair annual rental value of the property available for disposal. ... value must be obtained for real property disposal transactions? 102-75.305 Section 102-75.305 Public...-75.305 What type of appraisal value must be obtained for real property disposal transactions? For all...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How many days does a Federal agency have to issue a permit following receipt of a completed application? 102-74.480 Section 102... Buildings Permits § 102-74.480 How many days does a Federal agency have to issue a permit following receipt...
-
41 CFR 102-75.943 - What happens if granting an easement will reduce the value of the property?
2010-07-01
... reduce the property's value, agencies must grant the easement for the amount by which the property's fair market value is decreased unless the agency determines that the Government's best interests are served by... an easement will reduce the value of the property? 102-75.943 Section 102-75.943 Public Contracts and...
-
49 CFR 1014.102 - Application.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Application. 1014.102 Section 1014.102 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE SURFACE TRANSPORTATION BOARD § 1014.102 Application...
-
2010-07-01
... who are to be displaced by Federal or Federally assisted projects? Section 218 of the Uniform... real property for the purpose of providing replacement housing for persons who are to be displaced by Federal or Federally assisted projects? 102-75.695 Section 102-75.695 Public Contracts and Property...
-
41 CFR 102-76.15 - What are design and construction services?
2010-07-01
... CONSTRUCTION Design and Construction § 102-76.15 What are design and construction services? Design and construction services are— (a) Site planning and landscape design; (b) Architectural and interior design; and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are design and...
-
41 CFR 102-42.10 - What definitions apply to this part?
2010-07-01
... on Ethics of the Senate, for Senators and employees of the Senate, except that those responsibilities... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What definitions apply..., DONATION, AND DISPOSAL OF FOREIGN GIFTS AND DECORATIONS General Provisions Definitions § 102-42.10 What...
-
41 CFR 102-38.35 - What definitions apply to this part?
2010-07-01
... contacted via e-mail at [email protected] SCs may utilize (and should consider) private sector... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What definitions apply... PROPERTY General Provisions Definitions § 102-38.35 What definitions apply to this part? The following...
-
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...
-
29 CFR 1615.102 - Application.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Application. 1615.102 Section 1615.102 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON... COMMISSION AND IN ACCESSIBILITY OF COMMISSION ELECTRONIC AND INFORMATION TECHNOLOGY § 1615.102 Application...
-
7 CFR 959.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 959.102 Section 959.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulations General § 959.102 Communications. Unless otherwise provided in the order, or by specific direction...
-
41 CFR 102-85.105 - How does an agency pay for customer alterations that exceed the TI allowance?
2010-07-01
... for customer alterations that exceed the TI allowance? 102-85.105 Section 102-85.105 Public Contracts....105 How does an agency pay for customer alterations that exceed the TI allowance? Amounts exceeding the TI allowance are paid in a one-time lump sum and are not amortized over the term of the occupancy...
-
41 CFR 102-192.65 - What features must our finance systems have to keep track of mail costs?
2010-07-01
... finance systems have to keep track of mail costs? 102-192.65 Section 102-192.65 Public Contracts and... What features must our finance systems have to keep track of mail costs? All agencies must have an... requirement, because the level at which it is cost-beneficial differs widely. The agency's finance system(s...
-
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Management. 541.102 Section 541.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND... Executive Employees § 541.102 Management. Generally, “management” includes, but is not limited to...
-
2010-10-01
... 46 Shipping 9 2010-10-01 2010-10-01 false Application. 507.102 Section 507.102 Shipping FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE FEDERAL MARITIME COMMISSION § 507.102 Application. This...
-
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...
-
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 16.102 Section 16.102 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.102 Application. This regulation (§§ 16...
-
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 36.102 Section 36.102... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General § 36.102 Application. (a) General. This part applies to any... courses related to applications, licensing, certification, or credentialing for secondary or postsecondary...
-
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application. 550.102 Section 550.102 Wildlife and Fisheries MARINE MAMMAL COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.102 Application. This part...
-
16 CFR 1028.102 - Definitions.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Definitions. 1028.102 Section 1028.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROTECTION OF HUMAN SUBJECTS § 1028.102... investigator and subject. “Private information” includes information about behavior that occurs in a context in...
-
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Application. 28.102 Section 28.102 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.102 Application. This part...
-
41 CFR 102-117.345 - Is there a requirement for me to report to GSA on my transportation activities?
2010-07-01
... for me to report to GSA on my transportation activities? 102-117.345 Section 102-117.345 Public... requirement for me to report to GSA on my transportation activities? (a) Currently, there is no requirement for reporting to GSA on your transportation activities. However, GSA will work with your agency and...
-
41 CFR 102-3.180 - What does this subpart cover and how does it apply?
2010-07-01
... by the National Academy of Sciences or the National Academy of Public Administration? § 102-3.180... to the agency by the National Academy of Sciences (NAS) or the National Academy of Public Administration (NAPA), if such advice or recommendations were developed by use of a committee created by either...
-
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 39.102 Section 39.102 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.102 Application. This part applies to...
-
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 35.102 Section 35.102 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE BASIS OF DISABILITY IN STATE AND LOCAL GOVERNMENT SERVICES General § 35.102 Application. (a) Except as provided in paragraph (b) of this...
-
2010-01-01
... ASSISTANCE TO HIGH ENERGY COST COMMUNITIES RUS High Energy Cost Grant Program § 1709.102 Policy. (a) All high... 7 Agriculture 11 2010-01-01 2010-01-01 false Policy. 1709.102 Section 1709.102 Agriculture...). (b) RUS may give priority consideration to projects that benefit smaller rural communities...
-
2010-01-01
... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...
-
7 CFR 948.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 948.102 Section 948.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations General § 948.102 Communications. Unless otherwise provided in §§ 948.1 to 948.92...
-
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...
-
2010-07-01
... administrative claim using EDI or other electronic means? 102-118.550 Section 102-118.550 Public Contracts and... EDI or other electronic means? The medium and precise format of data for an administrative claim filed electronically must be approved in advance by the GSA Audit Division. GSA will use an authenticating EDI...
-
Introduction: Alternative Public School Financing.
Disend, David S., Ed.
2000-01-01
Argues that time and money are the two critical resources to allocate in any plan, and certainly regarding public education. Discusses four important elements in the debate about the use of resources: efficiency, content, effectiveness, and fairness. Outlines difficulties and questions regarding school funding. (SR)
-
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...
-
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application. 410.102 Section 410.102 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.102 Application...
-
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false State. 102.7 Section 102.7 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.7 State. The term State as used herein shall include the District of Columbia and all States, Territories, and possessions...
-
2010-01-01
...) NOTIFICATION OF POST-EMPLOYMENT RESTRICTIONS § 730.102 Definitions. Agency means an Executive agency as defined in 5 U.S.C. 105, but does not include the General Accounting Office. Senior executive means a member... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 730.102 Section 730.102...
-
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Discovery. 509.102 Section 509.102 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.102 Discovery. (a) In general. A party may take the deposition of an...
-
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Information. 935.102 Section 935.102 National... WAKE ISLAND CODE Criminal Actions § 935.102 Information. (a) Any offense may be prosecuted by a written information signed by the Island Attorney. However, if the offense is one for which issue of a citation is...
-
Publications | Page 438 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 4371 - 4380 of 6379 ... The project entailed research, design and implementation of a large-scale aerobic composting facility for tropical conditions, with a capacity of 50 tons per day material recovery, including: plans for composting in an aerobic digestion process; facility layout and operational optimization; and.
-
Publications | Page 438 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 4371 - 4380 of 6378 ... This chapter analyses the sustainability of the production of biodiesel from soybean oil, considering its social, environmental, economic, and strategic dimensions. It concludes that while economically viable, the option for biofuel from soybean will be environmentally safe, but socially.
-
5 CFR 430.102 - Performance management.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Performance management. 430.102 Section 430.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Management § 430.102 Performance management. (a) Performance management is the...
-
48 CFR 4.102 - Contractor's signature.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor's signature. 4.102 Section 4.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.102 Contractor's signature. (a) Individuals. A contract with an...
-
Dropping of mixing pump in Tank 102-AP
International Nuclear Information System (INIS)
Jimenez, R.F.
1995-01-01
The purpose of this study is to examine dropping of the mixing pump in Tank 102-AP during its removal poses the risk of causing a leak in the tank bottom with attendant potential for public exposure from the leak. The purpose of this investigation is to examine the potential for causing such a leak (i.e., estimated frequency of leak occurrence); to qualitatively estimate leak magnitude if its is a credible event; and, finally to compare the worker hazard, in the installation of an impact limiter (should it be required), to that which the public might incur if a leak is manifest in the tank bottom. The ultimate goal of the study is, of course, to assess the need for installation of an impact limiter
-
Public Employee Free Speech; Is Rankin V. McPherson Still Alive?
1991-05-10
eneally, M. Nimmer and L. Sobel, Niznmer on Freedom of Speech §4.08 (1989). M. Player, Employment Discrimination, §3.13 (1988). ~2ad 3 438 U.S. 378 (1987...908 F. 2d 1499, 1505 (11th Cir. 1990) (Public employee’s right to freedom of speech is not absolute. (ailing Bryson v. City of Waycross, 888 F.2d...the law of the first amendment has always been, by necessity, a law of flexibility. Public employee freedom of speech is no exception. 29 Seee.g
-
5 CFR 847.102 - Regulatory structure.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 847.102 Section 847.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... INSTRUMENTALITIES General Provisions § 847.102 Regulatory structure. (a)(1) Subpart A of this part contains...
