48 CFR 719.273-4 - Eligibility of Mentor and Protégé firms.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Eligibility of Mentor and... Development (USAID) Mentor-Protégé Program 719.273-4 Eligibility of Mentor and Protégé firms. Eligible business entities approved as Mentors may enter into agreements (hereafter referred to as “Mentor-Protégé...

Dicty_cDB: SLH273 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLH273 (Link to dictyBase) - - - Contig-U16280-1 SLH273P (Link to Original site) SLH2...73F 241 SLH273Z 294 SLH273P 535 - - Show SLH273 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH273Q.Seq.d/ Representative seq. ID SLH2...73P (Link to Original site) Representative DNA sequence >SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH2...ducing significant alignments: (bits) Value SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH273Q.Seq.d/ 868 0.0 SSK467 (S

39 CFR 273.10 - Reports.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual report...

Dicty_cDB: VFK273 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFK273 (Link to dictyBase) - - - Contig-U16028-1 | Contig-U16311-1 VFK2...73P (Link to Original site) VFK273F 633 VFK273Z 575 VFK273P 1188 - - Show VFK273 Library VF (Link to library) Clone ID VFK2...028-1 | Contig-U16311-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-D/VFK2...73Q.Seq.d/ Representative seq. ID VFK273P (Link to Original site) Representative DNA sequence >VFK273 (VFK2...73Q) /CSM/VF/VFK2-D/VFK273Q.Seq.d/ AAATCTTTATTAATATTTTTCAAAATAAATAAATAAATAAATTAAAAATGAAAGTTTTAT

Application of Taguchi Design and Response Surface Methodology for Improving Conversion of Isoeugenol into Vanillin by Resting Cells of Psychrobacter sp. CSW4.

Science.gov (United States)

Ashengroph, Morahem; Nahvi, Iraj; Amini, Jahanshir

2013-01-01

For all industrial processes, modelling, optimisation and control are the keys to enhance productivity and ensure product quality. In the current study, the optimization of process parameters for improving the conversion of isoeugenol to vanillin by Psychrobacter sp. CSW4 was investigated by means of Taguchi approach and Box-Behnken statistical design under resting cell conditions. Taguchi design was employed for screening the significant variables in the bioconversion medium. Sequentially, Box-Behnken design experiments under Response Surface Methodology (RSM) was used for further optimization. Four factors (isoeugenol, NaCl, biomass and tween 80 initial concentrations), which have significant effects on vanillin yield, were selected from ten variables by Taguchi experimental design. With the regression coefficient analysis in the Box-Behnken design, a relationship between vanillin production and four significant variables was obtained, and the optimum levels of the four variables were as follows: initial isoeugenol concentration 6.5 g/L, initial tween 80 concentration 0.89 g/L, initial NaCl concentration 113.2 g/L and initial biomass concentration 6.27 g/L. Under these optimized conditions, the maximum predicted concentration of vanillin was 2.25 g/L. These optimized values of the factors were validated in a triplicate shaking flask study and an average of 2.19 g/L for vanillin, which corresponded to a molar yield 36.3%, after a 24 h bioconversion was obtained. The present work is the first one reporting the application of Taguchi design and Response surface methodology for optimizing bioconversion of isoeugenol into vanillin under resting cell conditions.

Erratum: IJSNEM 27(3).

Science.gov (United States)

2017-08-01

The International Journal of Sport Nutrition and Exercise Metabolism 27(3), http://journals.humankinetics.com/toc/ijsnem/27/3 , was incorrectly paginated. The correct page range for this issue is 197-292. The online versions of these articles have been corrected.

Impact of agrochemicals on Peronospora sparsa and phenolic profiles in three Rubus arcticus cultivars.

Science.gov (United States)

Hukkanen, Anne; Kostamo, Katri; Kärenlampi, Sirpa; Kokko, Harri

2008-02-13

The main arctic bramble ( Rubus arcticus) cultivars are susceptible to downy mildew ( Peronospora sparsa), which seriously threatens the cultivation. The efficiency of Aliette, Euparen M, phosphite-containing Phosfik, Phostrol, Farm-Fos-44, and Kaliumfosfiet, as well as Bion was evaluated in the greenhouse. Fewer symptoms and less Peronospora DNA were found in plants treated with Euparen M and Bion, whereas Aliette, Phosfik, and Phostrol gave moderate protection. Three arctic bramble cultivars showed varying susceptibility to P. sparsa. An inexpensive and fast in vitro plate test gave results parallel with those obtained in the greenhouse. Quantitative differences were found in the phenolic profiles of the leaves of different cultivars and in different treatments. Several phenolic compounds were tentatively identified in arctic bramble for the first time, for example, monomeric and oligomeric ellagitannins and galloylglucoses. Negative correlation was found between the amount of P. sparsa DNA and flavonol glycosides and some ellagitannins in the leaves 8 days after inoculation, suggesting a possible role for these phenolics in the defense.

Heavy metal accumulation in arctic hares (Lepus arcticus) in Nunavut, Canada

Energy Technology Data Exchange (ETDEWEB)

Pedersen, Simen [Department of Biology, University of Tromso, N-9037 Tromso (Norway)]. E-mail: simenpeders1@gmail.com; Lierhagen, Syverin [Norwegian Institute for Nature Research, Tungasletta 2, N-7485 Trondheim (Norway)

2006-09-15

Accumulation of cadmium, mercury, lead, copper and zinc was studied in muscle, liver and kidney of 9 adult and 7 juvenile arctic hares (Lepus arcticus), collected in 2003 in the southwestern part of Nunavut, Canada. Our objective was to determine the level of heavy metal accumulation, and distribution among age groups and tissue. Concentrations of all metals varied among tissues, and concentrations of Cd, Hg and Zn were higher in adults compared to juveniles. We found correlations in metal content among tissues, and among metals in kidneys. We also found the hares to have low concentration of most heavy metals except cadmium. We suggest that the high cadmium levels might be caused by the local geology, and the hares being adapted to these levels. The low levels of the other metals are probably due to low input of atmospheric contaminants. Only one of the individuals had Cd content slightly above the maximum contaminant levels recommended for human consumption of meat. There were no levels in meat above the recommended maximum for the rest of the metals surveyed. However the Cd levels in liver and kidney are orders of magnitude higher than the recommended maximum, and consumption of these organs should be avoided.

Dicty_cDB: VHK273 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHK273 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...73F 620 - - - - - - Show VHK273 Library VH (Link to library) Clone ID VHK273 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK273Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK273 (VHK273Q) /CSM/VH/VHK2-D/VHK273Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

40 CFR 273.52 - Waste management.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.52 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.52 Waste management. (a) A universal waste transporter must comply with all applicable U.S. Department of...

40 CFR 273.3 - Applicability-pesticides.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-pesticides. 273.3... (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.3 Applicability—pesticides. (a) Pesticides covered under this part 273. The requirements of this part apply to persons managing pesticides, as...

40 CFR 273.13 - Waste management.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.13 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.13 Waste management. (a) Universal waste batteries. A small quantity handler of universal waste must manage...

40 CFR 273.33 - Waste management.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.33 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.33 Waste management. (a) Universal waste batteries. A large quantity handler of universal waste must manage...

40 CFR 273.2 - Applicability-batteries.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-batteries. 273.2 Section...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.2 Applicability—batteries. (a) Batteries covered under 40 CFR part 273. (1) The requirements of this part apply to persons managing batteries, as...

Larvas de Sergestes arcticus Kroyer, 1855, Neotrypaea uncinata (H. Milne-Edwards, 1837 y Munida gregaria (Fabricius, 1793, entre el seno Reloncaví y Boca del Guafo, sur de Chile Larvae of Sergestes arcticus Kroyer, 1855, Neotrypaea uncinata (H. Milne-Edwards, 1837, and Munida gregaria (Fabricius, 1793 between Seno Reloncaví and Boca del Guafo, southern Chile

Directory of Open Access Journals (Sweden)

Armando Mujica

2011-01-01

Full Text Available Se analiza la distribución de los estados de desarrollo de las larvas de Sergestes arcticus, Neotrypaea uncinata y Munida gregaria, capturadas entre el seno Reloncaví y la Boca del Guafo, durante noviembre de 2004. Se distinguieron tres zonas oceanógraficas, de acuerdo a los antecedentes relacionados con el grado de participación de aguas continentales y oceánicas. La distribución de las larvas de estas especies y sus estados de desarrollo, permitieron establecer diferencias significativas entre ellas respecto de las características oceanógraficas, lo que estaría relacionado con los lugares de desove y habitat de las poblaciones desovantes en el área de estudio.The distribution of developmental stages of Sergestes arcticus, Neotrypaea uncinata and Munida gregaria larvae caught between Seno Reloncaví and Boca del Guafo in November 2004 was analyzed. Three oceanographic zones were distinguished according to records showing the degree of participation of continental and oceanic waters. Significant differences were determined between larval distribution and development stages for these species with respect to oceanographic characteristics; said differences might be related to the spawning sites and the habitat of the spawning stock in the study area.

39 CFR 273.2 - Definitions.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Definitions. 273.2 Section 273.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION ADMINISTRATION OF PROGRAM FRAUD CIVIL... representation, certification, affirmation, document, record, or accounting or bookkeeping entry made: (1) With...

25 CFR 273.53 - Applicable procurement regulations.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Applicable procurement regulations. 273.53 Section 273.53 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT General Contract Requirements § 273.53...

48 CFR 719.273-6 - Application process.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application process. 719.273-6 Section 719.273-6 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...égé Program 719.273-6 Application process. Entities interested in becoming a Mentor firm must...

A modified stratified model for the 3C 273 jet

International Nuclear Information System (INIS)

Liu Wenpo; Shen Zhiqiang

2009-01-01

We present a modified stratified jet model to interpret the observed spectral energy distributions of knots in the 3C 273 jet. Based on the hypothesis of the single index of the particle energy spectrum at injection and identical emission processes among all the knots, the observed difference of spectral shape among different 3C 273 knots can be understood as a manifestation of the deviation of the equivalent Doppler factor of stratified emission regions in an individual knot from a characteristic one. The summed spectral energy distributions of all ten knots in the 3C 273 jet can be well fitted by two components: a low-energy component (radio to optical) dominated by synchrotron radiation and a high-energy component (UV, X-ray and γ-ray) dominated by inverse Compton scattering of the cosmic microwave background. This gives a consistent spectral index of α = 0.88 (S v ∝ v -α ) and a characteristic Doppler factor of 7.4. Assuming the average of the summed spectrum as the characteristic spectrum of each knot in the 3C 273 jet, we further get a distribution of Doppler factors. We discuss the possible implications of these results for the physical properties in the 3C 273 jet. Future GeV observations with GLAST could separate the γ-ray emission of 3C 273 from the large scale jet and the small scale jet (i.e. the core) through measuring the GeV spectrum.

39 CFR 273.6 - Evaluation by reviewing official.

Science.gov (United States)

2010-07-01

... supports the allegations of liability; (4) An estimate of the amount of money or the value of property or...)(4) and (5) of this section, the Reviewing Official recommends be demanded from the person alleged to... PROGRAM FRAUD CIVIL REMEDIES ACT § 273.6 Evaluation by reviewing official. (a) Based upon the...

40 CFR 273.36 - Employee training.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.36 Section 273.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A large quantity handler of universal waste must ensure that all employees are...

40 CFR 273.16 - Employee training.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.16 Section 273.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A small quantity handler of universal waste must inform all employees who handle or have...

48 CFR 852.273-71 - Alternative negotiation techniques.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative negotiation techniques. 852.273-71 Section 852.273-71 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-71 Alternative negotiation technique...

39 CFR 273.7 - Concurrence of Attorney General.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Concurrence of Attorney General. 273.7 Section 273... PROGRAM FRAUD CIVIL REMEDIES ACT § 273.7 Concurrence of Attorney General. (a) The Attorney General is... the Attorney General or his designee approves such action in a written statement which specifies: (1...

Characterization of Catalase from Psychrotolerant Psychrobacter piscatorii T-3 Exhibiting High Catalase Activity

Science.gov (United States)

Kimoto, Hideyuki; Yoshimune, Kazuaki; Matsuyma, Hidetoshi; Yumoto, Isao

2012-01-01

A psychrotolerant bacterium, strain T-3 (identified as Psychrobacter piscatorii), that exhibited an extraordinarily high catalase activity was isolated from the drain pool of a plant that uses H2O2 as a bleaching agent. Its cell extract exhibited a catalase activity (19,700 U·mg protein−1) that was higher than that of Micrococcus luteus used for industrial catalase production. Catalase was approximately 10% of the total proteins in the cell extract of the strain. The catalase (PktA) was purified homogeneously by only two purification steps, anion exchange and hydrophobic chromatographies. The purified catalase exhibited higher catalytic efficiency and higher sensitivity of activity at high temperatures than M. luteus catalase. The deduced amino acid sequence showed the highest homology with catalase of Psycrobacter cryohalolentis, a psychrotolelant bacterium obtained from Siberian permafrost. These findings suggest that the characteristics of the PktA molecule reflected the taxonomic relationship of the isolate as well as the environmental conditions (low temperatures and high concentrations of H2O2) under which the bacterium survives. Strain T-3 efficiently produces a catalase (PktA) at a higher rate than Exiguobacterium oxidotolerans, which produces a very strong activity of catalase (EktA) at a moderate rate, in order to adapt to high concentration of H2O2. PMID:22408420

36 CFR 27.3 - Seashore District.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Seashore District. 27.3 Section 27.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR CAPE...' studio, for appropriate small scale home occupations as the making and selling of traditional Cape Cod...

Endotoxin Structures in the Psychrophiles Psychromonas marina and Psychrobacter cryohalolentis Contain Distinctive Acyl Features

Directory of Open Access Journals (Sweden)

Charles R. Sweet

2014-07-01

Full Text Available Lipid A is the essential component of endotoxin (Gram-negative lipopolysaccharide, a potent immunostimulatory compound. As the outer surface of the outer membrane, the details of lipid A structure are crucial not only to bacterial pathogenesis but also to membrane integrity. This work characterizes the structure of lipid A in two psychrophiles, Psychromonas marina and Psychrobacter cryohalolentis, and also two mesophiles to which they are related using MALDI-TOF MS and fatty acid methyl ester (FAME GC-MS. P. marina lipid A is strikingly similar to that of Escherichia coli in organization and total acyl size, but incorporates an unusual doubly unsaturated tetradecadienoyl acyl residue. P. cryohalolentis also shows structural organization similar to a closely related mesophile, Acinetobacter baumannii, however it has generally shorter acyl constituents and shows many acyl variants differing by single methylene (-CH2- units, a characteristic it shares with the one previously reported psychrotolerant lipid A structure. This work is the first detailed structural characterization of lipid A from an obligate psychrophile and the second from a psychrotolerant species. It reveals distinctive structural features of psychrophilic lipid A in comparison to that of related mesophiles which suggest constitutive adaptations to maintain outer membrane fluidity in cold environments.

43 CFR 27.3 - Discrimination prohibited.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Discrimination prohibited. 27.3 Section 27... ISSUED UNDER TITLE II OF PUBLIC LAW 93-153 § 27.3 Discrimination prohibited. (a) General. No person shall... through contractual or other arrangements, subject an individual to discrimination on the grounds of race...

40 CFR 265.273 - Waste analysis.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by § 265.13... listed as a hazardous waste. As required by § 265.13, the waste analysis plan must include analyses...

47 CFR 25.273 - Duties regarding space communications transmissions.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Duties regarding space communications transmissions. 25.273 Section 25.273 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.273 Duties regarding space...

40 CFR 273.54 - Response to releases.

Science.gov (United States)

2010-07-01

... 273.54 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.54 Response to... other residues from universal wastes. (b) A universal waste transporter must determine whether any...

Morphometric, molecular and histopathologic description of hepatic infection by Orthosplanchnus arcticus (Trematoda: Digenea: Brachycladiidae) in ringed seals (Pusa hispida) from Northwest Greenland

DEFF Research Database (Denmark)

Andersen-Ranberg, Emilie; Lehnert, Kristina; Leifsson, Páll S.

2018-01-01

For the first time in > 30 years of routine sampling under the Arctic Monitoring and Assessment Program, a parasite was found in the liver of ringed seals (Phoca hispida) collected near Qaanaaq (Thule), Northwest Greenland, in 2008 and 2014. Concerns regarding changes to parasite occurrence......, possibly related to climate change and bioaccumulation of immunomodulating anthropogenic pollutants, spurred further investigations into parasite characterization, and implications for wildlife health and seal hunters. Microscopic, molecular, and morphometric analyses are presented herein. Of 40 seals, 6...... (15%) were infected, and 5 of 6 of these seals had severe infections. The parasite was identified morphologically as Orthosplanchnus arcticus Odhner, 1905 (Trematoda; Digenea: Brachycladiidae). Macro- and microscopic pathologic study indicated mild-to-severe biliary hyperplasia associated, stasis...

40 CFR 273.17 - Response to releases.

Science.gov (United States)

2010-07-01

... 273.17 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.17... of universal wastes and other residues from universal wastes. (b) A small quantity handler of...

40 CFR 273.37 - Response to releases.

Science.gov (United States)

2010-07-01

... 273.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.37... of universal wastes and other residues from universal wastes. (b) A large quantity handler of...

48 CFR 852.273-70 - Late offers.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Late offers. 852.273-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-70 Late offers. As prescribed in 873.110(a), insert the following provision: Late Offers (JAN 2003) This provision replaces...

33 CFR 273.17 - Annual budget request.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Annual budget request. 273.17... DEFENSE AQUATIC PLANT CONTROL § 273.17 Annual budget request. The Aquatic Plant Control Program is a... to utilize within the budget year taking into account the foreseeable availability of local funds to...

48 CFR 719.273-10 - Internal controls.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Internal controls. 719.273...égé Program 719.273-10 Internal controls. (a) OSDBU will oversee the Program and will work in... objectives. OSDBU will establish internal controls as checks and balances applicable to the Program. These...

Fish and crustaceans in northeast Greenland lakes with special emphasis on interactions between Arctic charr (Salvelinus alpinus), Lepidurus arcticus and benthic chydorids

DEFF Research Database (Denmark)

Jeppesen, E.; Christoffersen, K.; Landkildehus, F.

2001-01-01

We studied the trophic structure in the pelagial and crustacean remains in the surface 1 cm of the sediment of 13 shallow, high arctic lakes in northeast Greenland (74 N). Seven lakes were fishless, while the remaining six hosted a dwarf form of Arctic charr (Salvelinus alpinus). In fishless lakes...... sp. in lakes with Lepidurus, while they were abundant in lakes with fish. The low abundance in fishless lakes could not be explained by damage of crustacean remains caused by Lepidurus feeding in the sediment, because remains of the more soft-shelled, pelagic-living Daphnia were abundant...... in the sediment of these lakes. No significant differences between lakes with and without fish were found in chlorophyll a, total phosphorus, total nitrogen, conductivity or temperature, suggesting that the observed link between Lepidurus arcticus and the benthic crustacean community is causal. Consequently...

25 CFR 273.16 - Powers and duties of Indian Education Committee.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Powers and duties of Indian Education Committee. 273.16 Section 273.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.16...

26 CFR 1.273-1 - Life or terminable interests.

Science.gov (United States)

2010-04-01

....273-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.273-1 Life or terminable interests. Amounts paid as income to the holder of a life or a terminable interest acquired by gift, bequest, or inheritance shall not...

49 CFR 192.273 - General.

Science.gov (United States)

2010-10-01

... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Joining of Materials Other Than by Welding § 192.273...

40 CFR 273.8 - Applicability-household and conditionally exempt small quantity generator waste.

Science.gov (United States)

2010-07-01

... conditionally exempt small quantity generator waste. 273.8 Section 273.8 Protection of Environment ENVIRONMENTAL....8 Applicability—household and conditionally exempt small quantity generator waste. (a) Persons... universal wastes defined at § 273.9; and/or (2) Conditionally exempt small quantity generator wastes that...

25 CFR 273.38 - Equal quality and standard of education.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Equal quality and standard of education. 273.38 Section... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.38 Equal quality and standard of education. Contracts with State education agencies or school districts...

49 CFR 40.273 - What is the effect of a cancelled alcohol test?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled alcohol test? 40.273 Section 40.273 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.273 What is the...

CKD273, a new proteomics classifier assessing CKD and its prognosis.

Directory of Open Access Journals (Sweden)

Ángel Argilés

Full Text Available National Kidney Foundation CKD staging has allowed uniformity in studies on CKD. However, early diagnosis and predicting progression to end stage renal disease are yet to be improved. Seventy six patients with different levels of CKD, including outpatients and dialysed patients were studied for transcriptome, metabolome and proteome description. High resolution urinary proteome analysis was blindly performed in the 53 non-anuric out of the 76 CKD patients. In addition to routine clinical parameters, CKD273, a urinary proteomics-based classifier and its peptides were quantified. The baseline values were analyzed with regard to the clinical parameters and the occurrence of death or renal death during follow-up (3.6 years as the main outcome measurements. None of the patients with CKD2730.55. Unsupervised clustering analysis of the CKD273 peptides separated the patients into two main groups differing in CKD associated parameters. Among the 273 biomarkers, peptides derived from serum proteins were relatively increased in patients with lower glomerular filtration rate, while collagen-derived peptides were relatively decreased (p<0.05; Spearman. CKD273 was different in the groups with different renal function (p<0.003. The CKD273 classifier separated CKD patients according to their renal function and informed on the likelihood of experiencing adverse outcome. Recently defined in a large population, CKD273 is the first proteomic-based classifier successfully tested for prognosis of CKD progression in an independent cohort.