-
Genetics, health care, and public policy: an introduction to public health genetics
National Research Council Canada - National Science Library
Stewart, Alison
2007-01-01
... initiative About this book Further reading and resources Principles of public health The emergence of public health genetics The human genome project and 'genomic medicine' Community genetics Current developments in public health genetics Genomics and global health 2 Genetic science and technology Basic molecular genetics Genes and the geno...
-
5 CFR 10.2 - Accountability systems.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...
-
2010-07-01
... disposal agency receives the FAA's recommendation for disposal of the property for a public airport? 102-75... receives the FAA's recommendation for disposal of the property for a public airport? The head of the disposal agency, or his or her designee, may convey property approved by the FAA for use as a public...
-
Introduction: Digital Humanities, Public Humanities
Directory of Open Access Journals (Sweden)
Alex Christie
2014-07-01
Full Text Available NANO: New American Notes Online: An Interdisciplinary Academic Journal for Big Ideas in a Small World. This special issue shows how both public and digital humanities research can be rendered more persuasive through engagement with cultures beyond the academy. More specifically, the aim of this special issue is to demonstrate how investments in technologies and computation are not necessarily antithetical to investments in critical theory and social justice.
-
7 CFR 1900.102 - Applicable law.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...
-
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Trust fund. 280.102 Section 280.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) TECHNICAL STANDARDS AND CORRECTIVE ACTION REQUIREMENTS FOR OWNERS AND OPERATORS OF UNDERGROUND STORAGE TANKS (UST) Financial Responsibility § 280.102 Trust...
-
20 CFR 653.102 - Job information.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job information. 653.102 Section 653.102... SERVICE SYSTEM Services for Migrant and Seasonal Farmworkers (MSFWs) § 653.102 Job information. All State agencies shall make job order information conspicuous and available to MSFWs in all local offices. This...
-
19 CFR 360.102 - Online registration.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Online registration. 360.102 Section 360.102... ANALYSIS SYSTEM § 360.102 Online registration. (a) In general. (1) Any importer, importing company, customs.... boxes will not be accepted. A user identification number will be issued within two business days...
-
42 CFR 412.302 - Introduction to capital costs.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Introduction to capital costs. 412.302 Section 412... Inpatient Hospital Capital Costs General Provisions § 412.302 Introduction to capital costs. (a) New capital... revision of the debt instrument. (iii) If short-term financing was used to acquire old capital assets and...
-
41 CFR 102-73.10 - What is the basic real estate acquisition policy?
2010-07-01
... ESTATE ACQUISITION General Provisions § 102-73.10 What is the basic real estate acquisition policy? When... real estate and related services in an efficient and cost effective manner. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the basic real...
-
22 CFR 102.8 - Reporting accidents.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting accidents. 102.8 Section 102.8... Accidents Abroad § 102.8 Reporting accidents. (a) To airline and Civil Aeronautics Administration... probably be the first to be informed of the accident, in which event he will be expected to report the...
-
21 CFR 102.5 - General principles.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false General principles. 102.5 Section 102.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION COMMON OR USUAL NAME FOR NONSTANDARDIZED FOODS General Provisions § 102.5 General principles. (a...
-
Introduction to the Virtual Issue on Behavioral Public Administration
DEFF Research Database (Denmark)
Tummers, Lars; Olsen, Asmus Leth; Jilke, Sebastian
2016-01-01
For public administration scholars, psychological theories and methods can be extremely helpful, especially when studying attitudes or behaviors of (groups of) citizens, public professionals, or public managers. Behavioral public administration explicitly connects public administration...
-
Introduction to the Virtual Issue on Behavioral Public Administration
Tummers, Lars; Leth Olsen, Asmus; Jilke, Sebastian; Grimmelikhuijsen, S.G.
2016-01-01
For public administration scholars, psychological theories and methods can be extremely helpful, especially when studying attitudes or behaviors of (groups of) citizens, public professionals, or public managers. Behavioral public administration explicitly connects public administration and
-
39 CFR 10.2 - Advisory service.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...
-
29 CFR 102.70 - Runoff election.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...
-
29 CFR 102.4 - Region; subregion.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Region; subregion. 102.4 Section 102.4 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.4 Region; subregion. The term region as used herein shall mean that part of the United States or any Territory thereof...
-
Yang, Tae Un; Kim, Eunsung; Park, Young-Joon; Kim, Dongwook; Kwon, Yoon Hyung; Shin, Jae Kyong; Park, Ok
2016-03-18
Although pneumococcal vaccines had been recommended for the elderly population in South Korea for a considerable period of time, the coverage has been well below the optimal level. To increase the vaccination rate with integrating the pre-existing public health infrastructure and governmental funding, the Korean government introduced an elderly pneumococcal vaccination into the national immunization program with a 23-valent pneumococcal polysaccharide vaccine in May 2013. The aim of this study was to assess the performance of the program in increasing the vaccine coverage rate and maintaining stable vaccine supply and safe vaccination during the 20 months of the program. We qualitatively and quantitatively analyzed the process of introducing and the outcomes of the program in terms of the systematic organization, efficiency, and stability at the national level. A staggered introduction during the first year utilizing the public sector, with a target coverage of 60%, was implemented based on the public demand for an elderly pneumococcal vaccination, vaccine supply capacity, vaccine delivery capacity, safety, and sustainability. During the 20-month program period, the pneumococcal vaccine coverage rate among the population aged ≥65 years increased from 5.0% to 57.3% without a noticeable vaccine shortage or safety issues. A web-based integrated immunization information system, which includes the immunization registry, vaccine supply chain management, and surveillance of adverse events following immunization, reduced programmatic errors and harmonized the overall performance of the program. Introduction of an elderly pneumococcal vaccination in the national immunization program based on strong government commitment, meticulous preparation, financial support, and the pre-existing public health infrastructure resulted in an efficient, stable, and sustainable increase in vaccination coverage. Copyright © 2016. Published by Elsevier Ltd.
-
42 CFR 55a.102 - Who is eligible to apply for a Black Lung clinics grant?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Who is eligible to apply for a Black Lung clinics... SERVICES GRANTS PROGRAM GRANTS FOR BLACK LUNG CLINICS General Provisions § 55a.102 Who is eligible to apply for a Black Lung clinics grant? Any State or public or private entity may apply for a grant under this...
-
41 CFR 102-3.95 - What principles apply to the management of advisory committees?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What principles apply to...-FEDERAL ADVISORY COMMITTEE MANAGEMENT How Are Advisory Committees Managed? § 102-3.95 What principles... principles to the management of their advisory committees: (a) Provide adequate support. Before establishing...
-
2010-07-01
... requirements, such as the Debt Collection Improvement Act of 1996 (Public Law 104-134, sec. 31001, 110 Stat. 1321-358) and antitrust requirements that are discussed in § 102-38.325. Antitrust Requirements ...
-
2012-06-08
... DEPARTMENT OF HOMELAND SECURITY U.S. Citizenship and Immigration Services Agency Information... Nonimmigrant Arrival-Departure Document. The Department of Homeland Security, U.S. Citizenship and Immigration...-102; U.S. Citizenship and Immigration Services (USCIS). (4) Affected public who will be asked or...
-
16 CFR 1034.102 - Application.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Application. 1034.102 Section 1034.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... Application. This part applies to all programs or activities conducted by the agency. ...
-
Directory of Open Access Journals (Sweden)
Melinde Coetzee
2012-12-01
Full Text Available How to cite this article: Coetzee, M., & Gunz, H. (2012. Careers and retention of staff in the 21st century world of work: Introduction to the special edition. SA Journal of Human Resource Management/SA Tydskrif vir Menslikehulpbronbestuur, 10(2, Art. #505, 4 pages. http://dx.doi.org/10.4102/ sajhrm.v10i2.505
-
47 CFR 25.102 - Station authorization required.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station authorization required. 25.102 Section 25.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS General § 25.102 Station authorization required. (a) No person shall use or operate...
-
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 26.102 Section 26.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA...) Human subject means a living individual about whom an investigator (whether professional or student...
-
18 CFR 376.102 - Organization.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Organization. 376.102... OF ENERGY REVISED GENERAL RULES ORGANIZATION, MISSION, AND FUNCTIONS; OPERATIONS DURING EMERGENCY CONDITIONS Organization, Mission, and Functions § 376.102 Organization. The Commission is established as an...
-
41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 185.102 Section 185.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., or accounting or bookkeeping entry made: (a) With respect to a claim or to obtain the approval or...
-
7 CFR 3560.102 - Housing project management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Housing project management. 3560.102 Section 3560.102... § 3560.102 Housing project management. (a) General. Borrowers hold final responsibility for housing project management and must ensure that operations comply with the terms of all loan or grant documents...
-
29 CFR 102.104 - Withdrawal of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Withdrawal of petition. 102.104 Section 102.104 Labor... Orders and Advisory Opinions Regarding Board Jurisdiction § 102.104 Withdrawal of petition. The petitioner may withdraw his petition at any time prior to issuance of the Board's advisory opinion. ...