48 CFR 719.273-1 - Purpose.

Science.gov (United States)

2010-10-01

... 719.273-1 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-ProtégÃ... developmental assistance to Protégé entities, fostering the establishment of long-term business relationships...

An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273 (ApJ, 496, L9 [1998])

Science.gov (United States)

Xia, X.-Y.; Boller, Th.; Wu, H.; Deng, Z.-G.; Gao, Y.; Zou, Z.-L.; Mao, S.; Börner, G.

1998-11-01

In the Letter ``An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273'' by X.-Y. Xia, Th. Boller, H. Wu, Z.-G. Deng, Y. Gao, Z.-L. Zou, S. Mao, and G. Börner (ApJ, 496, L9 [1998]), an observational error occurred that invalidates some of our conclusions. Since Mrk 273x was essentially invisible (B~21) in our acqusition image, in order to position the slit on the faint Mrk 273x, a slit rotation had to be applied. Unfortunately, the amount of rotation was applied incorrectly. As a result, the spectrum obtained (shown in Fig. 2) was not for the intended target, Mrk 273x, but for an object very close to, but northeast of, Mrk 273. A new spectrum of Mrk 273x indicates that Mrk 273x is at redshift 0.458, not at 0.0378 as quoted in the Letter. The larger redshift implies that both the optical and X-ray luminosity have to be revised upward by a factor of ~170. Mrk 273x is therefore not a dwarf galaxy optically. The X-ray properties of Mrk 273x remain the same except that its soft X-ray luminosity now reaches ~1044 ergs s-1 for H0=50 km s-1 Mpc-1. The new observations will be presented in a subsequent paper (X.-Y. Xia et al., in preparation [1998]) in order to make corrections and shed further insights on the objects in the Mrk 273 field.

48 CFR 719.273-9 - Obligations under the Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... Mentor-Protégé Program. 719.273-9 Section 719.273-9 Federal Acquisition Regulations System AGENCY FOR... Development (USAID) Mentor-Protégé Program 719.273-9 Obligations under the Mentor-Protégé Program. (a) A Mentor or Protégé may voluntarily withdraw from the Program. However, in no event shall such withdrawal...

40 CFR 273.55 - Off-site shipments.

Science.gov (United States)

2010-07-01

....55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.55 Off-site... universal waste being shipped off-site meets the Department of Transportation's definition of hazardous...

The Multi-component X-ray Emission of 3C 273

Science.gov (United States)

Soldi, S.; Türler, M.; Paltani, S.; Courvoisier, T. J.-L.

2009-05-01

3C 273 is the brightest quasar in the sky and among the most extensively observed and studied AGN, therefore one of the most suitable targets for a long-term, multi-frequency study. The superposition of a thermal Comptonisation component, similar to that observed in Seyfert galaxies, and of a non-thermal component, related to the jet emission, seems to explain some of the spectral and timing properties of the X-ray emission of 3C 273. Yet, during some observations this dichotomy has not been observed and the variability properties could also be consistent with a single-component scenario, characterised by two parameters varying independently. In order to understand the nature of the X-ray emission in 3C 273, a series of observations up to 80-100 keV, possibly catching the source in different flux states, are essential. Simbol-X will be able to study the emission of 3C 273 in the broad 0.5-80 keV band with high sensitivity, allowing us to disentangle the emission from different spectral components, with 20-30 ks long observations. In addition, the shape and the origin of the high-energy emission of this quasar will be further constrained thanks to the AGILE and Fermi satellites, monitoring the γ-ray sky in the MeV-GeV energy domain.

Prediction of Chronic Kidney Disease Stage 3 by CKD273, a Urinary Proteomic Biomarker

DEFF Research Database (Denmark)

Pontillo, Claudia; Zhang, Zhen-Yu; Schanstra, Joost P

2017-01-01

Introduction: CKD273 is a urinary biomarker, which in advanced chronic kidney disease predicts further deterioration. We investigated whether CKD273 can also predict a decline of estimated glomerular filtration rate (eGFR) to ... threshold (P = 0.086). Discussion: In conclusion, while accounting for baseline eGFR, albuminuria, and covariables, CKD273 adds to the prediction of stage 3 chronic kidney disease, at which point intervention remains an achievable therapeutic target....

40 CFR 273.14 - Labeling/marking.

Science.gov (United States)

2010-07-01

... distributed; and (2) The words “Universal Waste-Pesticide(s)” or “Waste-Pesticide(s);” (c) A container, tank... administered or recognized by a state; and (2) The words “Universal Waste-Pesticide(s)” or “Waste-Pesticide(s...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.14...

40 CFR 273.34 - Labeling/marking.

Science.gov (United States)

2010-07-01

... distributed; and (2) The words “Universal Waste—Pesticide(s)” or “Waste—Pesticide(s);” (c) A container, tank...) The words “Universal Waste—Pesticide(s)” or “Waste—Pesticide(s).” (d) (1) Mercury-containing equipment...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.34...

25 CFR 273.72 - Appeal from decision to cancel contract for cause.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Appeal from decision to cancel contract for cause. 273.72 Section 273.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND... decision to cancel contract for cause. A contractor may appeal the decision of a Bureau official to cancel...

40 CFR 273.18 - Off-site shipments.

Science.gov (United States)

2010-07-01

....18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.18... universal waste. (c) If a universal waste being offered for off-site transportation meets the definition of...

40 CFR 273.38 - Off-site shipments.

Science.gov (United States)

2010-07-01

....38 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.38... universal waste. (c) If a universal waste being offered for off-site transportation meets the definition of...

An embedded circumnuclear disk in Mrk 273

NARCIS (Netherlands)

Klockner, HR; Baan, WA

Radio observations using very long baseline interferometry (VLBI) and the Westerbork interferometer have been carried out to study the hydroxyl Megamaser emission in Mrk 273 at different spatial resolutions. Line and continuum observations were carried out by the European VLBI network (EVN) at 1.6

7 CFR 273.9 - Income and deductions.

Science.gov (United States)

2010-01-01

... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.9 Income and...) Payments under Title I (VISTA, University Year for Action, etc.) of the Domestic Volunteer Service Act of...

Structural and sequence analysis of imelysin-like proteins implicated in bacterial iron uptake.

Directory of Open Access Journals (Sweden)

Qingping Xu

Full Text Available Imelysin-like proteins define a superfamily of bacterial proteins that are likely involved in iron uptake. Members of this superfamily were previously thought to be peptidases and were included in the MEROPS family M75. We determined the first crystal structures of two remotely related, imelysin-like proteins. The Psychrobacter arcticus structure was determined at 2.15 Å resolution and contains the canonical imelysin fold, while higher resolution structures from the gut bacteria Bacteroides ovatus, in two crystal forms (at 1.25 Å and 1.44 Å resolution, have a circularly permuted topology. Both structures are highly similar to each other despite low sequence similarity and circular permutation. The all-helical structure can be divided into two similar four-helix bundle domains. The overall structure and the GxHxxE motif region differ from known HxxE metallopeptidases, suggesting that imelysin-like proteins are not peptidases. A putative functional site is located at the domain interface. We have now organized the known homologous proteins into a superfamily, which can be separated into four families. These families share a similar functional site, but each has family-specific structural and sequence features. These results indicate that imelysin-like proteins have evolved from a common ancestor, and likely have a conserved function.

40 CFR 273.53 - Storage time limits.

Science.gov (United States)

2010-07-01

...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.53 Storage time limits. (a) A universal waste transporter may only store the universal waste at a universal waste transfer facility for ten days or less. (b) If a universal waste transporter stores universal waste for...

8 CFR 273.5 - General criteria used for reduction, refund, or waiver of fines.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false General criteria used for reduction, refund, or waiver of fines. 273.5 Section 273.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY..., liquidated damages, and user fee payment records; and, (3) The existence of any extenuating circumstances. ...

48 CFR 719.273 - The U.S. Agency for International Development (USAID) Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... International Development (USAID) Mentor-Protégé Program. 719.273 Section 719.273 Federal Acquisition.... Agency for International Development (USAID) Mentor-Protégé Program 719.273 The U.S. Agency for International Development (USAID) Mentor-Protégé Program. ...

High-voltage power supplies for traveling wave tube WV-273A; Vysokovol`tnye istochniki pitaniya dlya LBV UV-273A

Energy Technology Data Exchange (ETDEWEB)

Lebedev, N I; Fateev, A A

1996-12-31

Paper presents a description of two modifications of high-volt power sources described for preamplifier on UV-273A type travelling wave tube (TWT). Power source where anode power circuit contains semiconducting high-volt switch on thyristors was designed to average pulse mode of TWT operation. Time of switching-in this power circuit constitutes 20 mcs. 2 refs.

The Physics of AGN, a Deep Understanding of the Quasar 3C 273

Science.gov (United States)

Courvoisier, T.; Bottcher, Markus

2004-01-01

Upon our successful AO-1 proposal no. 120023, the quasar 3C 273 has been observed with INTEGRAL in 3 epochs in January 2003. The first observation, on January 5, 2003, with a total INTEGRAL exposure of 1.2 x 10(exp 5) s, was simultaneous with RXTE and XMM- Newton observations. Two more INTEGRAL observations were carried out on January 11, 2003 (exposure: lo4 s) and January 17, 2003 (exposure: 1.1 x 10(exp 5) s). The source was detected with high significance by all INTEGRAL instruments, the OMC, JEM-X, SPI, and IBIS/ISGRI. Being one of the first INTEGRAL observations simultaneous with XMM and RXTE, our observations were also used to fix the cross calibration with those instruments. The combined spectrum resulting from the XMM-Newton, JEM-X, RXTE, SPI and ISGRI X-ray / soft gamma-ray observations is consistent with a straight power-law of photon index Gamma = (1.73 +/- 0.015) between 3 keV and at least 200 keV. A possible detection in the 200 keV - 500 keV band by SPI can not be confirmed with our observations. The normalization of the X/gamma-ray spectrum is (2.24 +/- 0.05) x 10(exp -2) photons /sq cm keV at 1 keV. The source showed a moderate amount of optical variability as observed with the OMC onboard INTEGRAL. No evidence for variability at X-rays and gamma-rays could be reported, which may have been a result of insufficient photon statistics. The X-/gamma-ray spectrum observed in our 2003 observations is consistent with previously measured and modelled broadband spectral energy distributions of 3C 273. It has been included in the U.S. lead Col's work on spectral and variability modelling of gamma-ray blazars, supporting the trend of flat-spectrum radio quasars such as 3C 273 being 7-ray dominated due to a strong contribution from Compton upscattering of external radiation by ultrarelativistic electrons in a relativistic jet. 3C 273 is a particularly convincing example for such a picture since it provides very direct evidence for a strong external radiation

25 CFR 273.18 - Additional requirements for education plan.

Science.gov (United States)

2010-04-01

... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.18... of employees for each special program and number of Indian employees for that program. (k) State the...) Program goals and objectives related to the learning needs of potential target students. (2) Procedures...

Reaction of ammonium triphosphate with gadolinium nitrate in aqueous solution at 273K

International Nuclear Information System (INIS)

Rodicheva, G.V.; Tananaev, I.V.; Romanova, N.M.

1982-01-01

The solubility in the system (NW 4 ) 5 P 3 O 10 -Gd(NO 3 ) 3 - H 2 O (273 K) is studied. Depending on the reagent ratio formation of the compounds Gd 5 (P 3 O 10 ) 3 x22H 2 O, NH 4 Gd 3 (P 3 O 10 ) 2 x12H 2 O and (NH 4 ) 3 Gd 4 (P 3 O 10 ) 3 x14H 2 O is established. Gadolinium triphosphates, separated from solution, are studied using the methods of paper chromatography, X-ray diffractometry, thermography. Simultaneously with thermal dehydration of gadolinium triphosphates the processes of triphosphate decomposition and phosphate anion condensation take place. A mixture of crystalline ortho-phosphate and long- chain polyphosphate of gadolinium is the final product of thermal decomposition (1063 K) of normal and doubl e ammonium- containing gadolinium triphosphates [ru

OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

International Nuclear Information System (INIS)

Fan, J. H.; Liu, Y.; Yuan, Y. H.; Kurtanidze, O.; Chanishvili, R.; Richter, G. M.

2014-01-01

Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works

OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

Energy Technology Data Exchange (ETDEWEB)

Fan, J. H.; Liu, Y.; Yuan, Y. H. [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China); Kurtanidze, O.; Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Richter, G. M. [Astrophysikalisches Institut Potsdam, An der Sternwarte 16, D-14482 Potsdam (Germany)

2014-08-01

Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works.

25 CFR 273.37 - Use of funds outside of schools.

Science.gov (United States)

2010-04-01

... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.37 Use of funds outside of schools. Nothing in these regulations shall prevent the Commissioner from contracting...

Optical monitoring of BL Lac object S5 0716+714 and FSRQ 3C 273 from 2000 to 2014

Science.gov (United States)

Yuan, Yu-Hai; Fan, Jun-hui; Tao, Jun; Qian, Bo-Chen; Costantin, Denise; Xiao, Hu-Bing; Pei, Zhi-Yuan; Lin, Chao

2017-09-01

Context. Using the 1.56 m telescope at the Shanghai Observatory (ShAO), China, we monitored two sources, BL Lac object S5 0716+714 and flat spectrum radio quasar (FSRQ) 3C 273. For S5 0716+714, we report 4969 sets of CCD (Charge-coupled Device) photometrical optical observations (1369 for V band, 1861 for R band and 1739 for I band) in the monitoring time from Dec. 4, 2000 to Apr. 5, 2014. For 3C 273, we report 460 observations (138 for V band, 146 for R band and 176 for I band) in the monitoring time from Mar. 28, 2006 to Apr. 9, 2014. Aims: The observations provide us with a large amount of data to analyze the short-term and long-term optical variabilities. Based on the variable timescales, we can estimate the central black hole mass and the Doppler factor. An abundance of multi-band observations can help us to analyze the relations between the brightness and spectrum. Methods: We use Gaussian fitting to analyze the intra-day light curves and obtain the intra-day variability (IDV) timescales. We use the discrete correlation function (DCF) method and Jurkevich method to analyze the quasi-periodic variability. Based on the VRI observations, we use the linear fitting to analyze the relations between brightness and spectrum. Results: The two sources both show IDV properties for S5 0716+714. The timescales are in the range from 17.3 min to 4.82 h; for 3C 273, the timescale is ΔT = 35.6 min. Based on the periodic analysis methods, we find the periods PV = 24.24 ± 1.09 days, PR = 24.12 ± 0.76 days, PI = 24.82 ± 0.73 days for S5 0716+714, and P = 12.99 ± 0.72, 21.76 ± 1.45 yr for 3C 273. The two sources displayed the "bluer-when-brighter" spectral evolution properties. Conclusions: S5 0716+714 and 3C 273 are frequently studied objects. The violent optical variability and IDV may come from the jet. Gaussian fitting can be used to analyze IDVs. The relations between brightness (flux density) and spectrum are strongly influenced by the frequency. A table of the

Trophic interactions of the pelagic ecosystem over the Reykjanes Ridge as evaluated by fatty acid and stable isotope analyses

Science.gov (United States)

Petursdottir, H.; Gislason, A.; Falk-Petersen, S.; Hop, H.; Svavarsson, J.

2008-01-01

Trophic relationships of the important oceanic crustacean species Calanus finmarchicus, Meganyctiphanes norvegica and Sergestes arcticus, as well as the mesopelagic fishes Maurolicus muelleri, Benthosema glaciale and Sebastes mentella, were investigated over the Reykjanes Ridge in June 2003 and in June 2004. Measurements were performed of length, wet weight, dry weight, total lipid, lipid class, fatty acid and fatty alcohol profiles and stable isotopes (δ 13C and δ 15N). High amounts of the Calanus lipid markers, 20:1(n-9) and 22:1(n-11) in these species confirm the importance of Calanus spp. in this ecosystem. Comparisons of fatty acid/alcohol profiles by multivariate analysis revealed two main trophic pathways over the Reykjanes Ridge. In one pathway, Calanus spp. was an important part of the diet for the small mesopelagic fish species M. muelleri and B. glaciale and the shrimp S. arcticus, whereas in the other pathway, the euphausiid M. norvegica was the dominant food for the redfish S. mentella, and Calanus spp. were of less importance. M. muelleri and the smaller B. glaciale feed on C. finmarchicus, whereas the larger B. glaciale and S. arcticus select the larger, deeper-living C. hyperboreus. All investigated species are true pelagic species except for the shrimp S. arcticus, which seems to have a benthic feeding habit as well. The δ 15N levels show that of the species investigated, C. finmarchicus occupies the lowest trophic level (2.0) and the redfish, S. mentella, the highest (4.2). All the species were lipid rich, typical for subarctic pelagic ecosystem. Calanus finmarchicus, S. arcticus and B. glaciale store wax esters as their lipid stores, while M. norvegica, M. muelleri and S. mentella store triacylglycerols.

Integral Field Spectroscopy of Markarian 273: Mapping High-Velocity Gas Flows and an Off-Nucleus Seyfert 2 Nebula.

Science.gov (United States)

Colina; Arribas; Borne

1999-12-10

Integral field optical spectroscopy with the INTEGRAL fiber-based system is used to map the extended ionized regions and gas flows in Mrk 273, one of the closest ultraluminous infrared galaxies. The Hbeta and [O iii] lambda5007 maps show the presence of two distinct regions separated by 4&arcsec; (3.1 kpc) along position angle (P.A.) 240 degrees. The northeastern region coincides with the optical nucleus of the galaxy and shows the spectral characteristics of LINERs. The southwestern region is dominated by [O iii] emission and is classified as a Seyfert 2. Therefore, in the optical, Mrk 273 is an ultraluminous infrared galaxy with a LINER nucleus and an extended off-nucleus Seyfert 2 nebula. The kinematics of the [O iii] ionized gas shows (1) the presence of highly disturbed gas in the regions around the LINER nucleus, (2) a high-velocity gas flow with a peak-to-peak amplitude of 2.4x103 km s-1, and (3) quiescent gas in the outer regions (at 3 kpc). We hypothesize that the high-velocity flow is the starburst-driven superwind generated in an optically obscured nuclear starburst and that the quiescent gas is directly ionized by a nuclear source, similar to the ionization cones typically seen in Seyfert galaxies.

THE INNER KILOPARSEC OF Mrk 273 WITH KECK ADAPTIVE OPTICS

Energy Technology Data Exchange (ETDEWEB)

U, Vivian; Sanders, David; Kewley, Lisa [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Dr., Honolulu, HI 96822 (United States); Medling, Anne; Max, Claire [Department of Astronomy and Astrophysics, University of California, Santa Cruz, 1156 High Street, Santa Cruz, CA 95064 (United States); Armus, Lee [Spitzer Science Center, California Institute of Technology, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Iwasawa, Kazushi [ICREA and Institut del Ciències del Cosmos, Universitat de Barcelona (IEEC-UB), Martí i Franquès, 1, E-08028 Barcelona (Spain); Evans, Aaron [Department of Astronomy, University of Virginia, 530 McCormick Road, Charlottesville, VA 22904 (United States); Fazio, Giovanni, E-mail: vivianu@ucr.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)

2013-10-01

There is X-ray, optical, and mid-infrared imaging and spectroscopic evidence that the late-stage ultraluminous infrared galaxy merger Mrk 273 hosts a powerful active galactic nucleus (AGN). However, the exact location of the AGN and the nature of the nucleus have been difficult to determine due to dust obscuration and the limited wavelength coverage of available high-resolution data. Here we present near-infrared integral-field spectra and images of the nuclear region of Mrk 273 taken with OSIRIS and NIRC2 on the Keck II Telescope with laser guide star adaptive optics. We observe three spatially resolved components, and analyze the nuclear molecular and ionized gas emission lines and their kinematics. We confirm the presence of the hard X-ray AGN in the southwest nucleus. In the north nucleus, we find a strongly rotating gas disk whose kinematics indicate a central black hole of mass 1.04 ± 0.1 × 10{sup 9} M{sub ☉}. The H{sub 2} emission line shows an increase in velocity dispersion along the minor axis in both directions, and an increased flux with negative velocities in the southeast direction; this provides direct evidence for a collimated molecular outflow along the axis of rotation of the disk. The third spatially distinct component appears to the southeast, 640 and 750 pc from the north and southwest nuclei, respectively. This component is faint in continuum emission but shows several strong emission line features, including [Si VI] 1.964 μm which traces an extended coronal-line region. The geometry of the [Si VI] emission combined with shock models and energy arguments suggest that [Si VI] in the southeast component must be at least partly ionized by the SW AGN or a putative AGN in the northern disk, either through photoionization or through shock-heating from strong AGN- and circumnuclear-starburst-driven outflows. This lends support to a scenario in which Mrk 273 may be a dual AGN system.

20 CFR 404.273 - When are automatic cost-of-living increases effective?

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When are automatic cost-of-living increases..., SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.273 When are automatic cost-of-living increases effective? We make automatic cost-of-living...

43 CFR 30.273 - What action will the judge take to record title?

Science.gov (United States)

2010-10-01

... PROBATE HEARINGS PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.273 What action will...) File the complete record, including the decision, with the LTRO as provided in § 30.233; (c) Furnish a... decision to each interested party. ...

Testing a double AGN hypothesis for Mrk 273

Science.gov (United States)

Iwasawa, K.; U, V.; Mazzarella, J. M.; Medling, A. M.; Sanders, D. B.; Evans, A. S.