-
29 CFR 784.102 - General legislative history.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...
-
Freud's "On Narcissism: An Introduction"
Crockatt, Philip
2006-01-01
The author reviews Freud's (1914) seminal paper "On narcissism: an introduction". Freud's paper is briefly set in the historical context of the evolution of psychoanalysis and psychoanalytic theories, and Freud's metapsychology up to the publication of his Narcissism paper is outlined. A detailed and comprehensive description of the content of the…
-
29 CFR 102.116 - Signature of orders.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Signature of orders. 102.116 Section 102.116 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Certification and Signature of Documents § 102.116 Signature of orders. The executive secretary or the associate executive...
-
28 CFR 34.102 - Peer review procedures.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Peer review procedures. 34.102 Section 34.102 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.102 Peer review procedures. The OJJDP peer review process is contained in an OJJDP “Peer...
-
29 CFR 102.138 - Definition of meeting.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...
-
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 17.102 Section 17.102 Money and Finance: Treasury Office of the Secretary of the Treasury ENFORCEMENT OF NONDISCRIMINATION ON... Application. This part applies to all programs or activities conducted by the agency, except for programs or...
-
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...
-
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 901.102 Section... REGULATIONS SYSTEM Purpose, Authority, Issuance 901.102 Authority. The DEAR and amendments thereto are issued... the authority of section 644 of the Department of Energy Organization Act (42 U.S.C. 7254), section...
-
41 CFR 102-81.30 - What information must job applicants at child care centers reveal?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What information must... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 81-SECURITY Security § 102-81.30 What information must job applicants at child care centers reveal...
-
41 CFR 102-34.55 - Are there fleet average fuel economy standards we must meet?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are there fleet average... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 34-MOTOR VEHICLE MANAGEMENT Obtaining Fuel Efficient Motor Vehicles § 102-34.55 Are there fleet...
-
29 CFR 1650.102 - Delegation of authority.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Delegation of authority. 1650.102 Section 1650.102 Labor... for the Collection of Debts by Salary Offset § 1650.102 Delegation of authority. The Chair delegated to the Chief Human Capital Officer the authority to collect debts owed by current EEOC employees, and...
-
10 CFR 611.102 - Eligible project costs.
2010-01-01
... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...
-
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Policy. 0.102 Section 0.102 Money and Finance: Treasury Office of the Secretary of the Treasury DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF... is not limited to: (1) Reassignment of work duties; (2) Disqualification from a particular assignment...
-
2010-04-01
... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
-
20 CFR 655.102 - Special procedures.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Special procedures. 655.102 Section 655.102 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF... in force until modified by the Administrator. ...
-
Building Maintenance: Introduction. Units of Instruction. Teacher's Guide. First Edition.
Barnes, Bill
This volume, the first in a series of publications that will provide entry-level competencies in the area of building maintenance, is designed as an introduction. The seven instructional units cover these areas in the shop program: (1) introduction to building maintenance, (2) leadership development, (3) personal development, (4) job application…
-
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk
-
Energy Technology Data Exchange (ETDEWEB)
Hansen, E
2005-03-31
The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).
-
47 CFR 32.102 - Nonregulated investments.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.102 Section 32.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... investments. Nonregulated investments shall include the investment in nonregulated activities that are...
-
Ludovic J. A. Capo-chichi; Wilson H. Faircloth; A. G. Williamson; Michael G. Patterson; James H. Miller; Edzard van Santen
2008-01-01
Nine sites of cogongrass were included in a study of genotypic dimity and spread dynamics at the point of introduction and its adjacent areas in the southern United States. Clones evaluated with two primer pairs yielded a total of 137 amplified fragment length polymorphism (AFLP) hi of which 102 (74.4%) were polymorphic. Genetic diversity was measured as the percentage...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What happens if the FAA... Real Property Disposal Property for Public Airports § 102-75.420 What happens if the FAA informs the... property that the FAA does not recommend for disposal as a public airport must be disposed of in accordance...
-
75 FR 13303 - Notice of Realty Action: Direct Sale of Public Lands in Riverside County, CA
2010-03-19
....37 acres in Riverside County. The appraised fair market value is $2,102,000. The public land is... market value of $2,102,000. DATES: Comments regarding the proposed sale must be received by the BLM on or... market value: San Bernardino Meridian T. 3 S., R. 4 E., Sec. 34, those remaining public lands in the N...
-
41 CFR 102-73.15 - What real estate acquisition and related services may Federal agencies provide?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What real estate... REGULATION REAL PROPERTY 73-REAL ESTATE ACQUISITION General Provisions § 102-73.15 What real estate... provide real estate acquisition and related services, including leasing (with or without purchase options...
-
41 CFR 102-74.535 - What items may Federal agencies provide to permittees free of charge?
2010-07-01
... PROPERTY 74-FACILITY MANAGEMENT Occasional Use of Public Buildings Services and Costs § 102-74.535 What... permittees at no cost— (a) Space; and (b) Services normally provided at the building in question during normal hours of building operation, such as security, cleaning, heating, ventilation, and air...
-
5 CFR 880.102 - Regulatory structure.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 880.102 Section 880.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... Regulatory structure. (a) This part contains the following subparts: (1) Subpart A contains general...
-
38 CFR 13.102 - Accountability of legal custodians.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Accountability of legal custodians. 13.102 Section 13.102 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS VETERANS BENEFITS ADMINISTRATION, FIDUCIARY ACTIVITIES § 13.102 Accountability of legal custodians. (a...
-
41 CFR 102-37.125 - What are some donations that do not require GSA's approval?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are some donations... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Holding Agency § 102-37.125 What are some donations that do not require GSA's approval? (a) Some donations of surplus property that do not require GSA's...
-
18 CFR 284.102 - Transportation by interstate pipelines.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transportation by interstate pipelines. 284.102 Section 284.102 Conservation of Power and Water Resources FEDERAL ENERGY... 1978 AND RELATED AUTHORITIES Certain Transportation by Interstate Pipelines § 284.102 Transportation by...
-
29 CFR 1918.102 - Respiratory protection.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Respiratory protection. 1918.102 Section 1918.102 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... Respiratory protection. (See § 1918.1(b)(8)). [65 FR 40946, June 30, 2000] ...
-
13 CFR 102.41 - Other provisions.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Other provisions. 102.41 Section 102.41 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... the preservation of the constitutional principles of federalism and separation of powers. (d) Medical...
-
48 CFR 22.102-2 - Administration.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Administration. 22.102-2 Section 22.102-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... facilities, including requirements for workers in all occupations and skills from local labor market areas or...
-
37 CFR 102.9 - Business Information.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business Information. 102.9... COMMERCE ADMINISTRATION DISCLOSURE OF GOVERNMENT INFORMATION Freedom of Information Act § 102.9 Business Information. (a) In general. Business information obtained by USPTO from a submitter will be disclosed under...
-
DEFF Research Database (Denmark)
Beck Jørgensen, Torben; Rutgers, Mark R.
2015-01-01
administration is approached in terms of processes guided or restricted by public values and as public value creating: public management and public policy-making are both concerned with establishing, following and realizing public values. To study public values a broad perspective is needed. The article suggest......This article provides the introduction to a symposium on contemporary public values research. It is argued that the contribution to this symposium represent a Public Values Perspective, distinct from other specific lines of research that also use public value as a core concept. Public...... a research agenda for this encompasing kind of public values research. Finally the contributions to the symposium are introduced....
-
Choi, Jihee; Scharff, Robert L
2017-07-01
The increased frequency with which people are dining out coupled with an increase in the publicity of foodborne disease outbreaks has led the public to an increased awareness of food safety issues associated with food service establishments. To accommodate consumer needs, local health departments have increasingly publicized food establishments' health inspection scores. The objective of this study was to estimate the effect of the color-coded inspection score disclosure system in place since 2006 in Columbus, OH, by controlling for several confounding factors. This study incorporated cross-sectional time series data from food safety inspections performed from the Columbus Public Health Department. An ordinary least squares regression was used to assess the effect of the new inspection regime. The introduction of the new color-coded food safety inspection disclosure system increased inspection scores for all types of establishments and for most types of inspections, although significant differences were found in the degree of improvement. Overall, scores increased significantly by 1.14 points (of 100 possible). An exception to the positive results was found for inspections in response to foodborne disease complaints. Scores for these inspections declined significantly by 10.2 points. These results should be useful for both food safety researchers and public health decision makers.
-
26 CFR 1.102-1 - Gifts and inheritances.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Gifts and inheritances. 1.102-1 Section 1.102-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Excluded from Gross Income § 1.102-1 Gifts and inheritances...
-
Introduction à l'information quantique
Le , Bellac
2006-01-01
-Qu'est qu'un qu-bit ?-Manipulations d'un qu-bit-Corrélations quantiques-Introduction au calcul quantique; Ce cours a pour objectif d'exposer à un public de non physiciens les notions de physique quantique nécessaires pour comprendre l'information quantique et d'illustrer le calcul quantique en prenant comme exemple l'algorithme de factorisation de Shor (51 pages).