2018-04-01

The ultra-luminous infrared galaxy (ULIRG) Mrk 273 contains two infrared nuclei, N and SW, separated by 1 arcsecond. A Chandra observation has identified the SW nucleus as an absorbed X-ray source with NH 4 × 1023 cm-2 but also hinted at the possible presence of a Compton-thick AGN in the N nucleus, where a black hole of 109 M⊙ is inferred from the ionized gas kinematics. The intrinsic X-ray spectral slope recently measured by NuSTAR is unusually hard (Γ 1.3) for a Seyfert nucleus, for which we seek an alternative explanation. We hypothesize a strongly absorbed X-ray source in N, of which X-ray emission rises steeply above 10 keV, in addition to the known X-ray source in SW, and test it against the NuSTAR data, assuming the standard spectral slope (Γ = 1.9). This double X-ray source model gives a good explanation of the hard continuum spectrum, deep Fe K absorption edge, and strong Fe K line observed in this ULIRG, without invoking the unusual spectral slope required for a single source interpretation. The putative X-ray source in N is found to be absorbed by NH = 1.4+0.7-0.4 × 1024 cm-2. The estimated 2-10 keV luminosity of the N source is 1.3 × 1043 erg s-1, about a factor of 2 larger than that of SW during the NuSTAR observation. Uncorrelated variability above and below 10 keV between the Suzaku and NuSTAR observations appears to support the double source interpretation. Variability in spectral hardness and Fe K line flux between the previous X-ray observations is also consistent with this picture.

AN HST PROPER-MOTION STUDY OF THE LARGE-SCALE JET OF 3C273

Energy Technology Data Exchange (ETDEWEB)

Meyer, Eileen T.; Georganopoulos, Markos [University of Maryland Baltimore County, Baltimore, MD 21250 (United States); Sparks, William B. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Anderson, Jay; Marel, Roeland van der; Biretta, John; Chiaberge, Marco; Norman, Colin [Space Telescope Science Institute, Baltimore, MD 21210 (United States); Tony Sohn, Sangmo [Johns Hopkins University, Baltimore, MD 21210 (United States); Perlman, Eric, E-mail: meyer@stsci.edu [Florida Institute of Technology, Melbourne, FL 32901 (United States)

2016-02-20

The radio galaxy 3C 273 hosts one of the nearest and best-studied powerful quasar jets. Having been imaged repeatedly by the Hubble Space Telescope (HST) over the past twenty years, it was chosen for an HST program to measure proper motions in the kiloparsec-scale resolved jets of nearby radio-loud active galaxies. The jet in 3C 273 is highly relativistic on sub-parsec scales, with apparent proper motions up to 15c observed by very long baseline interferometry. In contrast, we find that the kiloparsec-scale knots are compatible with being stationary, with a mean speed of −0.2 ± 0.5c over the whole jet. Assuming the knots are packets of moving plasma, an upper limit of 1c implies a bulk Lorentz factor Γ < 2.9. This suggests that the jet has either decelerated significantly by the time it reaches the kiloparsec scale, or that the knots in the jet are standing shock features. The second scenario is incompatible with the inverse Compton off the Cosmic Microwave Background (IC/CMB) model for the X-ray emission of these knots, which requires the knots to be in motion, but IC/CMB is also disfavored in the first scenario due to energetic considerations, in agreement with the recent finding of Meyer and Georganopoulos which ruled out the IC/CMB model for the X-ray emission of 3C 273 via gamma-ray upper limits.

The rate coefficient for the reaction NO2 + NO3 yielding NO + NO2 + O2 from 273 to 313 K

Science.gov (United States)

Cantrell, Chris A.; Shetter, Richard E.; Mcdaniel, Anthony H.; Calvert, Jack G.

1990-01-01

The ratio of rate constants for the reaction NO3 + NO yielding 2 NO2 (k3) and the reaction NO2 + NO3 yielding NO + NO2 + O2 (k4) were determined by measuring of NO and NO2 concentrations of NO and NO2 in an N2O5/NO2/N2 mixture over the temperature range 273-313 K. The measured ratio was found to be expressed by the equation k3/k4 = 387 exp(-1375/T). The results are consistent with those of Hammer et al. (1986).

Alternative synthetic route for the heterometallic CO-releasing [Sb@Rh12(CO27]3− icosahedral carbonyl cluster and synthesis of its new unsaturated [Sb@Rh12(CO24]4− and dimeric [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− derivatives

Directory of Open Access Journals (Sweden)

Cristina Femoni

2016-10-01

Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.

Ten Years of Monitoring 3C 273 with XMM–Newton Liu Liu ...

Indian Academy of Sciences (India)

Abstract. We present ten years optical/UV/X-ray observations of 3C. 273 performed using XMM–Newton between 2000 and 2009. The short- time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum with a ...

Solubility measurement and correlation of 4-nitrophthalimide in (methanol, ethanol, or acetone) + N,N-dimethylformamide mixed solvents at temperatures from 273.15 K to 323.15 K

International Nuclear Information System (INIS)

Li, Rongrong; Han, Shuo; Du, Cunbin; Cong, Yang; Wang, Jian; Zhao, Hongkun

2016-01-01

Highlights: • Solubility of 4-nitrophthalimide in binary mixed solvents were determined. • Solubility data were correlated and calculated by four models. • The standard dissolution enthalpy for the dissolution processes were calculated. - Abstract: The solubility of 4-nitrophthalimide in binary (methanol + N,N-dimethylformamide (DMF), ethanol + DMF) and (acetone + DMF) solvent mixtures were investigated by the isothermal dissolution equilibrium method under atmosphere pressure. These studies were carried out at different mass fractions of methanol, ethanol or acetone ranging from 0.1 to 0.9 at temperature T = (273.15–323.15) K. For the nine groups of each solvent mixture studied, the solubility of 4-nitrophthalimide in mixed solutions increased with increasing temperature and mass fraction of methanol, ethanol or acetone for the three systems including (methanol + DMF), (ethanol + DMF) and (acetone + DMF). At the same temperature and mass fraction of methanol, ethanol or acetone, the mole fraction solubility of 4-nitrophthalimide in (acetone + DMF) was greater than that in the other two binary solvents. In addition, the experimental mole fraction solubility was correlated by four models (Jouyban–Acree model, van’t Hoff–Jouyban–Acree model, modified Apelblat–Jouyban–Acree model and Sun model). The Jouyban–Acree model gave best representation for the experimental solubility values. Furthermore, the standard molar enthalpies of 4-nitrophthalimide during the dissolving process (Δ sol H o ) were also obtained in this work, and the results show that the dissolution process is endothermic. The experimental solubility and the models used in this work will be helpful in separating 4-nitrophthalimide from its isomeric mixtures.

Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

DEFF Research Database (Denmark)

Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.

2003-01-01

INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...

New taxa and combinations in neotropical Juncus (Juncaceae)

DEFF Research Database (Denmark)

Balslev, Henrik

1983-01-01

Juncus arequipensis andJ. breviculmis are described as new species, andJ. ramboi subsp.colombianus as a new subspecies.Juncus arcticus Willd. var.mexicanus (Willd.), var.montanus (Engelm.), and var.andicola (Hook.) are proposed as new combinations.......Juncus arequipensis andJ. breviculmis are described as new species, andJ. ramboi subsp.colombianus as a new subspecies.Juncus arcticus Willd. var.mexicanus (Willd.), var.montanus (Engelm.), and var.andicola (Hook.) are proposed as new combinations....

Some observations on the use of the triple points of deuterium and xenon in interpolation schemes for platinum resistance thermometers below 273 K

International Nuclear Information System (INIS)

Kemp, R.C.

1988-01-01

The use of the triple points of deuterium and xenon is investigated in some interpolation schemes for platinum resistance thermometers between 13.8 K and 273 K. The use of these triple points together is shown to lead to a large sensitivity to errors in the realization of the boiling point of water or the triple point of gallium and of the triple point of xenon for interpolated temperatures below 25 K. The behaviour of these interpolation schemes is presented as evidence that the large non-uniqueness observed in temperature scales between 84 K and 273 K is due in part to measurement errors at the boiling point of water. The use of the triple point of xenon and in interpolation scheme between 25 K and 273 K is shown to lead to a large sensitivity to calibration errors in the triple points of xenon and gallium between 25 K and 54 K. (orig.)

33 CFR Appendix C to Part 273 - Information Requirements for Aquatic Plant Control Program Environmental Impact Statements

Science.gov (United States)

2010-07-01

... Aquatic Plant Control Program Environmental Impact Statements C Appendix C to Part 273 Navigation and... Environmental Impact Statements 1. Description of the problem. a. Pests. Identify the pest to be controlled by.... Relationship to environmental situation. Non-target organisms and integrated pest management programs. 2...

Constraining the location of rapid gamma-ray flares in the flat spectrum radio quasar 3C 273 [Constraining the location of rapid gamma-ray flares in the FSRQ 3C 273

International Nuclear Information System (INIS)

Rani, B.; Lott, B.; Krichbaum, T. P.; Fuhrmann, L.; Zensus, J. A.

2013-01-01

Here, we present a γ-ray photon flux and spectral variability study of the flat-spectrum radio quasar 3C 273 over a rapid flaring activity period between September 2009 to April 2010. Five major flares were observed in the source during this period. The most rapid flare observed in the source has a flux doubling time of 1.1 hr. The rapid γ-ray flares allow us to constrain the location and size of the γ-ray emission region in the source. The γγ-opacity constrains the Doppler factor δ_γ ≥ 10 for the highest energy (15 GeV) photon observed by the Fermi-Large Area Telescope (LAT). Causality arguments constrain the size of the emission region to 1.6 × 10"1"5 cm. The γ-ray spectra measured over this period show clear deviations from a simple power law with a break in the 1–2 GeV energy range. We discuss possible explanations for the origin of the γ-ray spectral breaks. Our study suggests that the γ-ray emission region in 3C 273 is located within the broad line region (< 1.6 pc). As a result, the spectral behavior and temporal characteristics of the individual flares indicate the presence of multiple shock scenarios at the base of the jet.

Gammay rays from Penrose powered black holes in centaurus A, 3C 273, and NGC 4151

International Nuclear Information System (INIS)

Kafatos, M.; and Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center)

1980-01-01

Gamma-ray observations of active galaxies have important consequences for theories of the activity in their nuclei. The observations of Cen A, 3C 273, and NGC 4151 are examined under the assumption that Penrose collision processes in the ergospheres of massive black holes power their nuclei. The observed sharp break in the MeV region of the NGC 4151 spectrum cannot be due to the γ-γ pair production process. We attribute this break to the Penrose Compton scattering (PCS), in which γ-rays escape from the ergosphere as a result of Penrose processes involving electrons and lower energy X-ray photons in the ergosphere of the black hole. The absence of an MeV break in the spectra of Cen A and 3C 273 argues in favor of the Penrose pair production (PPP), in which high-energy pairs (a few GeV in energy) escape as result of Penrose processes involving protons and γ-rays that are present in any hot, optically thin, vertically extended accretion disk. An intrinsic break in the GeV region is predicted for both Cen A and 3C 273 as well as any other PPP powered nucleus.If PPP is important for QSOs and radio galaxies and some Seyferts, powerful radio objects should also be powerful γ-ray objects. Nuclei in which the black hole is spinning slowly would still emit visible light, UV, and X-rays as result of accretion without Penrose processes but would be weak in radio or high-energy γ-rays. Future γ-ray observations should provide clues as to whether this scenario is correct. Besides spectral information at γ-ray frequencies, possible variability at γ-ray frequencies should be searched for

Effects of hyperoxia and caffeine on the expression of fragile site at Xq27.3

Energy Technology Data Exchange (ETDEWEB)

Rafi, S.K.; Surana, R.B.; Christopher, K.L. [Armed Forces Institute of Pathology, Washington, DC (United States)] [and others

1996-02-02

To enhance the cytogenetic expression of the fragile X chromosome, we studied the effects of hyperoxia and caffeine on the induction of fragile Xq27.3. A lymphoblastoid cell line (GM 06912) derived from a fragile X male proband was cultured in RPMI 1640 containing 16% dialyzed fetal calf serum. The cells were synchronously subjected to one of 3 different atmospheric oxygen tensions (21%, 21.3 kPa, hyperoxic) during the last 24 hours of the 72 hour culture, immediately after the addition of 2{prime}-deoxy-5-fluorouridine (FUdR) at 25 ng/ml. To study the enhancing effect of caffeine, with or without hyperoxia, a second set of cultures was additionally subjected to caffeine (2.5 mM) during the last 6 hours of the culture. When the fragility of hyperoxic cells (38.1 kPa dissolved oxygen) was compared to that of normoxic control cells (13.3 kPa dissolved oxygen), the difference was significant (P < 0.05). These data suggest that there is a mean increase in the fragile Xq27.3 expressivity as the dissolved oxygen tension increases. Additionally, we observed that caffeine, with or without hyperoxia, significantly (P <0.05) suppressed the expression of the fragile X site in this lymphoblastoid cell line. 34 refs., 2 tabs.

Study on the KM capacitor base thermometers in the 42-273 K range

International Nuclear Information System (INIS)

Luzganov, V.S.; Mats'ko, A.A.

1988-01-01

Thermometric characteristics of the KM-5a-HZ0 monolithic capacitors in the 42-273 K temperature range are studied. Capacitors capacitance - temperature relation is considered in details. The data reproducibility after 5, 23, 34, 50, 51 and 57 days is studied, the accuracy of temperature measurements by the given thermometers is determined. Recommendations on selection of cpacitors, suitable for application as thermometer, are given. These capacitors permit temperature measurement in the 42-225 K range with the error of ± 0.5 K, and above 225 K the error is ± 1K. 8 refs.; 1 fig.; 1 tab

Rapid infrared and optical variability in the bright quasar 3C273

International Nuclear Information System (INIS)

Courvoisier, T.J.-L.; Robson, E.I.; Hughes, D.H.; Bouchet, P.; Schwarz, H.E.; Krisciunas, K.

1988-01-01

We have observed variations by a factor of two in the infrared flux from the bright quasar 3C273 on a timescale as short as one day. In February 1988, the behaviour of the source changed from having a stable infrared flux and slow optical variations to a state characterized by recurrent infrared and optical flaring. The optical variations were of several per cent per day, changing from increase to decrease approximately every week. The amplitude of the repeated optical flares was 30-40%. The data are consistent with re-injection/acceleration of electrons followed by rapid cooling. The inferred magnetic field is 0.7 gauss and the data are marginally consistent with no relativistic beaming. (author)

Mitochondrial protection by the mixed muscarinic/σ1 ligand ANAVEX2-73, a tetrahydrofuran derivative, in Aβ25-35 peptide-injected mice, a nontransgenic Alzheimer's disease model.

Science.gov (United States)

Lahmy, Valentine; Long, Romain; Morin, Didier; Villard, Vanessa; Maurice, Tangui

2014-01-01

Alzheimer's disease (AD), the most prevalent dementia in the elderly, is characterized by progressive synaptic and neuronal loss. Mitochondrial dysfunctions have been consistently reported as an early event in AD and appear before Aβ deposition and memory decline. In order to define a new neuroprotectant strategy in AD targeting mitochondrial alterations, we develop tetrahydro-N,N-dimethyl-2,2-diphenyl-3-furanmethanamine (ANAVEX2-73, AE37), a mixed muscarinic receptor ligand and a sigma-1 receptor (σ1R) agonist. We previously reported that ANAVEX2-73 shows anti-amnesic and neuroprotective activities in mice injected intracerebroventricular (ICV) with oligomeric amyloid-β25-35 peptide (Aβ25-35). The σ1R is present at mitochondria-associated endoplasmic reticulum (ER) membranes, where it acts as a sensor/modulator of ER stress responses and local Ca(2+) exchanges with the mitochondria. We therefore evaluated the effect of ANAVEX2-73 and PRE-084, a reference σ1R agonist, on preservation of mitochondrial integrity in Aβ25-35-injected mice. In isolated mitochondria from hippocampus preparations of Aβ25-35 injected animals, we measured respiration rates, complex activities, lipid peroxidation, Bax/Bcl-2 ratios and cytochrome c release into the cytosol. Five days after Aβ25-35 injection, mitochondrial respiration in mouse hippocampus was altered. ANAVEX2-73 (0.01-1 mg/kg IP) restored normal respiration and PRE-084 (0.5-1 mg/kg IP) increased respiration rates. Both compounds prevented Aβ25-35-induced increases in lipid peroxidation levels, Bax/Bcl-2 ratio and cytochrome c release into the cytosol, all indicators of increased toxicity. ANAVEX2-73 and PRE-084 efficiently prevented the mitochondrial respiratory dysfunction and resulting oxidative stress and apoptosis. The σ1R, targeted selectively or non-selectively, therefore appears as a valuable target for protection against mitochondrial damages in AD.

Antibodies against aquaporin-4 in neuromyelitis optica: distinction between recurrent and monophasic patients

NARCIS (Netherlands)

Ketelslegers, I.A.; Modderman, P.W.; Vennegoor, A.; Killestein, J.; Hamann, D.; Hintzen, R.Q.

2011-01-01

The detection of antibodies against aquaporin-4 (AQP4) has improved the diagnosis of neuromyelitis optica (NMO). We evaluated a recently established cell-based anti-AQP4 assay in 273 patients with inflammatory CNS demyelination. The assay had a specificity of 99% and a sensitivity of 56% to detect

Yeast Interacting Proteins Database: YDL239C, YDR273W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available of a Don1p-containing structure at the leading edge of the prospore membrane via interaction with spindle p...it as prey (1) YDR273W DON1 Meiosis-specific component of the spindle pole body, part of the leading... edge protein (LEP) coat, forms a ring-like structure at the leading edge of the prospore...ption Protein required for spore wall formation, thought to mediate assembly of a Don1p-containing structure at the leading...description Meiosis-specific component of the spindle pole body, part of the leading edge protein (LEP) coat

South African Journal of Geomatics - Vol 4, No 3 (2015)

African Journals Online (AJOL)

Geospatial subsidence hazard modelling at Sterkfontein Caves · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Ashraf, F Cawood, 273-284. http://dx.doi.org/10.4314/sajg.v4i3.8 ...

N,N-Diethylanilinium 2,4-dioxo-5-(2,4,6-trinitrophenyl-1,2,3,4-tetrahydropyrimidin-6-olate

Directory of Open Access Journals (Sweden)

Manickam Buvaneswari

2011-12-01

Full Text Available In the crystal structure of the title molecular salt, C10H16N+·C10H4N5O9−, the components are linked through a N—H...O hydrogen bonds. R22(8 ring motifs are formed between inversion-related barbiturate residues. Two intramoleculer N—H...O hydrogen bonds are observed in the anion. The dihedral angle between 2,4,6-trinitrophenyl and barbiturate rings is 53.6 (2°. The N,N-diethylamine substituent is disordered and was modeled as two geometrically equivalent conformers with occupancies of 0.737 (2 and 0.273 (2.

A cosmic double helix in the archetypical quasar 3C273.

Science.gov (United States)

Lobanov, A P; Zensus, J A

2001-10-05

Finding direct evidence for plasma instability in extragalactic jets is crucial for understanding the nature of relativistic outflows from active galactic nuclei. Our radio interferometric observations of the quasar 3C273 made with the orbiting radio telescope, HALCA, and an array of ground telescopes have yielded an image in which the emission across the jet is resolved, revealing two threadlike patterns that form a double helix inside the jet. This double helical structure is consistent with a Kelvin-Helmholtz instability, and at least five different instability modes can be identified and modeled by a light jet with a Lorentz factor of 2 and Mach number of 3.5. The model reproduces in detail the internal structure of the jet on scales of up to 30 milli-arc seconds ( approximately 300 parsecs) and is consistent with the general morphology of the jet on scales of up to 1 kiloparsec.

1,4-Disilacyclohexa-2,5-diene

DEFF Research Database (Denmark)

Tibbelin, Julius; Wallner, Andreas; Emanuelsson, Rikard

2014-01-01

2,3,5,6-Tetraethyl-1,4-disilacyclohexa-2,5-dienes with either four chloro (1a), methyl (1b), or trimethylsilyl (TMS) (1c) substituents at the two silicon atoms were examined in an effort to design rigid compounds with strong neutral cross-hyperconjugation between π- and σ-bonded molecular segments......). Furthermore, 1,4-disilacyclohexadiene 1c absorbs strongly at 273 nm (4.55 eV), whereas 1a and 1b have no symmetry allowed excitations above 215 nm (below 5.77 eV). Thus, suitably substituted 1,4-disilacyclohexa-2,5-dienes could represent novel building blocks for the design of larger cross...

Species delimitation in northern European water scavenger beetles of the genus Hydrobius (Coleoptera, Hydrophilidae)

Science.gov (United States)

Fossen, Erlend I.; Ekrem, Torbjørn; Nilsson, Anders N.; Bergsten, Johannes

2016-01-01

Abstract The chiefly Holarctic Hydrobius species complex (Coleoptera, Hydrophilidae) currently consists of Hydrobius arcticus Kuwert, 1890, and three morphological variants of Hydrobius fuscipes (Linnaeus, 1758): var. fuscipes, var. rottenbergii and var. subrotundus in northern Europe. Here molecular and morphological data are used to test the species boundaries in this species complex. Three gene segments (COI, H3 and ITS2) were sequenced and analyzed with Bayesian methods to infer phylogenetic relationships. The Generalized Mixed Yule Coalescent (GMYC) model and two versions of the Bayesian species delimitation method BPP, with or without an a priori defined guide tree (v2.2 & v3.0), were used to evaluate species limits. External and male genital characters of primarily Fennoscandian specimens were measured and statistically analyzed to test for significant differences in quantitative morphological characters. The four morphotypes formed separate genetic clusters on gene trees and were delimited as separate species by GMYC and by both versions of BPP, despite specimens of Hydrobius fuscipes var. fuscipes and Hydrobius fuscipes var. subrotundus being sympatric. Hydrobius arcticus and Hydrobius fuscipes var. rottenbergii could only be separated genetically with ITS2, and were delimited statistically with GMYC on ITS2 and with BPP on the combined data. In addition, six or seven potentially cryptic species of the Hydrobius fuscipes complex from regions outside northern Europe were delimited genetically. Although some overlap was found, the mean values of six male genital characters were significantly different between the morphotypes (p < 0.001). Morphological characters previously presumed to be diagnostic were less reliable to separate Hydrobius fuscipes var. fuscipes from Hydrobius fuscipes var. subrotundus, but characters in the literature for Hydrobius arcticus and Hydrobius fuscipes var. rottenbergii were diagnostic. Overall, morphological and molecular

Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

Czech Academy of Sciences Publication Activity Database

Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.

2015-01-01

Roč. 473, 1 January (2015), s. 267-273 ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.557, year: 2015

16.4 W laser output at 1.34 μm with twin Nd:YVO4 crystals and double-end-pumping structure

International Nuclear Information System (INIS)

Lu, C; Gong, M; Liu, Q; Huang, L; He, F

2008-01-01

High-power high-beam-quality 1.34 μm continuous-wave laser with twin Nd:YVO 4 crystals pumped by four fiber-coupled laser diodes, which constructed a double-end-pumping structure, is reported. With total 60 W pumping power incident, the highest 16.4 W output laser power was generated, the slope efficiency and optical efficiency were measured as better than 30.0% and 27.3%, respectively. With 12 W laser output, the beam quality was measured to be better than two times diffraction-limit and the instability of laser output was determined to be better than 1% over an hour time

7 CFR 273.4 - Citizenship and alien status.

Science.gov (United States)

2010-01-01

... the Indian Self-Determination and Education Assistance Act (25 U.S.C. 450b(e)) which is recognized as... verification. Until the alien provides information or verification necessary to carry out the provisions of... cooperate in providing information or verification, other adult members of the alien's household are...

RADIOASTRON OBSERVATIONS OF THE QUASAR 3C273: A CHALLENGE TO THE BRIGHTNESS TEMPERATURE LIMIT

Energy Technology Data Exchange (ETDEWEB)

Kovalev, Y. Y.; Kardashev, N. S.; Voitsik, P. A.; Kovalev, Yu. A.; Lisakov, M. M.; Sokolovsky, K. V. [Astro Space Center of Lebedev Physical Institute, Profsoyuznaya 84/32, 117997 Moscow (Russian Federation); Kellermann, K. I. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903-2475 (United States); Lobanov, A. P.; Zensus, J. A.; Anderson, J. M.; Bach, U.; Kraus, A. [Max-Planck-Institute for Radio Astronomy, Auf dem Hügel 69, D-53121 (Germany); Johnson, M. D. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gurvits, L. I. [Joint Institute for VLBI ERIC, P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Jauncey, D. L. [CSIRO Astronomy and Space Sciences, Epping, NSW 1710 (Australia); Ghigo, F. [National Radio Astronomy Observatory, Rt. 28/92, Green Bank, WV 24944-0002 (United States); Ghosh, T.; Salter, C. J. [Arecibo Observatory, NAIC, HC3 Box 53995, Arecibo, Puerto Rico, PR 00612 (United States); Petrov, L. Yu. [Astrogeo Center, 7312 Sportsman Drive, Falls Church, VA 22043 (United States); Romney, J. D. [National Radio Astronomy Observatory, P.O. Box O, 1003 Lopezville Road, Socorro, NM 87801-0387 (United States)

2016-03-20

Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of 10{sup 11.5} K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of 10{sup 13} K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C 273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 μas (2.7 light months) and brightness temperature in excess of 10{sup 13} K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require a much higher Doppler factor than what is determined from jet apparent kinematics.

3C 273 with NuSTAR: Unveiling the Active Galactic Nucleus

DEFF Research Database (Denmark)

Madsen, Kristin K.; Fürst, Felix; Walton, Dominic J.

2015-01-01

We present results from a 244 ks NuSTAR observation of 3C 273 obtained during a cross-calibration campaign with the Chandra, INTEGRAL, Suzaku, Swift, and XMM-Newton observatories. We show that the spectrum, when fit with a power-law model using data from all observatories except INTEGRAL over the 1......-78 keV band, leaves significant residuals in the NuSTAR data between 30 and 78 keV. The NuSTAR 3-78 keV spectrum is well. described by an exponentially cutoff power law (Γ = 1.646± 0.006, Ecutoff = 202-34 +51 keV) with a weak reflection component from cold, dense material. There is also evidence......-energy power. law is consistent with the presence of a beamed jet, which begins to dominate over emission from the inner accretion flow at 30-40 keV. Modeling the jet locally (in the NuSTAR + INTEGRAL band) as a power. law, we find that the coronal component is fit by ΓAGN = 1.638 ± 0.045, Ecutoff = 47 ± 15 ke...

IACHEC CROSS-CALIBRATION OF CHANDRA , NuSTAR , SWIFT , SUZAKU , XMM-NEWTON WITH 3C 273 ANDPKS 2155-304

Energy Technology Data Exchange (ETDEWEB)

Madsen, Kristin K.; Forster, Karl [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Beardmore, Andrew P.; Page, Kim L. [X-ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom); Guainazzi, Matteo [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, 3-1-1, Yoshinodai, Sagamihara, Kanagawa, 252-5201 (Japan); Marshall, Herman L.; Miller, Eric D. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Stuhlinger, Martin [European Space Astronomy Centre (ESAC), P.O. Box 78, E-28691 Villanueva de la Caada, Madrid (Spain)

2017-01-01

On behalf of the International Astronomical Consortium for High Energy Calibration, we present results from the cross-calibration campaigns in 2012 on 3C 273 and in 2013 on PKS 2155-304 between the then active X-ray observatories Chandra , NuSTAR , Suzaku , Swift, and XMM-Newton . We compare measured fluxes between instrument pairs in two energy bands, 1–5 keV and 3–7 keV, and calculate an average cross-normalization constant for each energy range. We review known cross-calibration features and provide a series of tables and figures to be used for evaluating cross-normalization constants obtained from other observations with the above mentioned observatories.

The structuring role of fish in Greenland lakes: an overview based on contemporary and paleoecological studies of 87 lakes from the low and the high Arctic

DEFF Research Database (Denmark)

Jeppesen, Erik; Lauridsen, Torben L.; Christoffersen, Kirsten S.

2017-01-01

largest between fishless lakes and lakes hosting only sticklebacks (Gasterosteus aculeatus), while lakes with both Arctic charr (Salvelinus arcticus) and stickleback revealed a more modest response, indicating that presence of charr modulates the predation effect of sticklebacks. It is predicted that more...

A microporous MOF with a polar pore surface exhibiting excellent selective adsorption of CO2 from CO2-N2 and CO2-CH4 gas mixtures with high CO2 loading.

Science.gov (United States)

Pal, Arun; Chand, Santanu; Elahi, Syed Meheboob; Das, Madhab C

2017-11-14

A microporous MOF {[Zn(SDB)(L) 0.5 ]·S} n (IITKGP-5) with a polar pore surface has been constructed by the combination of a V-shaped -SO 2 functionalized organic linker (H 2 SDB = 4,4'-sulfonyldibenzoic acid) with an N-rich spacer (L = 2,5-bis(3-pyridyl)-3,4-diaza-2,4-hexadiene), forming a network with sql(2,6L1) topology. IITKGP-5 is characterized by TGA, PXRD and single crystal X-ray diffraction. The framework exhibits lozenge-shaped channels of an approximate size of 4.2 × 5.6 Å 2 along the crystallographic b axis with a potential solvent accessible volume of 26%. The activated IITKGP-5a revealed a CO 2 uptake capacity of 56.4 and 49 cm 3 g -1 at 273 K/1 atm and 295 K/1 atm, respectively. On the contrary, it takes up a much smaller amount of CH 4 (17 cm 3 g -1 at 273 K and 13.6 cm 3 g -1 at 295 K) and N 2 (5.5 cm 3 g -1 at 273 K; 4 cm 3 g -1 at 295 K) under 1 atm pressure exhibiting its potential for a highly selective adsorption of CO 2 from flue gas as well as a landfill gas mixture. Based on the ideal adsorbed solution theory (IAST), a CO 2 /N 2 selectivity of 435.5 and a CO 2 /CH 4 selectivity of 151.6 have been realized at 273 K/100 kPa. The values at 295 K are 147.8 for CO 2 /N 2 and 23.8 for CO 2 /CH 4 gas mixtures under 100 kPa. In addition, this MOF nearly approaches the target values proposed for PSA and TSA processes for practical utility exhibiting its prospect for flue gas separation with a CO 2 loading capacity of 2.04 mmol g -1 .

Association among retinol-binding protein 4, small dense LDL cholesterol and oxidized LDL levels in dyslipidemia subjects.

Science.gov (United States)

Wu, Jia; Shi, Yong-hui; Niu, Dong-mei; Li, Han-qing; Zhang, Chun-ni; Wang, Jun-jun

2012-06-01

To investigate retinol-binding protein 4 (RBP4), small dense low-density lipoprotein cholesterol (sdLDL-C) and oxidized low-density lipoprotein (ox-LDL) levels and their associations in dyslipidemia subjects. We determined RBP4, sdLDL-C, ox-LDL levels in 150 various dyslipidemia subjects and 50 controls. The correlation analysis and multiple linear regression analysis were performed. The RBP4, sdLDL-C and ox-LDL levels were found increased in various dyslipidemia subjects. The sdLDL-C levels were positively correlated with RBP4 (r=0.273, P=0.001) and ox-LDL (r=0.273, P=0.001). RBP4 levels were also correlated with ox-LDL (r=0.167, P=0.043). The multiple regression analysis showed that only sdLDL-C was a significant independent predictor for RBP4 (β coefficient=0.219, P=0.009; adjusted R(2)=0.041) and ox-LDL (β coefficient=0.253, P=0.003; adjusted R(2)=0.057) levels, respectively. The independent associations of sdLDL-C with RBP4 and ox-LDL were observed in dyslipidemia subjects. RBP4 may play an important role in lipid metabolism of atherosclerosis, particularly in formation of sdLDL. Copyright © 2012 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

Genome-scale data suggest reclassifications in the Leisingera-Phaeobacter cluster including proposals for Sedimentitalea gen. nov. and Pseudophaeobacter gen. nov.

Directory of Open Access Journals (Sweden)

Sven eBreider

2014-08-01

Full Text Available Earlier phylogenetic analyses of the marine Rhodobacteraceae (class Alphaproteobacteria genera Leisingera and Phaeobacter indicated that neither genus might be monophyletic. We here used phylogenetic reconstruction from genome-scale data, MALDI-TOF mass-spectrometry analysis and a re-assessment of the phenotypic data from the literature to settle this matter, aiming at a reclassification of the two genera. Neither Phaeobacter nor Leisingera formed a clade in any of the phylogenetic analyses conducted. Rather, smaller monophyletic assemblages emerged, which were phenotypically more homogeneous, too. We thus propose the reclassification of Leisingera nanhaiensis as the type species of a new genus as Sedimentitalea nanhaiensis gen. nov., comb. nov., the reclassification of Phaeobacter arcticus and Phaeobacter leonis as Pseudophaeobacter arcticus gen. nov., comb. nov. and Pseudophaeobacter leonis comb. nov., and the reclassification of Phaeobacter aquaemixtae, Phaeobacter caeruleus and Phaeobacter daeponensis as Leisingera aquaemixtae comb. nov., Leisingera caerulea comb. nov. and Leisingera daeponensis comb. nov. The genera Phaeobacter and Leisingera are accordingly emended.

An environmental DNA assay for detecting Arctic grayling in the upper Missouri River basin, North America

Science.gov (United States)

K. J. Carim; J. C. S. Dysthe; Michael Young; Kevin McKelvey; Michael Schwartz

2016-01-01

The upper Missouri River basin in the northwestern US contains disjunct Arctic grayling (Thymallus arcticus) populations of conservation concern. To assist efforts aimed at understanding Artic grayling distribution, we developed a quantitative PCR assay to detect the presence of Arctic grayling DNA in environmental samples. The assay amplified low...

The role of wildfire, prescribed fire, and mountain pine beetle infestations on the population dynamics of black-backed woodpeckers in the Black Hills, South Dakota

Science.gov (United States)

Christopher T. Rota; Joshua J. Millspaugh; Mark A. Rumble; Chad P. Lehman; Dylan C. Kesler

2014-01-01

Wildfire and mountain pine beetle infestations are naturally occurring disturbances in western North American forests. Black-backed woodpeckers (Picoides arcticus) are emblematic of the role these disturbances play in creating wildlife habitat, since they are strongly associated with recently-killed forests. However, management practices aimed at reducing the economic...

FERMI-LARGE AREA TELESCOPE OBSERVATIONS OF THE EXCEPTIONAL GAMMA-RAY OUTBURSTS OF 3C 273 IN 2009 SEPTEMBER

International Nuclear Information System (INIS)

Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

2010-01-01

We present the light curves and spectral data of two exceptionally luminous gamma-ray outbursts observed by the Large Area Telescope experiment on board the Fermi Gamma-ray Space Telescope from 3C 273 in 2009 September. During these flares, having a duration of a few days, the source reached its highest γ-ray flux ever measured. This allowed us to study, in some details, their spectral and temporal structures. The rise and the decay are asymmetric on timescales of 6 hr, and the spectral index was significantly harder during the flares than during the preceding 11 months. We also found that short, very intense flares put out the same time-integrated energy as long, less intense flares like that observed in 2009 August.

Inter-individual variation in nucleotide excision repair pathway is modulated by non-synonymous polymorphisms in ERCC4 and MBD4 genes

Energy Technology Data Exchange (ETDEWEB)

Allione, Alessandra, E-mail: alessandra.allione@hugef-torino.org [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Guarrera, Simonetta; Russo, Alessia [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Ricceri, Fulvio [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Department of Medical Sciences, University of Turin, Via Santena 19, 10126 Turin (Italy); Purohit, Rituraj [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Bioinformatics Division, School of Bio Sciences and Technology, Vellore Institute of Technology University, Vellore 632014, Tamil Nadu (India); Pagnani, Andrea; Rosa, Fabio; Polidoro, Silvia; Voglino, Floriana [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Matullo, Giuseppe [Human Genetics Foundation (HuGeF), Via Nizza 52, 10126 Turin (Italy); Department of Medical Sciences, University of Turin, Via Santena 19, 10126 Turin (Italy)

2013-11-15

Highlights: • We reported a large inter-individual variability of NER capacity. • ERCC4 rs1800124 and MBD4 rs10342 nsSNP variants were associated with DNA repair capacity. • DNA–protein interaction analyses showed alteration of binding for ERCC4 and MBD4 variants. • A new possible cross-talk between NER and BER pathways has been reported. - Abstract: Inter-individual differences in DNA repair capacity (DRC) may lead to genome instability and, consequently, modulate individual cancer risk. Among the different DNA repair pathways, nucleotide excision repair (NER) is one of the most versatile, as it can eliminate a wide range of helix-distorting DNA lesions caused by ultraviolet light irradiation and chemical mutagens. We performed a genotype–phenotype correlation study in 122 healthy subjects in order to assess if any associations exist between phenotypic profiles of NER and DNA repair gene single nucleotide polymorphisms (SNPs). Individuals were genotyped for 768 SNPs with a custom Illumina Golden Gate Assay, and peripheral blood mononuclear cells (PBMCs) of the same subjects were tested for a NER comet assay to measure DRC after challenging cells by benzo(a)pyrene diolepoxide (BPDE). We observed a large inter-individual variability of NER capacity, with women showing a statistically significant lower DRC (mean ± SD: 6.68 ± 4.76; p = 0.004) than men (mean ± SD: 8.89 ± 5.20). Moreover, DRC was significantly lower in individuals carrying a variant allele for the ERCC4 rs1800124 non-synonymous SNP (nsSNP) (p = 0.006) and significantly higher in subjects with the variant allele of MBD4 rs2005618 SNP (p = 0.008), in linkage disequilibrium (r{sup 2} = 0.908) with rs10342 nsSNP. Traditional in silico docking approaches on protein–DNA and protein–protein interaction showed that Gly875 variant in ERCC4 (rs1800124) decreases the DNA–protein interaction and that Ser273 and Thr273 variants in MBD4 (rs10342) indicate complete loss of protein�

Global patterns of marine bacterioplankton diversity and characterisation of bioactive Vibrionaceae isolates

DEFF Research Database (Denmark)

Wietz, Matthias

from P. halotolerans and a novel siderophore-like compound from V. nigripulchritudo were isolated. All three compounds interfere with quorum sensing in S. aureus. During LOMROG-II further seventeen strains with antagonistic activity were isolated, affiliating with the Actinobacteria (8 strains......), Pseudoalteromonas (4 strains), the Vibrionaceae (3 strains), and Psychrobacter (2 strains). Seven of the eight bioactive Actinobacteria, being isolated from different sources throughout the Arctic Ocean, were related to Arthrobacter davidanieli. Its broad antibiotic spectrum was likely based on production...... demonstrated that marine Vibrionaceae and polar Actinobacteria are a resource of antibacterial compounds and may have potential for future natural product discovery....

Detection probabilities of woodpecker nests in mixed conifer forests in Oregon

Science.gov (United States)

Robin E. Russell; Victoria A. Saab; Jay J. Rotella; Jonathan G. Dudley

2009-01-01

Accurate estimates of Black-backed (Picoides arcticus) and Hairy Woodpecker (P. villosus) nests and nest survival rates in post-fire landscapes provide land managers with information on the relative importance of burned forests to nesting woodpeckers. We conducted multiple-observer surveys in burned and unburned mixed coniferous forests in Oregon to identify important...

Do male and female black-backed woodpeckers respond differently to gaps in habitat?

Science.gov (United States)

Jennifer Pierson; Fred W. Allendorf; Vicki Saab; Pierre Drapeau; Michael K. Schwartz

2010-01-01

We used population- and individual-based genetic approaches to assess barriers to movement in black-backed woodpeckers (Picoides arcticus), a fire-specialist that mainly occupies the boreal forest in North America. We tested if male and female woodpeckers exhibited the same movement patterns using both spatially implicit and explicit genetic analyses to define...

Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

Science.gov (United States)

Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

2018-05-24

Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

Tritellurides of comples cations: Synthesis and crystal structure of (Ba(en)/sub 3/)Te/sub 3/ and (Ba(en)/sub 4,5/)Te/sub 3/

Energy Technology Data Exchange (ETDEWEB)

Zagler, R; Eisenmann, B; Schaefer, H

1987-02-01

The two title compounds have been prepared by reaction of appropriate mixtures of the elements in ethylenediamine. The structures have been determined on the basis of single crystal data. (Ba(en)/sub 3/Te/sub 3/ crystallizes in the monoclinic system, space group P2/sub 1/c with a = 918.0(4), b = 1203.7(6), c = 1639,9(6) pm, ..beta.. = 93.4(1)/sup 0/. In the structure there are bent tritelluride anions Te/sub 3//sup 2 -/ (bond lengths 273,9-278,5 pm, bond angle (105.7/sup 0/). The Ba/sup 2 +/ cations are six coordinate by the bidentate ligand ethylenediamine. (Ba(en)/sub 4,5/)Te/sub 3/ crystallizes in the monoclinic system, space group Cc with a = 1752.8(6), b = 938.9(4), c = 3041.7(8) pm, ..beta.. = 91.3(1)/sup 0/. In this structure the bond lengths in the TE/sub 3//sup 2 -/ anions are shorter (272.1-273.1 pm, bond angles 110.9-112.2/sup 0/). The cations are coordinated by four bidentate ligands, and are connected into pairs by a further ethylenediamine molecule. The resulting dinuclear (Ba(en)/sub 4/)en(Ba(en)/sub 4/)/sup 4 +/ units have the Ba/sup 2 +/ cations in CN 9.

48 CFR 812.301 - Solicitation provisions and contract clauses for the acquisition of commercial items.

Science.gov (United States)

2010-10-01

....216-70, Estimated quantities. (15) 852.228-71, Indemnification and insurance. (16) 852.229-70, Sales...) 852.273-71, Alternative negotiation techniques. (3) 852.273-72, Alternative evaluation. (4) 852.273-73...

Image of the Quasar 3C 273 Taken by the High Energy Astronomy Observatory (HEAO)-2

Science.gov (United States)

1979-01-01

This image is an observation of Quasar 3C 273 by the High Energy Astronomy Observatory (HEAO)-2/Einstein Observatory. It reveals the presence of a new source (upper left) with a red shift that indicates that it is about 10 billion light years away. Quasars are mysterious, bright, star-like objects apparently located at the very edge of the visible universe. Although no bigger than our solar system, they radiate as much visible light as a thousand galaxies. Quasars also emit radio signals and were previously recognized as x-ray sources. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2 was designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center.