-
29 CFR 102.147 - Contents of application; net worth exhibit; documentation of fees and expenses.
2010-07-01
... RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Awards of Fees and Other Expenses § 102.147 Contents of... it is a cooperative association as defined in section 15(a) of the Agricultural Marketing Act (12 U.S... otherwise directed by the administrative law judge, the net worth exhibit will be included in the public...
-
9 CFR 3.102 - Facilities, indoor.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, indoor. 3.102 Section 3... Marine Mammals Facilities and Operating Standards § 3.102 Facilities, indoor. (a) Ambient temperature. The air and water temperatures in indoor facilities shall be sufficiently regulated by heating or...
-
Platts-Mills, James A; Amour, Caroline; Gratz, Jean; Nshama, Rosemary; Walongo, Thomas; Mujaga, Buliga; Maro, Athanasia; McMurry, Timothy L; Liu, Jie; Mduma, Estomih; Houpt, Eric R
2017-05-29
No data are available on the etiology of diarrhea requiring hospitalization after rotavirus vaccine introduction in Africa. The monovalent rotavirus vaccine was introduced in Tanzania on January 1, 2013. We performed a vaccine impact and effectiveness study as well as a qPCR-based etiology study at a rural Tanzanian hospital. We obtained data on admissions among children under 5 years to Haydom Lutheran Hospital between January 1, 2010 and December 31, 2015, and estimated the impact of vaccine introduction on all-cause diarrhea admissions. We then performed a vaccine effectiveness study using the test-negative design. Finally, we tested diarrheal specimens during 2015 by qPCR for a broad range of enteropathogens and calculated pathogen-specific attributable fractions. Vaccine introduction was associated with a 44.9% (95% CI 17.6 - 97.4) reduction in diarrhea admissions in 2015, as well as delay of the rotavirus season. The effectiveness of two doses of vaccine was 74.8% (-8.2 - 94.1) using an enzyme immunoassay-based case definition and 85.1% (26.5 - 97.0) using a qPCR-based case definition. Among 146 children enrolled in 2015, rotavirus remained the leading etiology of diarrhea requiring hospitalization (AF 25.8%, 95% CI: 24.4 - 26.7), followed by heat-stabile enterotoxin-producing E. coli (18.4%, 12.9 - 21.9), Shigella/enteroinvasive E. coli (14.5%, 10.2 - 22.8), and Cryptosporidium (7.9%, 6.2 - 9.3). Despite the clear impact of vaccine introduction in this setting, rotavirus remained the leading etiology of diarrhea requiring hospitalization. Further efforts to maximize vaccine coverage and improve vaccine performance in these settings are warranted. © The Author 2017. Published by Oxford University Press for the Infectious Diseases Society of America.
-
19 CFR 102.23 - Origin and Manufacturer Identification
2010-04-01
... Section 102.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... address of the entity performing the origin-conferring operations pursuant to § 102.21 or § 102.22, as... product from CBP custody will be denied until a determination of the country of origin is made based upon...
-
12 CFR 263.102 - Prevailing party.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...
-
40 CFR 133.102 - Secondary treatment.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Secondary treatment. 133.102 Section... TREATMENT REGULATION § 133.102 Secondary treatment. The following paragraphs describe the minimum level of effluent quality attainable by secondary treatment in terms of the parameters—BOD5, SS and pH. All...
-
27 CFR 44.102 - Change in trade name.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in trade name. 44.102 Section 44.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Warehouse Proprietors Changes in Name § 44.102 Change in trade name. Where there is a change in, or an...
-
29 CFR 1926.102 - Eye and face protection.
2010-07-01
... spectacles, when required by this regulation to wear eye protection, shall be protected by goggles or... 29 Labor 8 2010-07-01 2010-07-01 false Eye and face protection. 1926.102 Section 1926.102 Labor... § 1926.102 Eye and face protection. (a) General. (1) Employees shall be provided with eye and face...
-
2010-07-01
... and Construction Sustainable Development § 102-76.55 What sustainable development principles must... Acquisition,” Federal agencies must apply sustainable development principles to the siting, design, and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What sustainable...
-
Ethics Simulations as Preparation for Public Discourse
Hamilton, James P.; Mueller, Alfred G.
2010-01-01
Courses: Fundamentals of public speaking, basic hybrid course, introduction to communication, introduction to journalism, introduction to advertising, and any other course that includes components of communication ethics. Objective: Students will understand the fundamental elements of communication ethics.
-
33 CFR 401.102 - Civil penalty.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Civil penalty. 401.102 Section... TRANSPORTATION SEAWAY REGULATIONS AND RULES Penalties-Violations of Seaway Regulations § 401.102 Civil penalty. (a) A person, as described in § 401.101(b), who violates a regulation is liable to a civil penalty of...
-
48 CFR 232.102 - Description of contract financing methods.
2010-10-01
... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...
-
Verheij, Louis Johan Philip
2009-01-01
'Where of is Mad al Mankynde' represents a new critical edition of the collection of twenty-four late-medieval anonymous poems contained, among other pieces, in Oxford, Bodleian Library, MS Digby 102. Each poem is introduced with a brief summary and closes with line-for-line explanatory comments.
-
48 CFR 1432.102 - Description of contract financing methods.
2010-10-01
... financing methods. 1432.102 Section 1432.102 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 1432.102 Description of contract financing methods. Use of progress payments based on a percentage or stage...
-
48 CFR 932.102 - Description of contract financing methods.
2010-10-01
... financing methods. 932.102 Section 932.102 Federal Acquisition Regulations System DEPARTMENT OF ENERGY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 932.102 Description of contract financing methods. (e)(2) Progress payments based on a percentage or stage of...
-
48 CFR 1532.102 - Description of contract financing methods.
2010-10-01
... financing methods. 1532.102 Section 1532.102 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING General 1532.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are authorized for use as...
-
48 CFR 432.102 - Description of contract financing methods.
2010-10-01
... financing methods. 432.102 Section 432.102 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are...
-
48 CFR 32.102 - Description of contract financing methods.
2010-10-01
... financing methods. 32.102 Section 32.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.102 Description of contract financing methods. (a) Advance payments are advances of money by the Government to a...
-
DEFF Research Database (Denmark)
Høgfeldt Hansen, Leif
2016-01-01
This introduction to South Korean architecture gives an overall view of the architecture done in the country in historic times as well as a general introduction to the culture of the country.......This introduction to South Korean architecture gives an overall view of the architecture done in the country in historic times as well as a general introduction to the culture of the country....
-
41 CFR 102-39.80 - What are the accounting requirements for exchange allowances or proceeds of sale?
2010-07-01
... the general finance and accounting rules applicable to you. Except as otherwise authorized by law, all... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the accounting... Exchange/Sale Methods and Reports § 102-39.80 What are the accounting requirements for exchange allowances...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Where hazardous... Provisions Relating to Hazardous Substance Activity § 102-75.340 Where hazardous substance activity has been... offer to purchase and the conveyance document? Where the existence of hazardous substance activity has...
-
International Nuclear Information System (INIS)
Kusama, Tomoko
1988-01-01
ICRP established a task group within its Committee 1 to carry out studies on the effects of irradiation on the central nerve system of embryos and fetuses. The present article summarizes the study results presented in the report, named ICRP Publication 49, published by the task group. Publication 49 consists of seven chapters dealing with the introduction, development of brain and auxiliary organs of embryo primates, retarded development of central nerve system, ionizing radiation as factor in teratogenesis of central nerve system, maximum susceptibility period, risk estimation for human being, and necessity of research. Radiation may cause either organogenetic or histological disturbances depending on the developmental stage of the brain. Results of animal tests can be applied to studies on the morphogenetic disturbances in human beings. Data on embryos and fetuses that received radiation in Hiroshima or Nagasaki are currently used for the estimation of the risk of disturbance in the brain of human embryos and fetuses. Risk estimation for the brain of human embryo exposed to radiation is discussed. (Nogami, K.)
-
Public Finance Administration. Second Edition.
Reed, B. J.; Swain, John W.
This book is intended for the nonexpert in finance who has a public administration background. It opens with a broad introduction to public finance administration and how this job is related to public budgeting, the practice of public-sector accounting, and the economic concepts of money and value. Issues surrounding public revenue, its sources,…
-
25 CFR 39.102 - What is academic base funding?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What is academic base funding? 39.102 Section 39.102... PROGRAM Indian School Equalization Formula Base and Supplemental Funding § 39.102 What is academic base funding? Academic base funding is the ADM times the weighted student unit. ...
-
21 CFR 640.102 - Manufacture of Immune Globulin (Human).
2010-04-01
... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Manufacture of Immune Globulin (Human). 640.102 Section 640.102 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES....102 Manufacture of Immune Globulin (Human). (a) Processing method. The processing method shall be one...
-
Media relations after the introduction of social media
Mesila, Helin
2010-01-01
In the light of the popularity of social media on one hand, and the contradictive relationships between journalists and public relations practitioners on the other hand, the thesis studies media relations after the introduction of social media. The study focuses on media relations in Estonian public relations scenery. The research answers to the questions: - What are media relations today? - What are the functions of social media and media relations in organizational communication? ...
-
Introduction of human papillomavirus vaccination in Nordic countries.