Trophic ecology of deep-sea Asteroidea (Echinodermata) from eastern Canada

Science.gov (United States)

Gale, Katie S. P.; Hamel, Jean-François; Mercier, Annie

2013-10-01

Asteroids (sea stars) can be important predators in benthic communities and are often present in ecologically important and vulnerable deep-sea coral and sponge habitats. However, explicit studies on the trophic ecology of deep-sea asteroids are rare. We investigated the diets of seven species of deep-sea asteroid from the bathyal zone of Newfoundland and Labrador, eastern Canada. A multifaceted approach including live animal observations, stomach content analysis, and stable isotope analysis revealed the asteroids to be either top predators of megafauna or secondary consumers (mud ingesters, infaunal predators, and suspension feeders). The stable isotope signatures of Ceramaster granularis, Hippasteria phrygiana, and Mediaster bairdi are characteristic of high-level predators, having δ15N values 4.4‰ (more than one trophic level) above Ctenodiscus crispatus, Leptychaster arcticus, Novodinia americana, and Zoroaster fulgens. We present strong evidence that corals and sponges are common food items for two of the predatory species, C. granularis and H. phrygiana. During laboratory feeding trials, live H. phrygiana fed on several species of soft coral and C. granularis fed on sponges. Stomach content analysis of wild-caught individuals revealed sclerites from sea pens (e.g. Pennatula sp.) in the stomachs of both asteroid species; H. phrygiana also contained sclerites from at least two other species of octocoral and siliceous sponge spicules were present in the stomachs of C. granularis. The stomach contents of the secondary consumers contained a range of invertebrate material. Leptychaster arcticus and Ctenodiscus crispatus feed infaunally on bulk sediment and molluscs, Zoroaster fulgens is a generalist infaunal predator, and the brisingid Novodinia americana is a specialist suspension feeder on benthopelagic crustaceans. This study provides a foundation for understanding the ecological roles of bathyal asteroids, and suggests that some species may have the

Partial molar volumes of (acetonitrile + water) mixtures over the temperature range (273.15 to 318.15) K

International Nuclear Information System (INIS)

Yeow, Y. Leong; Leong, Yee-Kwong

2007-01-01

Isothermal molar volume data of (acetonitrile + water) mixtures, between T = 273.15 K and T = 318.15 K, extracted from different sources are combined and treated as a single set to even out minor differences between sources and to increase the number of data points for each temperature. Tikhonov regularization is applied to compute the isothermal first and second derivatives of these data with respect to molar composition. For the reference temperature of 298.15 K, this computation is extended to the third derivative. Generalized Cross Validation is used to guide the selection of the regularization parameter that keeps noise amplification under control. The resulting first derivatives are used to construct the partial molar volume curves which are then checked against published results. Properties of the partial molar volumes are analysed by examining their derivatives. Finally the general shape of the second derivative curve of molar volume is explained qualitatively in terms of tripartite segmentation of the molar composition interval but quantitative comparisons are required to confirm this explanation

Phase equilibrium measurements and thermodynamic modeling of aqueous solutions of polyamines CO_2 absorbents: 3-aminopropylmethylamine, 3-aminopropyldimethylamine and N,N-diethyl 1,3-propanediamine at temperatures from 273 K to 363 K

International Nuclear Information System (INIS)

Bouzina, Zahida; Mokbel, Ilham; Negadi, Amina; Jose, Jacques; Negadi, Latifa

2016-01-01

Highlights: • Experimental vapor pressures of pure MAPA, DMAPA, DEAPA and their aqueous solutions are reported. • The investigated temperatures are 273 K through 363 K. • The MAPA binary system exhibits negative deviations in G"E values. • The DMAPA and DEAPA systems exhibit negative, sinusoidal and positive deviations in G"E values. • The 3rd order Redlich–Kister, and NRTL or UNIQUAC models have been used to correlate the (P-x-y) data. - Abstract: The vapor pressures of the pure components 3-aminopropylmethylamine (MAPA), 3-aminopropyldimethylamine (DMAPA) and N,N-diethyl 1,3-propanediamine (DEAPA) along with the binary mixtures (MAPA + water), (DMAPA + water) and (DEAPA + water) were measured by means of a static apparatus at temperatures between (273 and 363) K. The data were correlated with the Antoine equation. From these data, excess Gibbs functions (G"E) were calculated for several constant temperatures, and fitted to a three parameters Redlich–Kister equation using the Barker’s method. Additionally, the NRTL and UNIQUAC models have been used for the correlation of the total pressure.

Probing the innermost regions of AGN jets and their magnetic fields with RadioAstron. II. Observations of 3C 273 at minimum activity

Science.gov (United States)

Bruni, G.; Gómez, J. L.; Casadio, C.; Lobanov, A.; Kovalev, Y. Y.; Sokolovsky, K. V.; Lisakov, M. M.; Bach, U.; Marscher, A.; Jorstad, S.; Anderson, J. M.; Krichbaum, T. P.; Savolainen, T.; Vega-García, L.; Fuentes, A.; Zensus, J. A.; Alberdi, A.; Lee, S.-S.; Lu, R.-S.; Pérez-Torres, M.; Ros, E.

2017-08-01

Context. RadioAstron is a 10 m orbiting radio telescope mounted on the Spektr-R satellite, launched in 2011, performing Space Very Long Baseline Interferometry (SVLBI) observations supported by a global ground array of radio telescopes. With an apogee of 350 000 km, it is offering for the first time the possibility to perform μas-resolution imaging in the cm-band. Aims: The RadioAstron active galactic nuclei (AGN) polarization Key Science Project (KSP) aims at exploiting the unprecedented angular resolution provided by RadioAstron to study jet launching/collimation and magnetic-field configuration in AGN jets. The targets of our KSP are some of the most powerful blazars in the sky. Methods: We present observations at 22 GHz of 3C 273, performed in 2014, designed to reach a maximum baseline of approximately nine Earth diameters. Reaching an angular resolution of 0.3 mas, we study a particularly low-activity state of the source, and estimate the nuclear region brightness temperature, comparing with the extreme one detected one year before during the RadioAstron early science period. We also make use of the VLBA-BU-BLAZAR survey data, at 43 GHz, to study the kinematics of the jet in a 1.5-yr time window. Results: We find that the nuclear brightness temperature is two orders of magnitude lower than the exceptionally high value detected in 2013 with RadioAstron at the same frequency (1.4 × 1013 K, source-frame), and even one order of magnitude lower than the equipartition value. The kinematics analysis at 43 GHz shows that a new component was ejected 2 months after the 2013 epoch, visible also in our 22 GHz map presented here. Consequently this was located upstream of the core during the brightness temperature peak. Fermi-LAT observations for the period 2010-2014 do not show any γ-ray flare in conjunction with the passage of the new component by the core at 43 GHz. Conclusions: These observations confirm that the previously detected extreme brightness temperature in

CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

Energy Technology Data Exchange (ETDEWEB)

Hill, K.D.; Steele, A.G. [National Research Council of Canada, Institute for National Measurement Standards, Ottawa, ON (Canada); Dedikov, Y.A.; Shkraba, V.T. [Institute for Physical-Technical and Radiotechnical Measurements (VNIIFTRI), Moscow (Russian Federation)

2005-04-01

The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 {omega} capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L and N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. (authors)

Characterization of the intestinal microbiota of wild-caught and farmed fine flounder (Paralichthys adspersus)

OpenAIRE

Salas-Leiva, Joan; Opazo, Rafael; Remond, Camille; Uribe, Eduardo; Velez, Antonio; Romero, Jaime

2017-01-01

A comparative analysis of the cultivable intestinal microbiota of farmed (AF) and wild-caught (WF) Paralichthys adspersus was performed. The 16S rRNA gene was used for taxa identification, and the ITS region for strain differentiation. We detected the presence of Vibrio, Bacillus, Photobacterium, Staphylococcus and Carnobacterium in AF, and Exiguobacterium, Klebsiella, Arthrobacter, Raoultella, Kluyvera, Myroides, Streptococcus, Vagococcus, Staphylococcus, Acinetobacter, Psychrobacter, Lactob...

33 CFR 273.12 - References.

Science.gov (United States)

2010-07-01

... pesticide chemicals, 2,4-D, subpart C (F) 16 December 1975. (d) Pub. L. 91-596, Occupational Safety and Health Act of 1970, (84 Stat. 1609, 29 U.S.C. 668), 29 December 1970. (e) 29 CFR 1960, Safety and Health... Management System.” (h) ER 1105-2-507, “Preparation and Coordination of Environmental Statements.” (33 CFR...

Recurrent Microdeletions at Xq27.3-Xq28 and Male Infertility: A Study in the Czech Population.

Directory of Open Access Journals (Sweden)

Blanka Chylíková

Full Text Available Genetic causes of male infertility are hypothesized to involve multiple types of mutations, from single gene defects to complex chromosome rearrangements. Recently, several recurrent X-chromosome microdeletions (located in subtelomeric region of the long arm were reported to be associated with male infertility in Spanish and Italian males. The aim of our study was to test their prevalence and infertility association in population of men from the Czech Republic.107 males with pathological sperm evaluation resulting in nonobstructive infertility were compared to 131 males with normal fecundity. X-chromosome microdeletions were assessed by +/- PCR with three primer pairs for each region Xcnv64 (Xq27.3, Xcnv67 (Xq28 and Xcnv69 (Xq28. The latter microdeletion was further characterized by amplification across the deleted region, dividing the deletion into three types; A, B and C.We detected presence of isolated Xcnv64 deletion in 3 patients and 14 controls, and Xcnv69 in 3 patients and 6 controls (1 and 1 patient vs.4 and 1 control for types A and B respectively. There was one control with combined Xcnv64 and Xcnv69 type B deletions, and one patient with combination of Xcnv64 and Xcnv69 type C deletions. The frequency of the deletions was thus not higher in patient compared to control group, Xcnv64 was marginally associated with controls (adjusted Fisher´s exact test P = 0.043, Xcnv69 was not associated (P = 0.452. We excluded presence of more extensive rearrangements in two subjects with combined Xcnv64 and Xcnv69 deletions. There was no Xcnv67 deletion in our cohort.In conclusion, the two previously reported X-linked microdeletions (Xcnv64 and Xcnv69 do not seem to confer a significant risk to impaired spermatogenesis in the Czech population. The potential clinical role of the previously reported patient-specific Xcnv67 remains to be determined in a larger study population.

Results of the independent verification of radiological remedial action at 273 East 1st South Street, Monticello, Utah (MS00092)

International Nuclear Information System (INIS)

Crutcher, J.W.; Smuin, M.W.

1989-12-01

In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1984 and 1985, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 273 East 1st South Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

Bacterial communities in ancient permafrost profiles of Svalbard, Arctic.

Science.gov (United States)

Singh, Purnima; Singh, Shiv M; Singh, Ram N; Naik, Simantini; Roy, Utpal; Srivastava, Alok; Bölter, Manfred

2017-12-01

Permafrost soils are unique habitats in polar environment and are of great ecological relevance. The present study focuses on the characterization of bacterial communities from permafrost profiles of Svalbard, Arctic. Counts of culturable bacteria range from 1.50 × 10 3 to 2.22 × 10 5 CFU g -1 , total bacterial numbers range from 1.14 × 10 5 to 5.52 × 10 5 cells g -1 soil. Bacterial isolates are identified through 16S rRNA gene sequencing. Arthrobacter and Pseudomonas are the most dominant genera, and A. sulfonivorans, A. bergeri, P. mandelii, and P. jessenii as the dominant species. Other species belong to genera Acinetobacter, Bacillus, Enterobacter, Nesterenkonia, Psychrobacter, Rhizobium, Rhodococcus, Sphingobacterium, Sphingopyxis, Stenotrophomonas, and Virgibacillus. To the best of our knowledge, genera Acinetobacter, Enterobacter, Nesterenkonia, Psychrobacter, Rhizobium, Sphingobacterium, Sphingopyxis, Stenotrophomonas, and Virgibacillus are the first northernmost records from Arctic permafrost. The present study fills the knowledge gap of culturable bacterial communities and their chronological characterization from permafrost soils of Ny-Ålesund (79°N), Arctic. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Characterization of the dominant bacterial communities during storage of Norway lobster and Norway lobster tails (Nephrops norvegicus) based on 16S rDNA analysis by PCR-DGGE.

Science.gov (United States)

Bekaert, Karen; Devriese, Lisa; Maes, Sara; Robbens, Johan

2015-04-01

The aim of this study was to investigate the microbial quality of whole Norway lobster (Nephrops norvegicus) and Norway lobster tails to optimize handling conditions. This was done by assessing the total viable count (TVC) and characterizing the dominant microbiota. The cultivable microorganisms were quantified via classical microbiological plating methods. To characterize as many bacterial species present as possible, we performed advanced molecular identification techniques (PCR-DGGE). The initial TVC of fresh Norway lobster meat was high (3.0 log cfu/g) as compared to fish. No significant difference between whole Norway lobster and Norway lobster tails could be found during the storage period. From day 6 of storage, a significant difference between Plate Count Agar (PCA) and Marine Agar (MA) was observed. The microbiota of Norway lobster was dominated by members of the Gram-negative genera such as Psychrobacter spp., Pseudoalteromonas spp., Pseudomonas spp., Luteimonas spp., and Aliivibrio spp. From these bacteria, mainly Psychrobacter spp. and Pseudomonas spp. remained present until the end of the storage period. These are known spoilage organisms in fishery products. Other known spoilage organisms of crustaceans such as Photobacterium spp. could not be identified. Copyright © 2014 Elsevier Ltd. All rights reserved.

L’art. 27 ultimo capoverso del Concordato lateranense e la sua applicazione al Santuario della B. Vergine delle Grazie in Brescia

Directory of Open Access Journals (Sweden)

Maria Vismara Missiroli

2012-02-01

Full Text Available SOMMARIO: 1. Problemi interpretativi dell’art. 27.3 del Concordato Lateranense - 2. L'Istruzione della Congregazione del Concilio del 1930. - 3. La qualificazione di una chiesa come Santuario - 4. Requisiti per l’applicazione ai santuari dell’art. 27.3 - 4.1. Amministrazione civile - 4.2. Personalità giuridica - 5. La questione dei santuari di proprietà di persone fisiche o giuridiche - 6. Il Santuario della Beata Vergine delle Grazie di Brescia. Brevi cenni storici - 7. L’applicazione dell’art. 27.3 del Concordato lateranense al Santuario di S. Maria delle Grazie - 8. Conclusione.

Synthesis, characterization, mucoadhesion and biocompatibility of thiolated carboxymethyl dextran-cysteine conjugate.

Science.gov (United States)

Shahnaz, G; Perera, G; Sakloetsakun, D; Rahmat, D; Bernkop-Schnürch, A

2010-05-21

This study was aimed at improving the mucoadhesive properties of carboxymethyl dextran by the covalent attachment of cysteine. Mediated by a carbodiimide, l-cysteine was covalently attached to the polymer. The resulting CMD-cysteine conjugate (CMD-(273) conjugate) displayed 273+/-20 micromol thiol groups per gram of polymer (mean+/-S.D.; n=3). Within 2h the viscosity of an aqueous mucus/CMD-(273) conjugate mixture pH 7.4 increased at 37 degrees C by more than 85% compared to a mucus/carboxymethyl dextran mixture indicating enlarged interactions between the mucus and the thiolated polymer. Due to the immobilization of cysteine, the swelling velocity of the polymer was significantly accelerated (ppolymer disintegrated within 15 min, whereas tablets of the CMD-(273) conjugate remained stable for 160 min (means+/-S.D.; n=3). Results from LDH and MTT assays on Caco-2 cells revealed 4.96+/-0.98% cytotoxicity and 94.1+/-0.9% cell viability for the CMD-(273) conjugate, respectively. Controlled release of model compound from CMD-(273) conjugate tablets was observed over 6h. These findings suggest that CMD-(273) conjugate is a promising novel polymer for drug delivery systems providing improved mucoadhesive and cohesive properties, greater stability and biocompatibility. Copyright 2010 Elsevier B.V. All rights reserved.

Electrical resistivity anisotropy of osmium single crystals in the range 4,2 to 300 K

International Nuclear Information System (INIS)

Volkenshtejn, N.V.; Dyakina, V.P.; Dyakin, V.V.; Startsev, V.E.; Cherepanov, V.I.; Azhazha, V.M.; Kovtun, G.P.; Elenskij, V.A.; AN Ukrainskoj SSR, Kharkov. Fiziko-Tekhnicheskij Inst.)

1981-01-01

Electrical resistivity and size effect anisotropies of pure osmium single crystals with rhosub(273.2/rhosub(4.2)2600 were investigated in the temperature range 4.2 to 300 K. It is found that the electrical resistivity anisotropy (αT)=rhosub( )/rhosub( ) is less than unit and has a maximum at T approximately 50 K; the size effect anisotropy (rho1)sub( )/(rho1)sub( ) is 0.39+-0.07 at T=4.2 K; at liquid helium temperature, the dependence of thin samples is controlled by the scattering of conduction electrons by the surface of the sample. The results are discussed for the specific shape of the Fermi surface geometry of osmium with an account for the scattering processes of conduction electrons by phonons and by surface of the sample

Transesterification of waste cooking oil by an organic solvent-tolerant alkaline lipase from Streptomyces sp. CS273.

Science.gov (United States)

Mander, Poonam; Yoo, Hah-Young; Kim, Seung Wook; Choi, Yun Hee; Cho, Seung Sik; Yoo, Jin Cheol

2014-02-01

The aim of this present study was to produce a microbial enzyme that can potentially be utilized for the enzymatic transesterification of waste cooking oil. To that end, an extracellular lipase was isolated and purified from the culture broth of Streptomyces sp. CS273. The molecular mass of purified lipase was estimated to be 36.55 kDa by SDS PAGE. The optimum lipolytic activity was obtained at alkaline pH 8.0 to 8.5 and temperature 40 °C, while the enzyme was stable in the pH range 7.0 ∼ 9.0 and at temperature ≤40 °C. The lipase showed highest hydrolytic activity towards p-nitrophenyl myristate (C14). The lipase activity was enhanced by several salts and detergents including NaCl, MnSo₄, and deoxy cholic acid, while phenylmethylsulfonyl fluoride at concentration 10 mM inhibited the activity. The lipase showed tolerance towards different organic solvents including ethanol and methanol which are commonly used in transesterification reactions to displace alcohol from triglycerides (ester) contained in renewable resources to yield fatty acid alkyl esters known as biodiesel. Applicability of the lipase in transesterification of waste cooking oil was confirmed by gas chromatography mass spectrometry analysis.

Faecal bacterial composition in dairy cows shedding Mycobacterium avium subsp. paratuberculosis in faeces in comparison with nonshedding cows.

Science.gov (United States)

Kaevska, Marija; Videnska, Petra; Sedlar, Karel; Bartejsova, Iva; Kralova, Alena; Slana, Iva

2016-06-01

The aim of this study was to determine possible differences in the faecal microbiota of dairy cows infected with Mycobacterium avium subsp. paratuberculosis (Johne's disease) in comparison with noninfected cows from the same herds. Faecal samples from cows in 4 herds were tested for M. avium subsp. paratuberculosis by real-time PCR, and faecal bacterial populations were analysed by 454 pyrosequencing of the 16S rRNA gene. The most notable differences between shedding and nonshedding cows were an increase in the genus Psychrobacter and a decrease in the genera Oscillospira, Ruminococcus, and Bifidobacterium in cows infected with M. avium subsp. paratuberculosis. The present study is the first to report the faecal microbial composition in dairy cows infected with M. avium subsp. paratuberculosis.

Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 1997

International Nuclear Information System (INIS)

1999-01-01

Los Alamos National Laboratory (the Laboratory) is subject to emissions reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73, (20 NMAC 2.73), Notice of Intent and Emissions Inventory Requirements. The Laboratory has the potential to emit 100 tons per year of suspended particulate matter (PM), nitrogen oxides (NO x ), carbon monoxide (CO), and volatile organic compounds (VOCs). For 1997, combustion products from the industrial sources contributed the greatest amount of regulated air emissions from the Laboratory. Research and development activities contributed the greatest amount of VOCs. Emissions of beryllium and aluminum were reported for activities permitted under 20 NMAC 2.72, Construction Permits

Vom work Book Journal 2011, 2010 4th Edition PDF

African Journals Online (AJOL)

USER

affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.

South African Journal of Animal Science - Vol 34, No 4 (2004)

African Journals Online (AJOL)

A genetic analysis of epistaxis as associated with EIPH in the Southern African Thoroughbred · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Weideman, SJ Schoeman, GF Jordaan, 265-273 ...

Thermodynamic activity of saturated solutions of CsClO4 in ethylene glycol and its analogs of the HOCH2(CH2CH2O)nCH2OH series

International Nuclear Information System (INIS)

Krasnoperova, A.P.; Ivanova, E.F.; Kijko, S.M.; Yukhno, G.D.

1997-01-01

Solubility of CsClO 4 in ethylene glycol, diethylene glycol, triethylene glycol, tetraethylene glycol, polyethylene glycols with molar mass 300 and 400 in the temperature range of 273.15-318.15 K has been ascertained by the method of radioactive indicators. Dependence of saturated solutions activity on temperature, dielectric permittivity and the number of (CH 2 CH 2 O) ether groups in glycols is discussed

VITAMIN AND THYROID STATUS IN ARCTIC GRAYLING (THYMALLUS ARCTICUS) EXPOSED TO DOSES OF 3, 3', 4, 4'-TETRACHLOROBIPHENYL THAT INDUCE THE PHASE I ENZYME SYSTEM

Science.gov (United States)

Induction of phase I biotransformation enzymes is recognized as a hallmark response in fish exposed to coplanar PCBs. Depletions of vitamins A and E and disrupted thyroid hormone and glandular structure secondary to this induction have not yet been examined in an arctic fish spec...

East African Medical Journal - Vol 94, No 4 (2017)

African Journals Online (AJOL)

Sero prevalence of hepatitis B and C viruses among HIV infected patients in a HIV care program in Kenya: a cross sectional study · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S.B. Okoth, O.F. Rehmani, M.J. Karoney, L Diero, P.O. Ayuo, 266-273 ...

Comparative baseline levels of mercury, Hsp 70 and Hsp 60 in subsistence fish from the Yukon-Kuskokwim delta region of Alaska.