Sander, Bente Braad; Rebolj, Matejka; Valentiner-Branth, Palle; Lynge, Elsebeth
2012-02-14
Cervical screening has helped decrease the incidence of cervical cancer, but the disease remains a burden for women. Human Papillomavirus (HPV) vaccination is now a promising tool for control of cervical cancer. Nordic countries (Denmark, Finland, Greenland, Iceland, Norway and Sweden) are relatively wealthy with predominantly publicly paid health care systems. The aim of this paper was to provide an update of the current status of introduction of HPV vaccine into the childhood vaccination programs in this region. Data on cervical cancer, cervical screening programs, childhood immunization and HPV vaccination programs for Nordic countries were searched via PubMed and various organizations. We furthermore contacted selected experts for information. The incidence of cervical cancer is highest in Greenland (25 per 100,000, age standardized, World Standard Population, ASW) and lowest in Finland (4 per 100,000 ASW) and rates in the other Nordic countries vary between 7 and 11 per 100,000 ASW. Greenland and Denmark were first to introduce HPV vaccination, followed by Norway. Vaccination programs are underway in Sweden and Iceland, while Finland has just recently recommended introduction of vaccination. HPV vaccination has been intensively debated, in particular in Denmark and Norway. In Nordic countries with a moderate risk of cervical cancer and a publicly paid health care system, the introduction of HPV vaccination was a priority issue. Many players became active, from the general public to health professionals, special interest groups, and the vaccine manufacturers. These seemed to prioritize different health care needs and weighed differently the uncertainty about the long-term effects of the vaccine. HPV vaccination posed a pressure on public health authorities to consider the evidence for and against it, and on politicians to weigh the wish for cervical cancer protection against other pertinent health issues. Copyright © 2011 Elsevier Ltd. All rights reserved.
-
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Documentation a smallpox vaccine recipient must..., DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Required Documentation To Be Deemed Eligible § 102.51 Documentation a smallpox vaccine recipient must submit to be deemed eligible by...
-
5 CFR 179.102 - Delegation of authority.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Delegation of authority. 179.102 Section... COLLECTION STANDARDS General Provisions and Administration § 179.102 Delegation of authority. (a) The Chief... Disability Fund, the Employees' Life Insurance Fund, the Retired Federal Employees Health Benefits Act (74...
-
5 CFR 6201.102 - Prohibited financial interests.
2010-01-01
... Section 6201.102 Administrative Personnel EXPORT-IMPORT BANK OF THE UNITED STATES SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE EXPORT-IMPORT BANK OF THE UNITED STATES § 6201.102 Prohibited...) All exporters that, during the preceding two fiscal years, exported an aggregate dollar volume of...
-
30 CFR 219.102 - Method of payment.
2010-07-01
... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...
-
29 CFR 102.115 - Certification of papers and documents.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Certification of papers and documents. 102.115 Section 102... Certification and Signature of Documents § 102.115 Certification of papers and documents. The executive... Board in his place and stead shall certify copies of all papers and documents which are a part of any of...
-
Greenhawt, M; Fleischer, D M; Chan, E S; Venter, C; Stukus, D; Gupta, R; Spergel, J M
2017-08-01
In the Learning Early About Peanut Allergy (LEAP) study, early peanut introduction in high-risk 4- to 11-month-olds was associated with a significantly decreased risk of developing peanut allergy. However, the influences of key baseline high-risk factors on peanut tolerance are poorly understood. Secondary analysis was conducted on the publically available LEAP dataset, exploring relationships between peanut tolerance, baseline peanut/egg sensitization, eczema severity/duration, age of introduction, gender, and race. A multiple logistic regression model predicting odds of successful oral food challenge (OFC) at 60 months noted higher odds with early introduction (OR 9.2, P introduction group was 83% vs 43% in the avoidance group with SPT wheal of introduction between 6 and 11 months than at 4-6 months. Increasing eczema severity had limited impact on the probability of peanut tolerance in the early introduction arm. Increasing peanut wheal size predicted peanut tolerance only in the avoidance arm. Peanut introduction between 6 and 11 months of age was associated with the highest rates of peanut tolerance, questioning the 'urgency' of introduction before 6 months. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
-
48 CFR 1.102-3 - Acquisition team.
2010-10-01
... service. By identifying the team members in this manner, teamwork, unity of purpose, and open... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Acquisition team. 1.102-3... ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1.102-3 Acquisition team. The purpose of defining...
-
An introduction to mathematical cryptography
Hoffstein, Jeffrey; Silverman, Joseph H
2014-01-01
This self-contained introduction to modern cryptography emphasizes the mathematics behind the theory of public key cryptosystems and digital signature schemes. The book focuses on these key topics while developing the mathematical tools needed for the construction and security analysis of diverse cryptosystems. Only basic linear algebra is required of the reader; techniques from algebra, number theory, and probability are introduced and developed as required. This text provides an ideal introduction for mathematics and computer science students to the mathematical foundations of modern cryptography. The book includes an extensive bibliography and index; supplementary materials are available online. The book covers a variety of topics that are considered central to mathematical cryptography. Key topics include: classical cryptographic constructions, such as Diffie–Hellmann key exchange, discrete logarithm-based cryptosystems, the RSA cryptosystem, and digital signatures; fundamental mathematical tools for cr...
-
Introduction: U.S. Homophile Internationalism.
Stein, Marc
2017-01-01
This article introduces "U.S. Homophile Internationalism," a special issue of the Journal of Homosexuality. The introduction provides a broad overview of the "U.S. Homophile Internationalism" archive and exhibit, which was published on the Outhistory Web site in 2015. The archive and exhibit consists of more than 800 U.S. homophile magazine articles, letters, and other items that referenced non-U.S. regions of the world from 1953 to 1964. The essays in the special issue focus on (1) Africa; (2) Asia and the Pacific; (3) Canada; (4) Latin America and the Caribbean; (5) the Middle East; and (6) Russia, the Soviet Union, and Eastern Europe. There is also an article that addresses the public history and digital humanities dimensions of the project. The introduction concludes by discussing the essays' common goals, themes, and concerns.
-
Difference in Neutropenia due to Administration Schedule of TAS-102
Directory of Open Access Journals (Sweden)
Yoichiro Yoshida
2017-03-01
Full Text Available TAS-102 significantly improves overall survival in patients with metastatic colorectal cancer. The most common adverse event of TAS-102 is bone marrow suppression, which leads to neutropenia. The incidence of neutropenia is high, and there is no known effective prevention method. Furthermore, the administration method of TAS-102 is complicated. We reported that neutropenia could be avoided by changing to a simple administration method of TAS-102.
-
49 CFR 24.102 - Basic acquisition policies.
2010-10-01
... valuation only if the offer to acquire the property is $10,000, or less. (See appendix A, § 24.102(n).) [70... Transportation Office of the Secretary of Transportation UNIFORM RELOCATION ASSISTANCE AND REAL PROPERTY ACQUISITION FOR FEDERAL AND FEDERALLY-ASSISTED PROGRAMS Real Property Acquisition § 24.102 Basic acquisition...
-
2010-07-01
... for other individual alteration projects when they demonstrate the ability to perform the delegated... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the requirements for obtaining a delegation of individual repair and alteration project authority from GSA? 102-72...
-
Longo-Silva, Giovana; Toloni, Maysa Helena de Aguiar; de Menezes, Risia Cristina Egito; Asakura, Leiko; Oliveira, Maria Alice Araújo; Taddei, José Augusto de Aguiar Carrazedo
2015-01-01
OBJECTIVE: Identifying at what age infants enrolled in public day care centers are introduced to soft drinks and industrialized juice, as well as comparing the nutritional composition of these goods with natural fruit juice. METHODS: A cross-sectional study with the mothers of 636 children (aged 0 to 36 months) from nurseries of day care centers, who were asked questions about the age of feeding introduction. This study evaluated the proximate composition of soft drinks and artificial juice, comparing them with those of natural fruit juice regarding energy, sugar, fiber, vitamin C, and sodium values. The chemical composition of fruit juice was obtained by consulting the Table of Food Composition and, for industrialized drinks, the average nutritional information on the labels of the five most consumed product brands. RESULTS: The artificial drinks were consumed before the first year of life by more than half of the children studied, however, approximately 10% consumed them before the age of 6 months. With regard to the comparison among the drinks, artificial fruit juice beverages and soft drinks proved to contain from nine to 13 times higher amounts of sodium, and 15 times less vitamin C than natural juices. CONCLUSIONS: The introduction of soft drinks and industrialized juice in the diet of infants was inopportune and premature.. When compared to natural fruit juice, these have inferior nutritional composition, which suggests the urgent need for measures based on strategies for food and nutrition education in order to promote awareness and the maintenance of healthy eating habits. PMID:25662561
-
Directory of Open Access Journals (Sweden)
Giovana Longo-Silva
2015-03-01
Full Text Available OBJECTIVE: Identifying at what age infants enrolled in public day care centers are introduced to soft drinks and industrialized juice, as well as comparing the nutritional composition of these goods with natural fruit juice. METHODS: A cross-sectional study with the mothers of 636 children (aged 0 to 36 months from nurseries of day care centers, who were asked questions about the age of feeding introduction. This study evaluated the proximate composition of soft drinks and artificial juice, comparing them with those of natural fruit juice regarding energy, sugar, fiber, vitamin C, and sodium values. The chemical composition of fruit juice was obtained by consulting the Table of Food Composition and, for industrialized drinks, the average nutritional information on the labels of the five most consumed product brands. RESULTS: The artificial drinks were consumed before the first year of life by more than half of the children studied, however, approximately 10% consumed them before the age of 6 months. With regard to the comparison among the drinks, artificial fruit juice beverages and soft drinks proved to contain from nine to 13 times higher amounts of sodium, and 15 times less vitamin C than natural juices. CONCLUSIONS: The introduction of soft drinks and industrialized juice in the diet of infants was inopportune and premature.. When compared to natural fruit juice, these have inferior nutritional composition, which suggests the urgent need for measures based on strategies for food and nutrition education in order to promote awareness and the maintenance of healthy eating habits.