Science.gov (United States)

Duffy, L K; Scofield, E; Rodgers, T; Patton, M; Bowyer, R T

1999-10-01

In subsistence fish; northern pike (Esox lucius), burbot (Lota lota), whitefish (Coregonus nelsoni), grayling (Thymallus arcticus) and sheefish (Stenodus lencichthys), we determined the Hsp 60 and Hsp 70 levels in 31 samples from adult fish gills. A dot-blot analysis using antibodies to either Hsp 70 or Hsp 60 showed the average Hsp 70 concentration was 9.1 microg/mg protein, while the average Hsp 60 concentration was 147.4 microg/mg protein. Mercury levels in muscle tissue in these fish averaged 0.382 ppm. Using a subset of samples (n = 24), we determined that the major component in the muscle of Alaskan subsistence fish was methyl mercury. No correlation was observed between Hsp 60 or Hsp 70 expression in gill tissue and mercury concentrations in muscle tissue. Hsp 60 and Hsp 70 protein levels in the gills were correlated.

Benzothiadiazole affects the leaf proteome in arctic bramble (Rubus arcticus).

Science.gov (United States)

Hukkanen, Anne; Kokko, Harri; Buchala, Antony; Häyrinen, Jukka; Kärenlampi, Sirpa

2008-11-01

Benzothiadiazole (BTH) induces resistance to the downy mildew pathogen, Peronospora sparsa, in arctic bramble, but the basis for the BTH-induced resistance is unknown. Arctic bramble cv. Mespi was treated with BTH to study the changes in leaf proteome and to identify proteins with a putative role in disease resistance. First, BTH induced strong expression of one PR-1 protein isoform, which was also induced by salicylic acid (SA). The PR-1 was responsive to BTH and exogenous SA despite a high endogenous SA content (20-25 microg/g fresh weight), which increased to an even higher level after treatment with BTH. Secondly, a total of 792 protein spots were detected in two-dimensional gel electrophoresis, eight proteins being detected solely in the BTH-treated plants. BTH caused up- or down-regulation of 72 and 31 proteins, respectively, of which 18 were tentatively identified by mass spectrometry. The up-regulation of flavanone-3-hydroxylase, alanine aminotransferase, 1-aminocyclopropane-1-carboxylate oxidase, PR-1 and PR-10 proteins may partly explain the BTH-induced resistance against P. sparsa. Other proteins with changes in intensity appear to be involved in, for example, energy metabolism and protein processing. The decline in ATP synthase, triosephosphate isomerase, fructose bisphosphate aldolase and glutamine synthetase suggests that BTH causes significant changes in primary metabolism, which provides one possible explanation for the decreased vegetative growth of foliage and rhizome observed in BTH-treated plants.

Thermodynamics of R-(+)-2-(4-Hydroxyphenoxy)propanoic Acid Dissolution in Methanol, Ethanol, and Methanol-Ethanol Mixture

Science.gov (United States)

Liu, Wei; Ma, Jinju; Yao, Xinding; Fang, Ruina; Cheng, Liang

2018-05-01

The solubilities of R-(+)-2-(4-hydroxyphenoxy)propanoic acid (D-HPPA) in methanol, ethanol and various methanol-ethanol mixtures are determined in the temperature range from 273.15 to 323.15 K at atmospheric pressure using a laser detecting system. The solubilities of D-HPPA increase with increasing mole fraction of ethanol in the methanol-ethanol mixtures. Experimental data were correlated with Buchowski-Ksiazczak λ h equation and modified Apelblat equation; the first one gives better approximation for the experimental results. The enthalpy, entropy and Gibbs free energy of D-HPPA dissolution in methanol, ethanol and methanol-ethanol mixtures were also calculated from the solubility data.

Thermodynamic calculations in the system CH4-H2O and methane hydrate phase equilibria

Science.gov (United States)

Circone, S.; Kirby, S.H.; Stern, L.A.

2006-01-01

Using the Gibbs function of reaction, equilibrium pressure, temperature conditions for the formation of methane clathrate hydrate have been calculated from the thermodynamic properties of phases in the system CH4-H 2O. The thermodynamic model accurately reproduces the published phase-equilibria data to within ??2 K of the observed equilibrium boundaries in the range 0.08-117 MPa and 190-307 K. The model also provides an estimate of the third-law entropy of methane hydrate at 273.15 K, 0.1 MPa of 56.2 J mol-1 K-1 for 1/n CH4??H 2O, where n is the hydrate number. Agreement between the calculated and published phase-equilibria data is optimized when the hydrate composition is fixed and independent of the pressure and temperature for the conditions modeled. ?? 2006 American Chemical Society.

Reorientations in [Mg(H2O)6](CLO4)2 studied by the proton magnetic resonance and the quasielastic neutron scattering methods

International Nuclear Information System (INIS)

Svare, I.; Fimland, B.O.; Janik, J.A.; Janik, J.M.; Mikuli, E.; Migdal-Mikuli, A.

1980-01-01

Proton magnetic relaxation measurements carried out for [Mg(H 2 O)XL6](CLO 4 ) 2 revealed two processes responsible for T 1 vs temperature dependence: one connected with H 2 O 180deg flips about the symmetry axes and second connected with a tumbling of the complex cation. Quasielastic neutron scattering measurements gave another evidence of H 2 O 180deg flips. The reorientational corelation times, which in the 273 K - 325 K region are of the order of picoseconds, as derived from NMR coincide perfectly well with those derived from QNS. (author)

KEY COMPARISON: CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

Science.gov (United States)

Hill, K. D.; Steele, A. G.; Dedikov, Y. A.; Shkraba, V. T.

2005-01-01

The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 Ω capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L&N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions

48 CFR 719.273-8 - Developmental assistance.

Science.gov (United States)

2010-10-01

... relating to— (1) Financial management; (2) Organizational management; (3) Overall business management/planning; (4) Business development; and (5) Technical assistance. (b) Loans; (c) Rent-free use of... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development...

Ethyl 4-{1-[(2,4-dinitrophenylhydrazono]ethyl}-5-(2-naphthylmethoxymethylisoxazole-3-carboxylate

Directory of Open Access Journals (Sweden)

Nicholas R. Natale

2009-01-01

Full Text Available The title compound, C26H23N5O8, was prepared and its structure investigated to further develop a working hypothesis for the essential binding pharmacophore for ligands of the System Xc- transporter [Patel et al. (2004. Neuropharmacology, 46, 273–284]. The hydrazone group displays an E geometry and the isoxazole double bond and C=N group of the hydrazone are in an s-cis relationship. The secondary amino NH group forms an intramolecular N—H...O hydrogen bond to a ring nitro group. There is a dihedral angle of 44.27 (5° between the isoxazole plane and the hydrazone group plane.

Survival patterns and hemopathological responses of dogs under continuous gamma irradiation

International Nuclear Information System (INIS)

Seed, T.M.; Fritz, T.E.; Tolle, D.V.; Poole, C.M.; Lombard, L.S.; Doyle, D.E.; Kaspar, L.V.; Cullen, S.M.; Carnes, B.A.

1983-01-01

Survival curves were constructed and analyzed relative to contributing hematopathological responses for groups of beagles exposed continuously for duration of life to low daily doses of whole body 60 Co gamma irradiation (27.3 rads/day to 4 rads/day). The survival curves versus time were progressively displaced toward longer survival as rates of exposure were reduced from the relatively high dose rate of 27.3 rads/day to the low dose rate of 4.0 rads/day. Average survival times increased from 57 days at 27.3 rads/day to 1830 days at 4.0 rads/day, representing fractional increased life-spans from 1.5% to 50.8%, respectively. Survival curves versus total dose were markedly displaced along the cumulative radiation dose axis at the extreme dose rates (i.e., 27.3 and 4.0 rads/day), but not at the intermediate dose rates (i.e., 13.4 and 7.9 rads/day) in which the upper linear portions of the survival curves are superimposed. From these dose-dependent survival curves, LD 50 values for whole body gamma irradiation, delivered chronically at 27.3, 13.4, 7.9, and 4.0 rads per day were estimated to be 1442, 2124, 2039, and 7161 rads, respectively. Both time- and dose-dependent survival curves for the intermediate dose rates, in contrast to the extreme dose rates, exhibited pronounced transitions in the lethality rate below the 50% survival level. These lethality rate transitions occurred at approx. 2500 rads of accumulated dose and were attributed to a shift in the spectrum of developing hematopathologies: namely, from a predominance of the acutely ablative radiation-induced lymphohematopoietic syndromes (i.e., septicemias and aplastic anemias) to a predominance of the late arising hematopoietic neoplasias (myelogenous leukemia and related myeloproliferative disorders)

Periodontitis and cancer mortality: Register-based cohort study of 68,273 adults in 10-year follow-up.

Science.gov (United States)

Heikkilä, Pia; But, Anna; Sorsa, Timo; Haukka, Jari

2018-06-01

Periodontitis, a multifactorial infection-induced low-grade chronic inflammation, can influence the process of carcinogenesis. We studied with 10 years follow-up of 68,273 adults-based cohort the involvement of periodontitis as a risk factor for cancer mortality. Periodontal status was defined based on procedure codes of periodontal treatment. Rate ratios and absolute differences of overall and cancer mortality rates were assessed with respect to periodontal status using multiplicative and additive Poisson regression models, respectively. We adjusted for effect of age, sex, calendar time, socio-economic status, oral health, dental treatments and diabetes. Data about smoking or alcohol consumption were not available. Altogether 797 cancer deaths occurred during 664,020 person-years accumulated over a mean 10.1-year follow-up. Crude cancer mortality rate per 10,000 person-years for participants without and with periodontitis was 11.36 (95% CI 10.47-12.31) and 14.45 (95% CI 12.51-16.61), respectively. Crude rate ratios for periodontitis indicated an increased risk of overall (RR 1.27, 95% CI 1.08-1.39) and pancreatic cancer (RR 1.69, 95% CI 1.04-2.76) mortality. After adjustment, the results showed even stronger associations of periodontitis with increased overall (RR 1.33, 95% CI 1.10-1.58) and pancreatic cancer (RR 2.32, 95% CI 1.31-3.98) mortality. A higher pancreatic cancer mortality among individuals with periodontitis contributed considerably to the difference in overall cancer mortality, but this difference was not due to pancreatic cancer deaths alone. © 2018 UICC.

Habitats of small mammals at Whiteshell Nuclear Research Establishment

Energy Technology Data Exchange (ETDEWEB)

Iverson, S L; Turner, B N

1973-12-01

The small mammals in the area around the Whiteshell Nuclear Research Establishment in southeastern Manitoba were sampled by approximately 110,000 snap- trap nights in a 5 year period. Habitats trapped were divided into major types on the basis of the tree species present, and occurrences of the different species of shrubs and herbs in each habitat type were noted. The major habitats were mixed deciduous, aspen, ash, mixed coniferous, The small mammal component of the mixed deciduous forest was dominated by Peromyscus maniculatus and Clethrionomys gapperi but all of the other species included in this study were also present. In both aspen and ash forests, Microtus pennsylvanicus and C. gapperi were the most numerous species, with Sorex arcticus reaching its greatest abundance in the latter. In the open field, M. pennsylvanicus was most abundant, followed by Zapus hudsonius, C. gapperi, M. pennsylvanicus and Sorex cinereus were the most numerous mammals in the black spruce bog community, and also extended into the black spruce forest. All of the species studied, except Napaeozapus insignis and S. arcticus, were present in the mixed coniferous forest. S. arcticus and S. cinereus, although captured in habitats ranging from heavy forest to open field, appeared to be most numerous in young forests and other intermediate habitats. Blarina brevicauda was most numerous in older forests. P. maniculatus and N. insignis were most common in the mixed deciduous forest, but P. maniculatus occurred more frequently than N. insignis in the younger forests. P. maniculatus showed a significant positive relationship with large tree diameter and low percentages of ground cover. C. gapperi was captured in highest numbers in the mixed deciduous and coniferous forests, but was also found in the other types of forest in greater numbers than P. maniculaius. M. pennsylvanicus and Zapus hudsonius were most common in the open field, but both species were present in the forests. Analysis of data

Physiological characteristics of bacteria isolated from water brines within permafrost

Science.gov (United States)

Shcherbakova, V.; Rivkina, E.; Laurinavichuis, K.; Pecheritsina, S.; Gilichinsky, D.

2004-01-01

In the Arctic there are lenses of overcooled water brines (cryopegs) sandwiched within permafrost marine sediments 100 120 thousand years old. We have investigated the physiological properties of the pure cultures of anaerobic Clostridium sp. strain 14D1 and two strains of aerobic bacteria Psychrobacter sp. isolated from these cryopegs. The structural and physiological characteristics of new bacteria from water brines have shown their ability to survive and develop under harsh conditions, such as subzero temperatures and high salinity.

New member of the hormone-sensitive lipase family from the permafrost microbial community.

Science.gov (United States)

Petrovskaya, Lada E; Novototskaya-Vlasova, Ksenia A; Gapizov, Sultan Sh; Spirina, Elena V; Durdenko, Ekaterina V; Rivkina, Elizaveta M

2017-07-04

Siberian permafrost is a unique environment inhabited with diverse groups of microorganisms. Among them, there are numerous producers of biotechnologically relevant enzymes including lipases and esterases. Recently, we have constructed a metagenomic library from a permafrost sample and identified in it several genes coding for potential lipolytic enzymes. In the current work, properties of the recombinant esterases obtained from this library are compared with the previously characterized lipase from Psychrobacter cryohalolentis and other representatives of the hormone-sensitive lipase family.

Replacement of CH4 in the hydrate by use of liquid CO2

International Nuclear Information System (INIS)

Ota, Masaki; Morohashi, Kenji; Abe, Yuki; Watanabe, Masaru; Smith, Richard Lee Jr.; Inomata, Hiroshi

2005-01-01

The dynamics of CH 4 replacement in the CH 4 hydrate with saturated liquid CO 2 at 273.2 K was measured with a high pressure optical cell. The results showed that CH 4 in the hydrate gradually moved to the liquid CO 2 phase while CO 2 in the liquid phase penetrated into the hydrate from the quantitative analysis. The decomposing process of the CH 4 hydrate during the replacement was analyzed with in situ Raman spectroscopy, which allowed us to distinguish the cage structure of the CH 4 hydrate and discuss the microscopic view of the replacement in the hydrate. It was found that the decomposition of the medium cage (M-cage) in the CH 4 hydrate proceeded faster than that of the small cage (S-cage). The observed rate difference could be related to the stability of the S-cage in the CH 4 hydrate or the re-formation tendency of CH 4 and water molecules in the S-cage after decomposing the hydrate structure, whereas the guest molecule exchange of CH 4 with CO 2 could occur in the M-cage. Based on the experimental data, we developed a kinetic model for calculation of the CH 4 remaining in the hydrate considering the decomposition rate difference between the M-cage and S-cage in the CH 4 hydrate. The results indicate that the driving force could be the fugacity difference between the fluid phase and the hydrate phase for the replacement process

Measurement of the D/H, 18O/16O, and 17O/16O Isotope Ratios in Water by Laser Absorption Spectroscopy at 2.73 μm

Directory of Open Access Journals (Sweden)

Tao Wu

2014-05-01

Full Text Available A compact isotope ratio laser spectrometry (IRLS instrument was developed for simultaneous measurements of the D/H, 18O/16O and 17O/16O isotope ratios in water by laser absorption spectroscopy at 2.73 μm. Special attention is paid to the spectral data processing and implementation of a Kalman adaptive filtering to improve the measurement precision. Reduction of up to 3-fold in standard deviation in isotope ratio determination was obtained by the use of a Fourier filtering to remove undulation structure from spectrum baseline. Application of Kalman filtering enables isotope ratio measurement at 1 s time intervals with a precision (<1‰ better than that obtained by conventional 30 s averaging, while maintaining a fast system response. The implementation of the filter is described in detail and its effects on the accuracy and the precision of the isotope ratio measurements are investigated.

The preparation of 3,5-dihydroxy-4-isopropylstilbene nanoemulsion and in vitro release

Science.gov (United States)

Zhang, Yue; Gao, Jungang; Zheng, Hetang; Zhang, Ran; Han, Yucui

2011-01-01

We have reported a novel procedure to prepare 3,5-dihydroxy-4-isopropylstilbene (DHPS) nanoemulsion, using a low-energy emulsification method. Based on the phase diagram, the optimum prescription of nanoemulsion preparation was screened. With polyoxyethylenated castor oil (EL-40) as the surfactant, ethanol as the co-surfactant, and isopropyl myristate (IPM) as the oil phase, the DHPS nanoemulsion was obtained with a transparent appearance, little viscosity, and spherically uniform distribution verified by transmission electron microscopy and laser scattering analyzer. The nanoemulsion was also determined by FT-Raman spectroscopy. The DHPS nanoemulsion demonstrated good stability and stable physical and chemical properties. The nanoemulsion dramatically improved the transdermal release of DHPS (from 8.02 μg · cm−2 to 273.15 μg · cm−2) and could become a favorable new dosage form for DHPS. PMID:21674020

Arsenite-oxidizing and arsenate-reducing bacteria associated with arsenic-rich groundwater in Taiwan

Science.gov (United States)

Liao, Vivian Hsiu-Chuan; Chu, Yu-Ju; Su, Yu-Chen; Hsiao, Sung-Yun; Wei, Chia-Cheng; Liu, Chen-Wuing; Liao, Chung-Min; Shen, Wei-Chiang; Chang, Fi-John

2011-04-01

Drinking highly arsenic-contaminated groundwater is a likely cause of blackfoot disease in Taiwan, but microorganisms that potentially control arsenic mobility in the subsurface remain unstudied. The objective of this study was to investigate the relevant arsenite-oxidizing and arsenate-reducing microbial community that exists in highly arsenic-contaminated groundwater in Taiwan. We cultured and identified arsenic-transforming bacteria, analyzed arsenic resistance and transformation, and determined the presence of genetic markers for arsenic transformation. In total, 11 arsenic-transforming bacterial strains with different colony morphologies and varying arsenic transformation abilities were isolated, including 10 facultative anaerobic arsenate-reducing bacteria and one strictly aerobic arsenite-oxidizing bacterium. All of the isolates exhibited high levels of arsenic resistance with minimum inhibitory concentrations of arsenic ranging from 2 to 200 mM. Strain AR-11 was able to rapidly oxidize arsenite to arsenate at concentrations relevant to environmental groundwater samples without the addition of any electron donors or acceptors. We provide evidence that arsenic-reduction activity may be conferred by the ars operon(s) that were not amplified by the designed primers currently in use. The 16S rRNA sequence analysis grouped the isolates into the following genera: Pseudomonas, Bacillus, Psychrobacter, Vibrio, Citrobacter, Enterobacter, and Bosea. Among these genera, we present the first report of the genus Psychrobacter being involved in arsenic reduction. Our results further support the hypothesis that bacteria capable of either oxidizing arsenite or reducing arsenate coexist and are ubiquitous in arsenic-contaminated groundwater.

A one-pot synthesis of 1,6,9,13-tetraoxadispiro(4.2.4.2)tetradecane by hydrodeoxygenation of xylose using a palladium catalyst.

Science.gov (United States)

Jackson, Michael A; Blackburn, Judith A; Price, Neil P J; Vermillion, Karl E; Peterson, Steven C; Ferrence, Gregory M

2016-09-02

In an effort to expand the number of biobased chemicals available from sugars, xylose has been converted to 1,6,9,13-tetraoxadispiro(4.2.4.2)tetradecane in a one-pot reaction using palladium supported on silica-alumina as the catalyst. The title compound is produced in 35-40% yield under 7 MPa H2 pressure at 733 K using 3-10 wt%Pd on silica-alumina catalyst. It is isolated using a combination of liquid-liquid extractions and flash chromatography. This dimer can be converted to its monomer, 2-hydroxy-(2-hydroxymethyl)tetrahydrofuran, which ring opens under acid conditions to 1,5-dihydroxy-2-pentanone. This diol can then be esterified with vinylacetate in phosphate buffer to produce 1,5-bis(acetyloxy)-2-pentanone which is an inhibitor of mammalian 11β-hydroxysteroid dehydrogenase 1. (1)H and (13)C nmr spectra of each of these species are reported. The single crystal X-ray structure of the title compound is also reported. These data were collected in a temperature range of 100 K-273 K and show a solid state phase change from triclinic to monoclinic between 175 K and 220 K without a conformational change. Published by Elsevier Ltd.

Microbial background flora in small-scale cheese production facilities does not inhibit growth and surface attachment of Listeria monocytogenes.

Science.gov (United States)

Schirmer, B C T; Heir, E; Møretrø, T; Skaar, I; Langsrud, S

2013-10-01

The background microbiota of 5 Norwegian small-scale cheese production sites was examined and the effect of the isolated strains on the growth and survival of Listeria monocytogenes was investigated. Samples were taken from the air, food contact surfaces (storage surfaces, cheese molds, and brine) and noncontact surfaces (floor, drains, and doors) and all isolates were identified by sequencing and morphology (mold). A total of 1,314 isolates were identified and found to belong to 55 bacterial genera, 1 species of yeast, and 6 species of mold. Lactococcus spp. (all of which were Lactococcus lactis), Staphylococcus spp., Microbacterium spp., and Psychrobacter sp. were isolated from all 5 sites and Rhodococcus spp. and Chryseobacterium spp. from 4 sites. Thirty-two genera were only found in 1 out of 5 facilities each. Great variations were observed in the microbial background flora both between the 5 producers, and also within the various production sites. The greatest diversity of bacteria was found in drains and on rubber seals of doors. The flora on cheese storage shelves and in salt brines was less varied. A total of 62 bacterial isolates and 1 yeast isolate were tested for antilisterial activity in an overlay assay and a spot-on-lawn assay, but none showed significant inhibitory effects. Listeria monocytogenes was also co-cultured on ceramic tiles with bacteria dominating in the cheese production plants: Lactococcus lactis, Pseudomonas putida, Staphylococcus equorum, Rhodococcus spp., or Psychrobacter spp. None of the tested isolates altered the survival of L. monocytogenes on ceramic tiles. The conclusion of the study was that no common background flora exists in cheese production environments. None of the tested isolates inhibited the growth of L. monocytogenes. Hence, this study does not support the hypothesis that the natural background flora in cheese production environments inhibits the growth or survival of L. monocytogenes. Copyright © 2013 American

Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

Energy Technology Data Exchange (ETDEWEB)

Peleties, F. [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain); Trusler, J.P.M., E-mail: m.trusler@imperial.ac.u [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Vega-Maza, D. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain)

2010-05-15

We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

International Nuclear Information System (INIS)

Peleties, F.; Segovia, J.J.; Trusler, J.P.M.; Vega-Maza, D.

2010-01-01

We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

Waterborne Commerce of the United States, Calendar Year 1980. Part 2. Waterways and Harbors, Gulf Coast, Mississippi River System and Antilles.

Science.gov (United States)

1982-09-01

IX.UEX, * PASS6 199S--0𔄁,9M6. ( WORT TDS ) - - - -07 0 - - - - - - - --S R-S-, - -- ----------..........----- -----4,--3 - ,--- -- ...... 1091~~ 3,N126~v...OECCAST.ISE, INAATERR!?O~V -F O C O M M TD M E STY , IMPORTS ,,poP Ts CIP S w s TOTAL ---------------------------------------------------------- 1 ,4S,325...d6 680 1 1.9 62 262 1 - 776 776 273 273 TOTAL .---------- 300 1.452 2,132 171 4,055 265 1.451 1.904 163 3.803 MISSOURI 6rVE, S! 7UX CITY TO !’MA.A

14 CFR 171.273 - Maintenance and operations requirements.

Science.gov (United States)

2010-01-01

... authorized persons. (3) FCC licensing requirements for operations and maintenance personnel. (4) Posting of..., with a maximum corrective maintenance time of not greater than 1.5 hours. This measure applies to... than 1,500 hours. This measure applies to unscheduled outages, out-of-tolerance conditions, and...

A unique 3D ultramicroporous triptycene-based polyimide framework for efficient gas sorption applications

KAUST Repository

Ghanem, Bader

2016-10-03

A novel 3D ultramicroporous triptycene-based polyimide framework with high surface area (1050 m2 g−1) and thermal stability was synthesized. It exhibits relatively high CO2 (3.4 mmol g−1 at 273 K and 1 bar), H2 (7 mmol g−1 at 77 K and 1 bar), and olefin sorption capacity, good CO2/N2 (45) and CO2/CH4 (9.6) selectivity at 273 K and 1 bar, as well as promising C2H4/CH4 and C3H6/CH4 selectivities at 298 K, making it a potential candidate for CO2 capture, H2 storage, and hydrocarbon gas separation applications.

A unique 3D ultramicroporous triptycene-based polyimide framework for efficient gas sorption applications

KAUST Repository

Ghanem, Bader; Belmabkhout, Youssef; Wang, Yingge; Zhao, Yunfeng; Han, Yu; Eddaoudi, Mohamed; Pinnau, Ingo

2016-01-01

A novel 3D ultramicroporous triptycene-based polyimide framework with high surface area (1050 m2 g−1) and thermal stability was synthesized. It exhibits relatively high CO2 (3.4 mmol g−1 at 273 K and 1 bar), H2 (7 mmol g−1 at 77 K and 1 bar), and olefin sorption capacity, good CO2/N2 (45) and CO2/CH4 (9.6) selectivity at 273 K and 1 bar, as well as promising C2H4/CH4 and C3H6/CH4 selectivities at 298 K, making it a potential candidate for CO2 capture, H2 storage, and hydrocarbon gas separation applications.

The X-ray emission mechanism of large scale powerful quasar jets: Fermi rules out IC/CMB for 3C 273.

Directory of Open Access Journals (Sweden)

Georganopoulos Markos

2013-12-01

Full Text Available The process responsible for the Chandra-detected X-ray emission from the large-scale jets of powerful quasars is not clear yet. The two main models are inverse Compton scattering off the cosmic microwave background photons (IC/CMB and synchrotron emission from a population of electrons separate from those producing the radio-IR emission. These two models imply radically different conditions in the large scale jet in terms of jet speed, kinetic power, and maximum energy of the particle acceleration mechanism, with important implications for the impact of the jet on the larger-scale environment. Georganopoulos et al. (2006 proposed a diagnostic based on a fundamental difference between these two models: the production of synchrotron X-rays requires multi-TeV electrons, while the EC/CMB model requires a cutoff in the electron energy distribution below TeV energies. This has significant implications for the γ-ray emission predicted by these two models. Here we present new Fermi observations that put an upper limit on the gamma-ray flux from the large-scale jet of 3C 273 that clearly violates the flux expected from the IC/CMB X-ray interpretation found by extrapolation of the UV to X-ray spectrum of knot A, thus ruling out the IC/CMB interpretation entirely for this source. Further, the upper limit from Fermi puts a limit on the Doppler beaming factor of at least δ <9, assuming equipartition fields, and possibly as low as δ <5 assuming no major deceleration of the jet from knots A through D1.

Characterization of Novel Calmodulin Binding Domains within IQ Motifs of IQGAP1

Science.gov (United States)

Jang, Deok-Jin; Ban, Byungkwan; Lee, Jin-A

2011-01-01

IQ motif-containing GTPase-activating protein 1 (IQGAP1), which is a well-known calmodulin (CaM) binding protein, is involved in a wide range of cellular processes including cell proliferation, tumorigenesis, adhesion, and migration. Interaction of IQGAP1 with CaM is important for its cellular functions. Although each IQ domain of IQGAP1 for CaM binding has been characterized in a Ca2+-dependent or -independent manner, it was not clear which IQ motifs are physiologically relevant for CaM binding in the cells. In this study, we performed immunoprecipitation using 3xFLAGhCaM in mammalian cell lines to characterize the domains of IQGAP1 that are key for CaM binding under physiological conditions. Interestingly, using this method, we identified two novel domains, IQ(2.7-3) and IQ(3.5-4.4), within IQGAP1 that were involved in Ca2+-independent or -dependent CaM binding, respectively. Mutant analysis clearly showed that the hydrophobic regions within IQ(2.7-3) were mainly involved in apoCaM binding, while the basic amino acids and hydrophobic region of IQ(3.5-4.4) were required for Ca2+/CaM binding. Finally, we showed that IQ(2.7-3) was the main apoCaM binding domain and both IQ(2.7-3) and IQ(3.5-4.4) were required for Ca2+/CaM binding within IQ(1- 2-3-4). Thus, we identified and characterized novel direct CaM binding motifs essential for IQGAP1. This finding indicates that IQGAP1 plays a dynamic role via direct interactions with CaM in a Ca2+-dependent or -independent manner. PMID:22080369

Heavy and light beer: a carbon isotope approach to detect C(4) carbon in beers of different origins, styles, and prices.

Science.gov (United States)

Brooks, J Renée; Buchmann, Nina; Phillips, Sue; Ehleringer, Bruce; Evans, R David; Lott, Mike; Martinelli, Luiz A; Pockman, William T; Sandquist, Darren; Sparks, Jed P; Sperry, Lynda; Williams, Dave; Ehleringer, James R

2002-10-23

The carbon isotope ratios (delta(13)C) of 160 beers from around the world ranged from -27.3 to -14.9 per thousand, primarily due to variation in the percentage of C(3) or C(4) plant carbon in the final product. Thirty-one percent of beers had a carbon signature of C(3) plants (barley, rice, etc.), whereas the remaining 69% contained some C(3)-C(4) mixture (mean of mixtures, 39 +/- 11% C(4) carbon). Use of C(4) carbon (corn, cane sugar, etc.) was not confined to beers from any particular region (Pacific Rim, Mexico, Brazil, Europe, Canada, and the United States). However, the delta(13)C of European beers indicated mostly C(3) plant carbon. In contrast, U.S. and Canadian beers contained either only C(3) or C(3)-C(4) mixtures; Brazilian, Mexican, and Pacific Rim beers were mostly C(3)-C(4) mixtures. Among different lagers, U.S.-style lagers generally contained more C(4) carbon than did imported pilsners. Among different ales, those brewed by large high-production breweries contained significant proportions of C(4) carbon, while C(4) carbon was not detected in microbrewery or home-brew ales. Furthermore, inexpensive beers generally contained more C(4) carbon than expensive beers.

Gastric Medullary Carcinoma with Sporadic Mismatch Repair Deficiency and a TP53 R273C Mutation: An Unusual Case with Wild-Type BRAF

Directory of Open Access Journals (Sweden)

Brett M. Lowenthal

2017-01-01

Full Text Available Medullary carcinoma has long been recognized as a subtype of colorectal cancer associated with microsatellite instability and Lynch syndrome. Gastric medullary carcinoma is a very rare neoplasm. We report a 67-year-old male who presented with a solitary gastric mass. Total gastrectomy revealed a well-demarcated, poorly differentiated carcinoma with an organoid growth pattern, pushing borders, and abundant peritumoral lymphocytic response. The prior cytology was cellular with immunohistochemical panel consistent with upper gastrointestinal/pancreaticobiliary origin. Overall, the histopathologic findings were consistent with gastric medullary carcinoma. A mismatch repair panel revealed a mismatch repair protein deficient tumor with loss of MLH1 and PMS2 expression. BRAF V600E immunostain (VE1 and BRAF molecular testing were negative, indicating a wild-type gene. Tumor sequencing of MLH1 demonstrated a wild-type gene, while our molecular panel identified TP53 c.817C>T (p.R273C mutation. These findings were compatible with a sporadic tumor. Given that morphologically identical medullary tumors often occur in Lynch syndrome, it is possible that mismatch repair loss is an early event in sporadic tumors with p53 mutation being a late event. Despite having wild-type BRAF, this tumor is sporadic and unrelated to Lynch syndrome. This case report demonstrates that coordinate ancillary studies are needed to resolve sporadic versus hereditary rare tumors.

Radiographic findings in pulmonary hypertension from unresolved embolism

Energy Technology Data Exchange (ETDEWEB)

Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

1985-04-01

Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms.

Radiographic findings in pulmonary hypertension from unresolved embolism

International Nuclear Information System (INIS)

Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

1985-01-01

Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms

Baseline characteristics in PRIORITY study: Proteomics and mineralocorticoid receptor antagonism for prevention of diabetic nephropathy in type 2 diabetes

DEFF Research Database (Denmark)

Tofte, Nete

diabetic nephRopathy In TYpe 2 diabetic patients with normoalbuminuria) trial, the aim is to confirm that CKD273 can predict microalbuminuria prospectively, and to test whether mineralocorticoid receptor antagonism (MRA) delays progression to microalbuminuria. Here we report the association between CKD273...... and traditional risk factors for diabetic nephropathy at baseline. Materials and methods PRIORITY is an investigator-initiated, prospective, randomized, double blind, placebo-controlled multicentre clinical trial and observational study in normoalbuminuric type 2 diabetic patients. Patients are stratified...... is development of microalbuminuria. Results In total 2277 type 2 diabetic patients have been screened over a time period of 2.5 years and 1811 are included from 15 sites. Table 1 shows the baseline characteristics. 224 (12.4%) have the high-risk CKD273 pattern. The high- and low-risk populations differ...

The preparation of 3,5-dihydroxy-4-isopropylstilbene nanoemulsion and in vitro release

Directory of Open Access Journals (Sweden)

Zhang Y

2011-04-01

Full Text Available Yue Zhang1,2, Jungang Gao1, Hetang Zheng2, Ran Zhang3, Yucui Han21College of Chemistry and Enviromental Science, Hebei University, Baoding, China; 2School of Chemical and Pharmaceutical Engineering, Hebei University of Science and Technology, Shijiazhuang, China; 3College of Chemical Engineering, East China University of Science and Technology, Shanghai, ChinaAbstract: We have reported a novel procedure to prepare 3,5-dihydroxy-4-isopropylstilbene (DHPS nanoemulsion, using a low-energy emulsification method. Based on the phase diagram, the optimum prescription of nanoemulsion preparation was screened. With polyoxyethylenated castor oil (EL-40 as the surfactant, ethanol as the co-surfactant, and isopropyl myristate (IPM as the oil phase, the DHPS nanoemulsion was obtained with a transparent appearance, little viscosity, and spherically uniform distribution verified by transmission electron microscopy and laser scattering analyzer. The nanoemulsion was also determined by FT-Raman spectroscopy. The DHPS nanoemulsion demonstrated good stability and stable physical and chemical properties. The nanoemulsion dramatically improved the transdermal release of DHPS (from 8.02 µg · cm-2 to 273.15 µg · cm-2 and could become a favorable new dosage form for DHPS.Keywords: nanoemulsion, 3,5-dihydroxy-4-isopropylstilbene, DHPS, pseudo-ternary phase diagram

Solvent-free synthesis and application of nano-Fe/Ca/CaO/[PO{sub 4}] composite for dual separation and immobilization of stable and radioactive cesium in contaminated soils

Energy Technology Data Exchange (ETDEWEB)

Mallampati, Srinivasa Reddy, E-mail: srireddys@ulsan.ac.kr [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of); Mitoma, Yoshiharu, E-mail: mitomay@pu-hiroshima.ac.jp [Department of Environmental Sciences, Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, 562 Nanatsuka-Cho Shobara City, Hiroshima 727-0023 (Japan); Okuda, Tetsuji [Environmental Research and Management Center, Hiroshima University, 1-5-3 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8513 (Japan); Simion, Cristian [Politehnica University of Bucharest, Department of Organic Chemistry, Bucharest 060042 (Romania); Lee, Byeong Kyu [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of)

2015-10-30

Graphical abstract: A possible pathway for immobilization with the nano-Fe/Ca/CaO/[PO{sub 4}] treatment (a) {sup 133}Cs is adsorbed onto the soil particles, (b) Cs encapsulation through the formation of immobile salts, and (c) solid (small/finer or larger/aggregate) soil fraction separation. - Highlights: • Nano-Fe/Ca/CaO/[PO{sub 4}] composite for Cs immobilization in soil was developed. • Enhanced cesium separation and immobilization was done in dry condition. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • Nano-Fe/Ca/CaO/[PO{sub 4}] a highly potential amendment for the remediation of Cs. - Abstract: This study assessed the synthesis and application of nano-Fe/Ca/CaO-based composite material for use as a separation and immobilizing treatment of dry soil contaminated by stable ({sup 133}Cs) and radioactive cesium species ({sup 134}Cs and {sup 137}Cs). After grinding with nano-Fe/CaO, nano-Fe/Ca/CaO, and nano-Fe/Ca/CaO/[PO{sub 4}], approximately 31, 25, and 22 wt% of magnetic fraction soil was separated. Their resultant {sup 133}Cs immobilization values were about 78, 81, and 100%, respectively. When real radioactive cesium contaminated soil obtained from Fukushima was treated with nano-Fe/Ca/CaO/[PO{sub 4}], approximately 27.3 wt% of magnetic and 72.75% of non-magnetic soil fractions were separated. The highest amount of entrapped {sup 134}Cs and {sup 137}Cs was found in the lowest weight of the magnetically separated soil fraction (i.e., 80% in 27.3% of treated soil). Results show that {sup 134}Cs and {sup 137}Cs either in the magnetic or non-magnetic soil fractions was 100% immobilized. The morphology and mineral phases of the nano-Fe/Ca/CaO/[PO{sub 4}] treated soil were characterized using SEM–EDS, EPMA, and XRD analysis. The EPMA and XRD patterns indicate that the main fraction of enclosed/bound materials on treated soil

Quaternized chitosan/rectorite/AgNP nanocomposite catalyst for reduction of 4-nitrophenol

Energy Technology Data Exchange (ETDEWEB)

Ling, Yunzhi [State Key Laboratory of Pulp & Paper Engineering, South China University of Technology, Guangzhou 510640 (China); Zeng, Xianjie [School of Business Administration, South China University of Technology, Guangzhou 510640 (China); Tan, Weirui [State Key Laboratory of Pulp & Paper Engineering, South China University of Technology, Guangzhou 510640 (China); Luo, Jiwen, E-mail: holdit@126.com [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); State Key Laboratory of Pulp & Paper Engineering, South China University of Technology, Guangzhou 510640 (China); Liu, Shijie, E-mail: sjliu@163.com [State Key Laboratory of Pulp & Paper Engineering, South China University of Technology, Guangzhou 510640 (China); China Department of Paper and Bioprocess Engineering, State University of New York, College of Environmental Science and Forestry, 1 Forestry Drive, Syracuse, NY 13210 (United States)

2015-10-25

This study investigated a one-step green fabrication of exfoliated quaternized chitosan/rectorite/AgNP nanocomposites under microwave radiation method. The nanocomposites were characterized by FT-IR, XRD, XPS and TEM. The results revealed that quaternized chitosan and rectorite acted as reducing and stabilizing agents, spherical AgNPs were synthesized greenly and rapidly, meanwhile the layers of rectorite were exfoliated, and when the ratio of quaternized chitosan, rectorite and silver nitrate was 100 mg: 10 mg: 2 mmol, the AgNP content reached the maximum of 2.73%. Then, the quaternized chitosan/rectorite/AgNP nanocomposite was fabricated as a film, which was used in the catalytic reduction from 4-nitrophenol to 4-aminophenol by NaBH{sub 4}. The film showed excellent catalytic efficiency with an activation energy of 29.76 kJ mol{sup −1} and outstanding reusable performance even after catalysis for 10 times. - Graphical abstract: Quaternized chitosan/rectorite/AgNP nanocomposite catalyst was prepared greenly in one pot and fabricated as a film, which showed excellent catalytic efficiency and reusable performance. - Highlights: • Quaternized chitosan and rectorite acted as reducing and stabilizing agents. • Spherical Ag NPs were synthesized greenly and rapidly. • AgNP dispersed well on the surface and the interlayer of exfoliated rectorite. • Quaternized chitosan/rectorite/AgNP nanocomposite was prepared as a film. • The film showed excellent catalytic efficiency and reusable performance.

Passively Q-switched mode-locked Nd3+:LuVO4 laser by LT-GaAs saturable absorber

International Nuclear Information System (INIS)

Li, M; Zhao, S; Li, Y; Yang, K; Li, G; Li, D; An, J; Li, T; Yu, Z

2009-01-01

By using LT-GaAs as saturable absorber, we have demonstrated the stable Q-switched and mode-locked (QML) Nd:LuVO 4 laser run in a Z-type folded cavity. Nearly 100% modulation depth of mode locking can be obtained as long as the pump power reaches the oscillation threshold. The repetition rate of the passively Q-switched pulse envelops ranges from 37.5 to 139 kHz as the pump power increased from 1.7 to 8.2 W. The mode-locked pulse inside the Q-switched envelop has an estimated pulse width of about 220 ps and a repetition rate of 111 MHz. Under an incident pump power of 8.2 W, the highest pulse energy of 6 μJ of each Q-switched envelope, and the highest peak power about 2.73 kW of Q-switched mode-locked pulses can be obtained

Development of an Atmospheric Dispersion Model for Heavier-Than-Air Gas Mixtures. Volume 1.

Science.gov (United States)

1985-05-01

aspirated concentration sensor used a balanced Wheatstone bridge to measure the heat loss from a sensing element placed in the sample stream. Shaded...a semipermeable membrane and electrochemical cell. A fast response sensor (10 Hz) basically aspirated a sample past the cell membrane. Reported...ramp function around the freezing point of water by X11., X= vap for T 273.15 K vap fus 263.15 for 263.15 <T < 273.15 Xvap +x fus for T < 263.15 (A-4

Pharmacokinetics of MMB4 DMS in rats, rabbits, and dogs following a single IV administration.

Science.gov (United States)

Hong, S Peter; Gibbs, Seth T; Kobs, Dean J; Osheroff, Merrill R; Johnson, Jerry D; Burback, Brian L

2013-01-01

Organophosphorus (OP) nerve agents pose tremendous threats to both military and civilian populations. The substance 1,1'-methylenebis[4-[(hydroxyimino)methyl]-pyridinium] (MMB4) is being developed as a replacement for the currently fielded 2-pyridine aldoxime, or pralidoxime (2-PAM) as a treatment for OP nerve agent-induced toxicity. The present study characterized pharmacokinetic (PK) profiles of MMB4 in male and female Sprague-Dawley rats, New Zealand White rabbits, and beagle dogs given a single intravenous (IV) administration of MMB4 dimethanesulfonate (DMS) at 55, 25, and 15 mg/kg dose, respectively. The plasma MMB4 concentration versus time profiles were biphasic for all species tested and fit a 2-compartment model with first-order elimination. There were no overt sex-related differences in the calculated PK parameters. For the rat, rabbit, and dog, the average systemic exposure parameters predicted Cmax (µg/mL) and AUC∞ (µg·h/mL) were 273 and 71.0, 115 and 48.1, and 87.4 and 39.6; the average volume of distribution (mL/kg) values to the central and peripheral compartments were 207 and 143, 242 and 172, and 198 and 213; and the average elimination half-life (hour) and clearance (mL/h/kg) values were 0.18 and 778, 0.29 and 577, and 0.32 and 430, respectively, when the PK parameters for males and females were combined. The current study revealed a similarity in the volume of distribution to the central compartment for MMB4 among the 3 species tested while demonstrating species-related differences in the elimination half-life and clearance of MMB4.