-
The strategic approach to contraceptive introduction.
Simmons, R; Hall, P; Díaz, J; Díaz, M; Fajans, P; Satia, J
1997-06-01
The introduction of new contraceptive technologies has great potential for expanding contraceptive choice, but in practice, benefits have not always materialized as new methods have been added to public-sector programs. In response to lessons from the past, the UNDP/UNFPA/WHO/World Bank Special Programme of Research, Development, and Research Training in Human Reproduction (HRP) has taken major steps to develop a new approach and to support governments interested in its implementation. After reviewing previous experience with contraceptive introduction, the article outlines the strategic approach and discusses lessons from eight countries. This new approach shifts attention from promotion of a particular technology to an emphasis on the method mix, the capacity to provide services with quality of care, reproductive choice, and users' perspectives and needs. It also suggests that technology choice should be undertaken through a participatory process that begins with an assessment of the need for contraceptive introduction and is followed by research and policy and program development. Initial results from Bolivia, Brazil, Burkina Faso, Chile, Myanmar, South Africa, Vietnam, and Zambia confirm the value of the new approach.
-
41 CFR 102-37.180 - Does a SASP need special authorization to screen property at Federal facilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does a SASP need special...) Screening and Requesting Property § 102-37.180 Does a SASP need special authorization to screen property at... do not need a screener-ID card to inspect or remove property previously set aside or approved by GSA...
-
Spectroscopy of the odd-odd chiral candidate nucleus 102Rh
Directory of Open Access Journals (Sweden)
Yavahchova M.S.
2014-03-01
Full Text Available Excited states in 102Rh were populated in the fusion-evaporation reaction 94Zr(11B, 3n102Rh at a beam energy of 36 MeV, using the INGA spectrometer at IUAC, New Delhi. The angular correlations and the electromagnetic character of some of the 03B3-ray transitions observed in 102Rh were investigated in detail. A new candidate for achiral twin band was identified in 102Rh for the first time.
-
29 CFR 102.125 - Action on petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...
-
Epidemic risk from cholera introductions into Mexico.
Moore, Sean M; Shannon, Kerry L; Zelaya, Carla E; Azman, Andrew S; Lessler, Justin
2014-02-21
Stemming from the 2010 cholera outbreak in Haiti, cholera transmission in Hispaniola continues with over 40,000 cases in 2013. The presence of an ongoing cholera outbreak in the region poses substantial risks to countries throughout the Americas, particularly in areas with poor infrastructure. Since September 9, 2013 nearly 200 cholera cases have been reported in Mexico, as a result of introductions from Hispaniola or Cuba. There appear to have been multiple introductions into Mexico resulting in outbreaks of 2 to over 150 people. Using publicly available data, we attempt to estimate the reproductive number (R) of cholera in Mexico, and thereby assess the potential of continued introductions to establish a sustained epidemic. We estimate R for cholera in Mexico to be between 0.8 to 1.1, depending on the number of introductions, with the confidence intervals for the most plausible estimates crossing 1. These results suggest that the efficiency of cholera transmission in some regions of Mexico is near that necessary for a large epidemic. Intensive surveillance, evaluation of water and sanitation infrastructure, and planning for rapid response are warranted steps to avoid potential large epidemics in the region.
-
24 CFR 1000.102 - What are eligible affordable housing activities?
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible affordable housing activities? 1000.102 Section 1000.102 Housing and Urban Development Regulations Relating to... § 1000.102 What are eligible affordable housing activities? Eligible affordable housing activities are...
-
How to write an introduction section of a scientific article?
Armağan, Abdullah
2013-09-01
An article primarily includes the following sections: introduction, materials and methods, results, discussion, and conclusion. Before writing the introduction, the main steps, the heading and the familiarity level of the readers should be considered. Writing should begin when the experimental system and the equipment are available. The introduction section comprises the first portion of the manuscript, and it should be written using the simple present tense. Additionally, abbreviations and explanations are included in this section. The main goal of the introduction is to convey basic information to the readers without obligating them to investigate previous publications and to provide clues as to the results of the present study. To do this, the subject of the article should be thoroughly reviewed, and the aim of the study should be clearly stated immediately after discussing the basic references. In this review, we aim to convey the principles of writing the introduction section of a manuscript to residents and young investigators who have just begun to write a manuscript.
-
Working in the Public Sector. Introduction to the Thematic Issue
Directory of Open Access Journals (Sweden)
Annette Kamp
2013-05-01
Full Text Available Work in the public sector has been changing dramatically in recent decades. Reforms aimed at increasing the efficiency of public services have been extensive in the Nordic countries and elsewhere since the 1980s. The reforms and changes have to a large extent been associated with so-called New Public Management (NPM principles, emphasizing the market as a central coordination mechanism. Consequently, public institutions have been restructured, their services are standardized and commodified, and market-like relationships between them have been created. In order to create markets and transform citizens into customers on a market, outsourcing and privatization have been stimulated (Blomqvist & Rothstein 2000, Busch et al 2005, Christensen & Lægreid 2007, Greve 2003. At the same time, traditional Weberian bureaucratic principles are still viable and even enhanced within the sector, for instance, as a consequence of the use of contracts as a means of managing public organizations (Greve 2008. Lately, large reforms aimed at centralized coordination of different service providers, such as the integration of the Norwegian welfare administration, have been labeled post-NPM reforms by some researchers. The implication of all these parallel tendencies is that the institutional and organizational landscape surrounding the work situations of employees in the public sector have become increasingly complex, some call them hybrid, putting a variety of conflicting pressures on the performance of work within the sector (Christensen & Lægreid 2011, Hasselbladh et al. 2008. In this special issue, we explore some of the consequences of these structural and normative changes on the work of public sector employees in different sectors and contexts (...
-
Public Health Innovation and Research in Europe: introduction to the supplement.
McCarthy, Mark; Zeegers Paget, Dineke
2013-11-01
PHIRE (Public Health Innovation and Research in Europe) was developed for the national member associations and individual researchers of the European Public Health Association (EUPHA) to engage collectively with the health research agenda in Europe. It was co-funded by the European Commission's Directorate for Health and Consumers within the EU Health Programme. It was coordinated by EUPHA in a partnership of eight organizations. This article introduces the Supplement in the European Journal of Public Health presenting the results of PHIRE. PHIRE used mixed methods to collect data across 30 European countries (European Union 27 plus Iceland, Norway and Switzerland). Seven thematic Sections of EUPHA identified eight cross-national public health innovation projects, and Country Informants to report on national uptake and impact of these innovations. Public health was considered broadly--health determinants and interventions, health services and practice. Through EUPHA's member national public health associations, and by direct country contacts, PHIRE described country public health research strategies and structures, reviewed calls and programmes for research in 1 year and organized stakeholder workshops. PHIRE was reported to the European Commission, and the component reports placed on the EUPHA web page. A draft of the Final Summary Report was sent by email for commentary by selected experts. PHIRE data from the work packages were organized into eight themes for the Supplement. Through the EUPHA thematic Sections, experts described the uptake and impact of eight innovation projects from the EU Health Programme. National reports indicated a positive impact of the innovations in public health 'markets'. Through national public health associations, 75 programmes and calls for public health research were found for 2010, but systems are not comparable and nor is information exchanged or coordinated. Only a few countries have public health research strategies. Having
-
27 CFR 24.102 - Premises established for taxpaid wine operations.
2010-04-01
... taxpaid wine operations. 24.102 Section 24.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Premises and Operations § 24.102 Premises established for taxpaid wine operations. A person desiring to bottle...
-
Incorporating TED Talk Assignments into a Public-Speaking Course
Hayward, Pamela A.
2017-01-01
Courses: Introduction to public speaking, advanced public speaking, hybrid/survey introduction to communication. Objectives: At the end of this activity, students will be able to (1) explain the elements of a speaking outline and discover these elements in real-world speech examples, (2) recreate outline formats effectively in their personal…
-
Packaging design criteria, transfer and disposal of 102-AP mixer pump
International Nuclear Information System (INIS)
Carlstrom, R.F.
1994-01-01
A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)
-
25 CFR 183.1 - What is the purpose of this part?
2010-04-01
... SAN CARLOS APACHE TRIBE DEVELOPMENT TRUST FUND AND SAN CARLOS APACHE TRIBE LEASE FUND Introduction... Tribe Water Settlement Act (the Act), Public Law 102-575, 106 Stat. 4748, that requires regulations to administer the Trust Fund, and the Lease Fund established by the Act. ...
-
18 CFR 375.102 - Custody and authentication of Commission records.
2010-04-01
... authentication of Commission records. 375.102 Section 375.102 Conservation of Power and Water Resources FEDERAL... Provisions § 375.102 Custody and authentication of Commission records. (a) Custody of official records. (1...) Authentication of Commission action. All orders and other actions of the Commission shall be authenticated or...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is drug paraphernalia... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL... Personal Property Requiring Special Handling Drug Paraphernalia § 102-41.220 Is drug paraphernalia...
-
Using Crisis Simulations in Public Relations Education
Veil, Shari R.
2010-01-01
Objectives: Students will demonstrate research, decision making, team building, and public speaking skills, while applying issues management and crisis communication concepts in a realistic setting. Courses: Introduction to Public Relations, Public Relations Cases, Crisis Communication.
-
Longo-Silva, Giovana; Toloni, Maysa Helena de Aguiar; de Menezes, Risia Cristina Egito; Asakura, Leiko; Oliveira, Maria Alice Araújo; Taddei, José Augusto de Aguiar Carrazedo
2015-01-01
Identifying at what age infants enrolled in public day care centers are introduced to soft drinks and industrialized juice, as well as comparing the nutritional composition of these goods with natural fruit juice. A cross-sectional study with the mothers of 636 children (aged 0 to 36 months) from nurseries of day care centers, who were asked questions about the age of feeding introduction. This study evaluated the proximate composition of soft drinks and artificial juice, comparing them with those of natural fruit juice regarding energy, sugar, fiber, vitamin C, and sodium values. The chemical composition of fruit juice was obtained by consulting the Table of Food Composition and, for industrialized drinks, the average nutritional information on the labels of the five most consumed product brands. The artificial drinks were consumed before the first year of life by more than half of the children studied, however, approximately 10% consumed them before the age of 6 months. With regard to the comparison among the drinks, artificial fruit juice beverages and soft drinks proved to contain from nine to 13 times higher amounts of sodium, and 15 times less vitamin C than natural juices. The introduction of soft drinks and industrialized juice in the diet of infants was inopportune and premature. When compared to natural fruit juice, these have inferior nutritional composition, which suggests the urgent need for measures based on strategies for food and nutrition education in order to promote awareness and the maintenance of healthy eating habits. Copyright © 2014 Associação de Pediatria de São Paulo. Publicado por Elsevier Editora Ltda. All rights reserved.
-
Introduction to Value and Virtue in Public Administration
Vries, M.S. de; Kim, P.S.; Vries, M.S. de; Kim, P.S.
2014-01-01
Public values are defined as those values that provide normative consensus about: (1) the rights, benefits, and prerogatives to which citizens should (and should not) be entitled; (2) the obligations of citizens to society, the state, and one another; and (3) the principles upon which governments
-
Tank 241-AZ-102 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If hazardous substance... Utilization of Excess Real Property Title Report § 102-75.130 If hazardous substance activity took place on... quantity of such hazardous substance and the time at which such storage, release, or disposal took place...
-
7 CFR 330.102 - Basis for certain regulations.
2010-01-01
... of the Plant Protection Act, the Secretary may prohibit or restrict the importation, entry... 7 Agriculture 5 2010-01-01 2010-01-01 false Basis for certain regulations. 330.102 Section 330.102 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If no hazardous... DISPOSAL Utilization of Excess Real Property Title Report § 102-75.135 If no hazardous substance activity... hazardous substance activity took place, the reporting agency must include the following statement: The...
-
Natural Radioactivity in Public Water supplies in Spain
International Nuclear Information System (INIS)
Sostoa Grodo-Pacheco, A.
1989-01-01
This paper present the values of the Ra-226 concentration in public water supplies from different provinces of Spain and the values of anual intake. The Ra-226 concentration is in the range of (22.31 ± 3.44) 10 5 Bq/I - (8.55 ± 0.44) 10''2 Bq/l. The annual intake is in the range of (17.80±2.75) 10''2 Bq/l- (68 ± 3.5) Bq/I. As a conclusion no health risk due to intake is expected. Also is discussed in the paper a method for determination of Ra-226 concentration. (Author) 11 ref
-
32 CFR 644.102 - Examples of involuntary acquisitions.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Examples of involuntary acquisitions. 644.102... PROPERTY REAL ESTATE HANDBOOK Acquisition Involuntary Acquisition by the United States § 644.102 Examples... property, as prescribed by Pub. L. 91-646. Examples of involuntary acquisition are: (a) Damage to real...
-
International Nuclear Information System (INIS)
Wehrle, A.E.; Cohen, M.
1989-01-01
The object CTA 102, a low-frequency variable quasar, was observed with a VLBI Global Array in 1987.5 and 1988.5 at 5.0 GHz. The structure is complex, with three compact components along a line at PA = 157 deg, and several extended, ill-defined components east of the southernmost compact component. The components have no detectable relative motions, with mu less than 0.5 mas/yr along the main axis. This contrasts with the observation reported by Baath (1987), who found mu = 0.65 + or - 0.15 mas/yr at 932 MHz, which is exceptionally high. The new upper limit allows CTA 102 to be in the normal range of superluminal sources. 11 refs
-
42 CFR 438.50 - State Plan requirements.
2010-10-01
... Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... involve the public in both design and initial implementation of the program and the methods it uses to...) Receiving services through a family-centered, community-based, coordinated care system that receives grant...
-
26 CFR 509.102 - Applicable provisions of law.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Applicable provisions of law. 509.102 Section... UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.102 Applicable provisions of law. (a) General... reason of any alteration of law in relation to internal revenue. (b) Retroactivity of regulations or...
-
22 CFR 41.102 - Personal appearance of applicant.
2010-04-01
... interview. (d) Cases in which personal appearance may not be waived. A consular officer or the Deputy... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Personal appearance of applicant. 41.102... IMMIGRATION AND NATIONALITY ACT, AS AMENDED Application for Nonimmigrant Visa § 41.102 Personal appearance of...
-
DEFF Research Database (Denmark)
Kørnøv, Lone; Lund, Henrik; Remmen, Arne
2004-01-01
The chapter gives an introduction to the book "Environmental planning and management : tools for a sustainable development".......The chapter gives an introduction to the book "Environmental planning and management : tools for a sustainable development"....
-
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
-
Speaker Introductions at Internal Medicine Grand Rounds: Forms of Address Reveal Gender Bias.
Files, Julia A; Mayer, Anita P; Ko, Marcia G; Friedrich, Patricia; Jenkins, Marjorie; Bryan, Michael J; Vegunta, Suneela; Wittich, Christopher M; Lyle, Melissa A; Melikian, Ryan; Duston, Trevor; Chang, Yu-Hui H; Hayes, Sharonne N
2017-05-01
Gender bias has been identified as one of the drivers of gender disparity in academic medicine. Bias may be reinforced by gender subordinating language or differential use of formality in forms of address. Professional titles may influence the perceived expertise and authority of the referenced individual. The objective of this study is to examine how professional titles were used in the same and mixed-gender speaker introductions at Internal Medicine Grand Rounds (IMGR). A retrospective observational study of video-archived speaker introductions at consecutive IMGR was conducted at two different locations (Arizona, Minnesota) of an academic medical center. Introducers and speakers at IMGR were physician and scientist peers holding MD, PhD, or MD/PhD degrees. The primary outcome was whether or not a speaker's professional title was used during the first form of address during speaker introductions at IMGR. As secondary outcomes, we evaluated whether or not the speakers professional title was used in any form of address during the introduction. Three hundred twenty-one forms of address were analyzed. Female introducers were more likely to use professional titles when introducing any speaker during the first form of address compared with male introducers (96.2% [102/106] vs. 65.6% [141/215]; p form of address 97.8% (45/46) compared with male dyads who utilized a formal title 72.4% (110/152) of the time (p = 0.007). In mixed-gender dyads, where the introducer was female and speaker male, formal titles were used 95.0% (57/60) of the time. Male introducers of female speakers utilized professional titles 49.2% (31/63) of the time (p addressed by professional title than were men introduced by men. Differential formality in speaker introductions may amplify isolation, marginalization, and professional discomfiture expressed by women faculty in academic medicine.
-
10 CFR 2.102 - Administrative review of application.
2010-01-01
... proceeding to confer with the NRC staff informally. In the case of docketed application for a limited work... 10 Energy 1 2010-01-01 2010-01-01 false Administrative review of application. 2.102 Section 2.102... ORDERS Procedure for Issuance, Amendment, Transfer, or Renewal of a License, and Standard Design Approval...
-
7 CFR 61.102 - Determination of quantity index.
2010-01-01
... the quantity index shall equal four times percentage of oil plus six times percentage of ammonia, plus 5. (b) For American Pima cottonseed the quantity index shall equal four times percentage of oil... 7 Agriculture 3 2010-01-01 2010-01-01 false Determination of quantity index. 61.102 Section 61.102...
-
9 CFR 93.102 - Ports designated for the importation of birds.
2010-01-01
... of birds. 93.102 Section 93.102 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Birds § 93.102 Ports designated for...
-
Recombinant protective antigen 102 (rPA102): profile of a second-generation anthrax vaccine.
Keitel, Wendy A
2006-08-01
Recent terrorist attacks involving the use of Bacillus anthracis spores have stimulated interest in the development of new vaccines for anthrax prevention. Studies of the pathogenesis of anthrax and of the immune responses following infection and immunization underscore the pivotal role that antibodies to the protective antigen play in protection. The most promising vaccine candidates contain purified recombinant protective antigen. Clinical trials of one of these, recombinant protective antigen (rPA)102, are underway. Initial results suggest that rPA102 is well tolerated and immunogenic. Additional trials are necessary to identify optimal formulations and immunization regimens for pre- and postexposure prophylaxis. Future licensure of these and other candidate vaccines will depend on their safety and immunogenicity profiles in humans, and their ability to confer protection in animal models of inhalational anthrax.
-
Sharma, Abhishek; Kaplan, Warren A; Chokshi, Maulik; Hasan Farooqui, Habib; Zodpey, Sanjay P
2015-02-23
Haemophilus influenzae type b (Hib) vaccine has been available in India's private sector market since 1997. It was not until 14 December 2011 that the Government of India initiated the phased public sector introduction of a Hib (and DPT, diphtheria, pertussis, tetanus)-containing pentavalent vaccine. Our objective was to investigate the state-specific coverage and behaviour of Hib vaccine in India when it was available only in the private sector market but not in the public sector. This baseline information can act as a guide to determine how much coverage the public sector rollout of pentavalent vaccine (scheduled April 2015) will need to bear in order to achieve complete coverage. 16 of 29 states in India, 2009-2012. Retrospective descriptive secondary data analysis. (1) Annual sales of Hib vaccines, by volume, from private sector hospitals and retail pharmacies collected by IMS Health and (2) national household surveys. State-specific Hib vaccine coverage (%) and its associations with state-specific socioeconomic status. The overall private sector Hib vaccine coverage among the 2009-2012 birth cohort was low (4%) and varied widely among the studied Indian states (minimum 0.3%; maximum 4.6%). We found that private sector Hib vaccine coverage depends on urban areas with good access to the private sector, parent's purchasing capacity and private paediatricians' prescribing practices. Per capita gross domestic product is a key explanatory variable. The annual Hib vaccine uptake and the 2009-2012 coverage levels were several times higher in the capital/metropolitan cities than the rest of the state, suggesting inequity in access to Hib vaccine delivered by the private sector. If India has to achieve high and equitable Hib vaccine coverage levels, nationwide public sector introduction of the pentavalent vaccine is needed. However, the role of private sector in universal Hib vaccine coverage is undefined as yet but it should not be neglected as a useful complement to
-
31 CFR 800.102 - Effect on other law.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Effect on other law. 800.102 Section... TAKEOVERS BY FOREIGN PERSONS General § 800.102 Effect on other law. Nothing in this part shall be construed..., or review provided by or established under any other provision of federal law, including the...
-
Directory of Open Access Journals (Sweden)
Juliane Lauks
Full Text Available Neurobeachin (Nbea is a multidomain scaffold protein abundant in the brain, where it is highly expressed during development. Nbea-null mice have severe defects in neuromuscular synaptic transmission resulting in lethal paralysis of the newborns. Recently, it became clear that Nbea is important also for the functioning of central synapses, where it is suggested to play a role in trafficking membrane proteins to both, the pre- and post-synaptic sites. So far, only few binding partners of Nbea have been found and the precise mechanism of their trafficking remains unclear. Here, we used mass spectrometry to identify SAP102, a MAGUK protein implicated in trafficking of the ionotropic glutamate AMPA- and NMDA-type receptors during synaptogenesis, as a novel Nbea interacting protein in mouse brain. Experiments in heterologous cells confirmed this interaction and revealed that SAP102 binds to the C-terminal part of Nbea that contains the DUF, PH, BEACH and WD40 domains. Furthermore, we discovered that introducing a mutation in Nbea's PH domain, which disrupts its interaction with the BEACH domain, abolishes this binding, thereby creating an excellent starting point to further investigate Nbea-SAP102 function in the central nervous system.
-
2010-10-01
... DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY General 245.102 Policy. (1) Mapping, charting, and geodesy property. All Government-furnished mapping, charting, and geodesy (MC&G) property is under the control of...
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the most... Guidelines § 102-75.75 What is the most important consideration in evaluating a proposed transfer of excess real property? In every case of a proposed transfer of excess real property, the most important...
-
Hesitative introduction of E-mail consultations in general practice.
Verheij, R.; Ton, C.; Tates, K.
2008-01-01
Introduction: The Dutch Council for Public Health and Health Care reported in 2005 that 70% of internet users would want to have the opportunity to consult their own general practitioner by e-mail [1]. Since January 1, 2006, general practitioners in the Netherlands are reimbursed 4.50 euro for
-
27 CFR 31.102 - Addition of partners or incorporation of partnership.
2010-04-01
... incorporation of partnership. 31.102 Section 31.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Partnerships § 31.102 Addition of partners or incorporation of partnership. Where a number of persons who have filed a...
-
48 CFR 2953.102 - Quotation for Simplified Acquisitions DL 1-2078.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Quotation for Simplified Acquisitions DL 1-2078. 2953.102 Section 2953.102 Federal Acquisition Regulations System DEPARTMENT OF LABOR CLAUSE AND FORMS FORMS General 2953.102 Quotation for Simplified Acquisitions DL 1-2078. The following...
-
Double Shell Tank AY-102 Radioactive Waste Leak Investigation
International Nuclear Information System (INIS)
Washenfelder, Dennis J.
2014-01-01
PowerPoint. The objectives of this presentation are to: Describe Effort to Determine Whether Tank AY-102 Leaked; Review Probable Causes of the Tank AY-102 Leak; and, Discuss Influence of Leak on Hanford's Double-Shell Tank Integrity Program
-
16 CFR 502.102 - “Economy size.”
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false âEconomy size.â 502.102 Section 502.102 Commercial Practices FEDERAL TRADE COMMISSION RULES, REGULATIONS, STATEMENT OF GENERAL POLICY OR INTERPRETATION AND EXEMPTIONS UNDER THE FAIR PACKAGING AND LABELING ACT REGULATIONS UNDER SECTION 5(C) OF THE FAIR PACKAGING AND LABELING ACT Retail Sale...
-
2010-07-01
... safety devices and follow all safety guidelines? Yes, Federal employees in Government motor vehicles have... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Do Federal employees in Government motor vehicles have to use all safety devices and follow all safety guidelines? 102-34.250 Section...
-
Introduction Public Sector Reforms and the Quest for Democratic ...
African Journals Online (AJOL)
seriane.camara
substantive (or emancipatory) democracy in the long run”. Democratic .... the paradigm focused exclusively on short-term macro-economic stabilization, with little ..... Paper presented at the Guy Mhone Memorial Conference on Public Sector.
-
7 CFR 91.102 - Form of official identification symbols.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Form of official identification symbols. 91.102... LABORATORY TESTING PROGRAMS SERVICES AND GENERAL INFORMATION Designation of Approved Symbols for Identification of Commodities Officially Tested By AMS § 91.102 Form of official identification symbols. Two...
-
20 CFR 220.102 - Non-severe impairment(s), defined.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Non-severe impairment(s), defined. 220.102 Section 220.102 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT... these include— (1) Physical functions such as walking, standing, sitting, lifting, pushing, pulling...
-
2010-07-01
... Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT General Introduction... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does GSA still require...
-
DEFF Research Database (Denmark)
Jensen, Rasmus Thybo; Moran, Dermot
2012-01-01
An introduction to a special issue of Phenomenology and the Cognitive Sciences dedicated to empathy and the direct perception approach to other minds......An introduction to a special issue of Phenomenology and the Cognitive Sciences dedicated to empathy and the direct perception approach to other minds...
-
5 CFR 5001.102 - Prohibited financial interests in for-hire transportation companies.
2010-01-01
...-hire transportation companies. 5001.102 Section 5001.102 Administrative Personnel INTERSTATE COMMERCE COMMISSION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE INTERSTATE COMMERCE COMMISSION § 5001.102 Prohibited financial interests in for-hire transportation companies. (a) General prohibition...
-
INTRODUCTION Dental care utilization can be defined as the ...
African Journals Online (AJOL)
INTRODUCTION. Dental care utilization can be defined as the percentage of the population who access dental services over a specified period of time1. Measures of actual dental care utilization describe the percentage of the population who have seen a dentist at different time intervals. Dental disease is a serious public ...
-
12 CFR 1806.102 - Relationship to other Community Development Financial Institutions Programs.
2010-01-01
... Financial Institutions Programs. 1806.102 Section 1806.102 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY BANK ENTERPRISE AWARD PROGRAM General Provisions § 1806.102 Relationship to other Community Development Financial Institutions Programs. Prohibition against double funding...
-
Introduction of Software Products and Services Through "Public" Beta Launches
Amit Mehra; Gireesh Shrimali
2008-01-01
Public “Beta” launches have become a preferred route of entry into the markets for new software products and web site based services. While beta testing of novel products is nothing new, typically such tests were done by experts within firm boundaries. What makes public beta testing so attractive to firms? By introducing semi-completed products in the market, the firm can target the early adopter population, who can then build the potential market through the word of mouth effect by the time ...