Photoluminescence and thermoluminescence properties of Tb3+ doped K3Gd(PO4)2 nanophosphor

International Nuclear Information System (INIS)

Gupta, Palvi; Bedyal, A.K.; Kumar, Vinay; Khajuria, Y.; Lochab, S.P.; Pitale, S.S.; Ntwaeaborwa, O.M.; Swart, H.C.

2014-01-01

Energy level diagram of Tb 3+ ion in the K 3 Gd(PO 4 ) 2 host lattice. - Highlights: • First time, a detailed TL and PL study on undoped and Tb 3+ doped K 3 Gd(PO 4 ) 2 nanophosphor. • Combustion method was employed to synthesize the Tb 3+ doped K 3 Gd(PO 4 ) 2 nanophosphor. • Mechanism of excitation and emission in undoped and Tb 3+ doped K 3 Gd(PO 4 ) 2 nanophosphor was given. - Abstract: Tb 3+ doped nanoparticulate K 3 Gd(PO 4 ) 2 phosphor was prepared by combustion method using urea as a fuel. The structure, optical and luminescent properties of the phosphor were studied by X-ray diffraction (XRD), scanning electron microscopy (SEM), diffuse reflectance spectroscopy (DRS), photoluminescence spectroscopy (PL), and thermoluminescence (TL) spectroscopy. In undoped K 3 Gd(PO 4 ) 2 , the excitation and emission peaks at 273 nm and 323 nm belongs to the 8 S 7/2 → 6 I J(J=7/2) and 6 P J(J=7/2) → 8 S 7/2 transitions of Gd 3+ while green emission was observed in the Tb 3+ doped K 3 Gd(PO 4 ) 2 . TL study was carried out after exposing the samples to γ-radiations (0.1–5 kGy) in the K 3 Gd(PO 4 ) 2 :Tb 3+ (1.5 mol%). The calculated kinetic parameters were compared with different methods. The band gap of the phosphor was estimated as 5.80 eV. The green shade of the Tb 3+ ion with the CIE coordinates (x, y) as (0.29, 0.54) was in good agreement with the well known green phosphors

Analysis of points of dew and contents of humidity of gassy mixtures N2-H2 O and CH4 H2 O

International Nuclear Information System (INIS)

Bedoya M, D; Muller, C; Oellrich, L R

1995-01-01

The actual knowledge of the exact water content in saturated gas mixtures still is incomplete, especially in the high pressure and low temperature region. Hence, dew point measurements with nitrogen - water and methane-water mixtures were performed; at pressures of 3 and 6 MPa and temperatures from 258 K to 288 K. The dew points were determined with the dew point mirror method and the water content by means of the Karl-Fischer-titration. The experimental values were compared to correlations from the literature. The approach by Sharma-Campbell resulted in the best description of the system nitrogen - water. For temperatures below 273 K the assumption of ideal behavior proved to be sufficient for the system methane-water, whereas for temperatures above 273 K calculations with the two-parameter corresponding states principle in combination with a fugacity correction turned out to be the best

CT findings of mediastinal lymph nodes in tuberculous lymphadenitis and metastasis of primary lung cancer

International Nuclear Information System (INIS)

Lee, Hae Ryeon; Hwang, Jung Won; Sung, Kyu Bo; Woo, Won Hyeong

1989-01-01

We analyzed pre and post enhanced CT scan of eight two pathologically proven patients among which forty nine cases were pulmonary tuberculosis and thirty three patients, primary lung cancer, who had mediastinal lymphadenopathy, with special attentions to nodal architectures, numbers and locations. The results were as follows: 1. Lymph nodes abnormality was found in its average number of 1.2 nodes in tuberculosis and 2.8 nodes in primary lung cancer. 2, The location of abnormal lymph nodes were 4R (17.5%), 10R (17.5%) and 5 (14.0%) in order of frequency in tuberculosis, and 4R (17.6%), 10R (14.3%) and 7 (14.3%) in order of frequency in primary lung cancer. 3. In the feature of post enhanced lymph nodes, the central low density type was the most frequent in tuberculosis (61.4%). The most frequent type in primary lung cancer was the homogenous type (79.1%). 4. The incidence of lymph node calcification were as twice in tuberculous (67.3%) than in primary lung cancer (39.4%). 5. In order findings, parenchymal mass density (78.8% in Ca/12.2% in Tb) and pleural effusion (27.3% in Ca/10.2% in Tb) were more frequent in primary lung cancer, but parenchymal calcification (27.3% in Ca/49.0% in Tb) was more frequent in tuberculosis. The cavity formation of primary lung cancer (27.3%) was found to be as the same frequency as in tuberculosis (20.4%)

Neuropsychological Assessment at Preschool Age: Adaptation and Validation of the McCarthy Scales of Children's Abilities to 4 Year-old Basque-speaking Children.

Science.gov (United States)

Andiarena, Ainara; Balluerka, Nekane; Gorostiaga, Arantxa; Ibarluzea, Jesús

2017-10-23

Early neuropsychological assessment provides important information for clinical practice and research. As previously no tool for neuropsychological assessment has been developed in or adapted to Basque, the aim of this study was to adapt and validate the McCarthy Scales of Children's Abilities for 4 years old children. The adaptation and validation of the original instrument followed the methodological steps established by the International Test Commission. We examined the psychometric properties of the adapted instrument in 273 Basque preschool children (aged between 4 years and 4 months and 4 years and 11 months; 52.2% boys). Confirmatory factor analysis showed satisfactory fit indexes except for the General Cognitive and Memory scales. Most scales presented adequate internal consistency (Reliability coefficients ranged between .55 and .81). The Basque version also showed evidence of validity based on the relationship between neuropsychological development and sex, parental education, attention deficit hyperactivity disorder-like behaviours and early neurodevelopment (p < .05; effect sizes ranged between Cohen's d = .26 and .52 and r = .15 and 39). The Basque MSCA can be regarded as a useful tool to evaluate cognitive and psychomotor development in preschool children.

Modern analogues from the Southern Urals provide insights into biodiversity change in the early Holocene forests of Central Europe

Czech Academy of Sciences Publication Activity Database

Chytrý, M.; Danihelka, Jiří; Horsák, M.; Kočí, M.; Kubešová, S.; Lososová, Z.; Otýpková, Z.; Tichý, L.; Martynenko, V. B.; Baisheva, E. Z.

2010-01-01

Roč. 37, č. 4 (2010), s. 767-780 ISSN 0305-0270 Institutional research plan: CEZ:AV0Z60050516 Keywords : bryophytes * broad-leaved trees * mixed oak forests Subject RIV: EF - Botanics Impact factor: 4.273, year: 2010

Babesia major: protection of intact calves against homologous challenge by the injection of irradiated piroplasms

International Nuclear Information System (INIS)

Purnell, R.E.; Lewis, D.; Brocklesby, D.W.

1979-01-01

Blood from a splenectomized calf infected with Babesia major was divided into 20 ml aliquots which were γ-irradiated at doses of 0, 23.3, 27.3, 31.4, 35.4 and 39.5 krad and then inoculated into groups of three intact calves. Animals receiving non-irradiated blood had typical mild B. major reactions, but those receiving blood irradiated at 23.3, 27.3 and 31.4 krad and 2 of 3 receiving blood irradiated at 35.4 krad had minimal reactions. The remaining 4 animals had no detectable parasitaemic reactions. When the calves were challenged with a similar number (6.0 x 10 9 ) of homologous parasites, they were all immune with the exception of the 4 animals which had not reacted initially. The immune status of individual cattle was reflected accurately in the results of the micro-ELISA test, which detected a significant rise in serum antibody titre of the 4 susceptible animals 7 days after challenge. (author)

Babesia major: protection of intact calves against homologous challenge by the injection of irradiated piroplasms

Energy Technology Data Exchange (ETDEWEB)

Purnell, R E; Lewis, D; Brocklesby, D W [Agricultural Research Council, Compton (UK). Inst. for Research on Animal Diseases

1979-02-01

Blood from a splenectomized calf infected with Babesia major was divided into 20 ml aliquots which were ..gamma..-irradiated at doses of 0, 23.3, 27.3, 31.4, 35.4 and 39.5 krad and then inoculated into groups of three intact calves. Animals receiving non-irradiated blood had typical mild B. major reactions, but those receiving blood irradiated at 23.3, 27.3 and 31.4 krad and 2 of 3 receiving blood irradiated at 35.4 krad had minimal reactions. The remaining 4 animals had no detectable parasitaemic reactions. When the calves were challenged with a similar number (6.0 x 10/sup 9/) of homologous parasites, they were all immune with the exception of the 4 animals which had not reacted initially. The immune status of individual cattle was reflected accurately in the results of the micro-ELISA test, which detected a significant rise in serum antibody titre of the 4 susceptible animals 7 days after challenge.

33 CFR Appendix D to Part 273 - Work Progress Report

Science.gov (United States)

2010-07-01

... difference. Not applicable. 4. Outlook for meeting programmed objectives. a. Programmed objectives. Full utilization of work allowance. b. Outlook. We expect to meet our programmed objectives. 5. Problems and.... Surplus funds in the amount of $21,700 will be revoked. ...

Adsorption mechanism of magnetically separable Fe_3O_4/graphene oxide hybrids

International Nuclear Information System (INIS)

Ouyang, Ke; Zhu, Chuanhe; Zhao, Ya; Wang, Leichao; Xie, Shan; Wang, Qun

2015-01-01

Graphical abstract: A recyclable Fe_3O_4/graphene oxide (GO) magnetic hybrid was successfully synthesized via a facile one-pot polylol approach and exhibited an effective adsorption of BPA in aqueous solution. - Highlights: • Magnetically separable Fe_3O_4/GO hybrids were synthesized via a facile one-pot polylol approach. • The Fe_3O_4/GO hybrid could be easily recovered and met the need of magnetic separation, exhibiting excellent reproducibility and reusability. • The hybrids showed excellent adsorption ability for bisphenol A in aqueous solution. • The effect of pH value, temperature and coexisting ions on the adsorption was studied. • π–π interactions were postulated to be the primary mechanisms of adsorption of BPA on Fe_3O_4/GO hybrids. - Abstract: A reclaimable Fe_3O_4/graphene oxide (GO) magnetic hybrid was successfully synthesized via a facile one-pot polyol approach and employed as a recyclable adsorbent for Bisphenol A (BPA) in aqueous solutions. The maximum adsorption capacity (q_m) of the Fe_3O_4/GO hybrid for BPA was 72.80 mg/g at 273 K. The kinetics of the adsorption process and the adsorption isotherm data were fitted using the Freundlich equation and a pseudo-second-order kinetic model. The results of the thermodynamic parameters ΔH°, ΔS° and ΔG° showed that the adsorption process was exothermic and spontaneous. Furthermore, the reusability of the samples was investigated, and the results indicated that the samples exhibited high stability. The magnetic characterization demonstrated that hybrids were superparamagnetic and could be recovered conveniently by magnetic separation. The strong π–π interaction was determined to be the predominant driving force behind the adsorption of BPA onto the Fe_3O_4/GO hybrid. Therefore, the Fe_3O_4/GO hybrid could be regarded as a potential adsorbent for wastewater treatment and purification processes.

Gold Nanoparticles on Mesoporous SiO2-Coated Magnetic Fe3O4 Spheres: A Magnetically Separatable Catalyst with Good Thermal Stability

Directory of Open Access Journals (Sweden)

Huan Liu

2013-11-01

Full Text Available Fe3O4 spheres with an average size of 273 nm were prepared in the presence of CTAB by a solvothermal method. The spheres were modified by a thin layer of SiO2, and then coated by mesoporous SiO2 (m-SiO2 films, by using TEOS as a precursor and CTAB as a soft template. The resulting m-SiO2/Fe3O4 spheres, with an average particle size of 320 nm, a high surface area (656 m2/g, and ordered nanopores (average pore size 2.5 nm, were loaded with gold nanoparticles (average size 3.3 nm. The presence of m-SiO2 coating could stabilize gold nanoparticles against sintering at 500 °C. The material showed better performance than a conventional Au/SiO2 catalyst in catalytic reduction of p-nitrophenol with NaBH4. It can be separated from the reaction mixture by a magnet and be recycled without obvious loss of catalytic activity. Relevant characterization by XRD, TEM, N2 adsorption-desorption, and magnetic measurements were conducted.

Browse Title Index

African Journals Online (AJOL)

Items 151 - 200 of 273 ... Vol 11, No 4 (2016), Numerical solutions of fifth order boundary ... F – statistic: an example of sales distribution of pharmaceutical drugs, Abstract PDF ... Vol 12, No 4 (2017), Optimization of traffic light control system of an ...

Fasting leptin and appetite responses induced by a 4-day 65%-energy-restricted diet.

Science.gov (United States)

Mars, M; de Graaf, C; de Groot, C P G M; van Rossum, C T M; Kok, F J

2006-01-01

Animal studies show that the leptin decline after acute severe caloric restriction is a peripheral signal to increase food intake. However, most human studies have failed to observe such a relationship. We studied the acute effects of severe caloric restriction on the association between serum leptin concentrations and subjective appetite. A total of 44 healthy adult men (aged: 43 +/- 5 years; BMI: 27.3 +/- 3.2 kg/m(2)). Fasting serum leptin concentrations and self-perceived appetite levels were measured during a 4-day diet containing 36% of the estimated energy requirements. Appetite levels were assessed with a 10-point Likert scale, reflecting hunger, fullness, desire to eat, prospective consumption and total appetite. After the 4-day energy deficit, fasting leptin concentrations decreased by 39.4% (95% CI: -43.6; -34.9%). This decline was associated with an increase in fasting hunger (r = -0.42; P < 0.01), desire to eat (r = -0.39; P < 0.05) and total appetite (r = -0.38; P < 0.05). Furthermore, the association between fasting leptin concentrations and fasting appetite levels became stronger during the energy restriction period (for total appetite: day 0 r = -0.15, P = 0.32; day 2 r = -0.31, P =< 0.05; day 4 r = -0.41, P < 0.01). The acute proportional reduction in fasting leptin after 4-day energy restriction is associated with an increase in self-perceived appetite. Additionally, the inverse association between proportional fasting leptin concentrations and self-perceived appetite response becomes stronger as energy restriction is prolonged. These findings suggest that leptin has an instrumental role in restoring energy balance in humans through the expression of appetite.

Dicty_cDB: Contig-U03072-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library

Analysis of cardiac myosin binding protein-C phosphorylation in human heart muscle.

Science.gov (United States)

Copeland, O'Neal; Sadayappan, Sakthivel; Messer, Andrew E; Steinen, Ger J M; van der Velden, Jolanda; Marston, Steven B

2010-12-01

A unique feature of MyBP-C in cardiac muscle is that it has multiple phosphorylation sites. MyBP-C phosphorylation, predominantly by PKA, plays an essential role in modulating contractility as part of the cellular response to β-adrenergic stimulation. In vitro studies indicate MyBP-C can be phosphorylated at Serine 273, 282, 302 and 307 (mouse sequence) but little is known about the level of MyBP-C phosphorylation or the sites phosphorylated in heart muscle. Since current methodologies are limited in specificity and are not quantitative we have investigated the use of phosphate affinity SDS-PAGE together with a total anti MyBP-C antibody and a range of phosphorylation site-specific antibodies for the main sites (Ser-273, -282 and -302). With these newly developed methods we have been able to make a detailed quantitative analysis of MyBP-C phosphorylation in heart tissue in situ. We have found that MyBP-C is highly phosphorylated in non-failing human (donor) heart or mouse heart; tris and tetra-phosphorylated species predominate and less than 10% of MyBP-C is unphosphorylated (0, 9.3 ± 1%: 1P, 13.4 ± 2.7%: 2P, 10.5 ± 3.3%: 3P, 28.7 ± 3.7%: 4P, 36.4 ± 2.7%, n=21). Total phosphorylation was 2.7 ± 0.07 mol Pi/mol MyBP-C. In contrast in failing heart and in myectomy samples from HCM patients the majority of MyBP-C was unphosphorylated. Total phosphorylation levels were 23% of normal in failing heart myofibrils (0, 60.1 ± 2.8%: 1P, 27.8 ± 2.8%: 2P, 4.8 ± 2.0%: 3P, 3.7 ± 1.2%: 4P, 2.8 ± 1.3%, n=19) and 39% of normal in myectomy samples. The site-specific antibodies showed a distinctive distribution pattern of phosphorylation sites in the multiple phosphorylation level species. We found that phosphorylated Ser-273, Ser-282 and Ser-302 were all present in the 4P band of MyBP-C but none of them were significant in the 1P band, indicating that there must be at least one other site of MyBP-C phosphorylation in human heart. The pattern of phosphorylation at the

4.5 Tesla magnetic field reduces range of high-energy positrons -- Potential implications for positron emission tomography

International Nuclear Information System (INIS)

Wirrwar, A.; Vosberg, H.; Herzog, H.; Halling, H.; Weber, S.; Mueller-Gaertner, H.W.; Forschungszentrum Juelich GmbH

1997-01-01

The authors have theoretically and experimentally investigated the extent to which homogeneous magnetic fields up to 7 Tesla reduce the spatial distance positrons travel before annihilation (positron range). Computer simulations of a noncoincident detector design using a Monte Carlo algorithm calculated the positron range as a function of positron energy and magnetic field strength. The simulation predicted improvements in resolution, defined as full-width at half-maximum (FWHM) of the line-spread function (LSF) for a magnetic field strength up to 7 Tesla: negligible for F-18, from 3.35 mm to 2.73 mm for Ga-68 and from 3.66 mm to 2.68 mm for Rb-82. Also a substantial noise suppression was observed, described by the full-width at tenth-maximum (FWTM) for higher positron energies. The experimental approach confirmed an improvement in resolution for Ga-68 from 3.54 mm at 0 Tesla to 2.99 mm FWHM at 4.5 Tesla and practically no improvement for F-18 (2.97 mm at 0 Tesla and 2.95 mm at 4.5 Tesla). It is concluded that the simulation model is appropriate and that a homogeneous static magnetic field of 4.5 Tesla reduces the range of high-energy positrons to an extent that may improve spatial resolution in positron emission tomography

Solution of the Skyrme-Hartree–Fock–Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VIII) HFODD (v2.73y): A new version of the program

International Nuclear Information System (INIS)

Schunck, N.; Dobaczewski, J.

2017-01-01

Here, we describe the new version (v2.73y) of the code hfodd which solves the nuclear Skyrme Hartree–Fock or Skyrme Hartree–Fock–Bogolyubov problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following new features: (i) full proton–neutron mixing in the particle–hole channel for Skyrme functionals, (ii) the Gogny force in both particle–hole and particle–particle channels, (iii) linear multi-constraint method at finite temperature, (iv) fission toolkit including the constraint on the number of particles in the neck between two fragments, calculation of the interaction energy between fragments, and calculation of the nuclear and Coulomb energy of each fragment, (v) the new version 200d of the code hfbtho, together with an enhanced interface between HFBTHO and HFODD, (vi) parallel capabilities, significantly extended by adding several restart options for large-scale jobs, (vii) the Lipkin translational energy correction method with pairing, (viii) higher-order Lipkin particle-number corrections, (ix) interface to a program plotting single-particle energies or Routhians, (x) strong-force isospin-symmetry-breaking terms, and (xi) the Augmented Lagrangian Method for calculations with 3D constraints on angular momentum and isospin. Finally, an important bug related to the calculation of the entropy at finite temperature and several other little significant errors of the previous published version were corrected.

Crystal structure, IR and Mössbauer spectroscopy and magnetic properties of KZnFe(PO{sub 4}){sub 2} related to the zeolite-ABW-like compounds

Energy Technology Data Exchange (ETDEWEB)

Badri, Abdessalem [UR Matériaux Inorganiques, Faculté des Sciences, Université de Monastir, Monastir 5019 (Tunisia); Hidouri, Mourad, E-mail: mourad_hidouri@yahoo.fr [UR Matériaux Inorganiques, Faculté des Sciences, Université de Monastir, Monastir 5019 (Tunisia); Wattiaux, Alain [Institut de Chimie de la Matière Condensée de Bordeaux, CNRS, Université de Bordeaux I, 87 Avenue du Dr. A. Schweitzer, Pessac-Cedex 33608 (France); López, María Luisa; Veiga, María Luisa [Departamento de Química Inorgánica I, Facultad de Ciencias Químicas, Universidad Complutense, Madrid 28040 (Spain); Amara, Mongi Ben [UR Matériaux Inorganiques, Faculté des Sciences, Université de Monastir, Monastir 5019 (Tunisia)

2014-07-01

Highlights: • The reported structure of KZnFe(PO{sub 4}){sub 2} is closely related to the zeolite ABW-type. • The structure is described in detail. • The IR and Mössbauer spectroscopy results are reported. • The magnetic properties are developed. - Abstract: The new iron phosphate KZnFe(PO{sub 4}){sub 2} has been synthesized by flux method and solid state reaction, and characterized by X-ray diffraction, IR, Mössbauer spectroscopy and magnetic susceptibility. This compound crystallizes in the monoclinic space group C2/c with the cell parameters: a = 13.514(4) Å, b = 13.273(6) Å, c = 8.742(3) Å and β = 100.07(2)°. It displays strong similarities with the phosphates KCoAl(PO{sub 4}){sub 2} and NaCoPO{sub 4} and features some analogies with the zeolite-ABW structural type. 3D framework is built up by a corner-sharing between MO{sub 4} (M = 0.5 Zn + 0.5 Fe) and PO{sub 4} tetrahedra. The K{sup +} ions are found within crossing tunnels perpendicular to the (1 0 0), (0 1 0) and (0 0 1) planes, delimited by this framework. A Mössbauer study confirmed the presence of Fe{sup 3+} ions in a tetrahedral environment. Magnetic measurements revealed an antiferromagnetic behavior with T{sub N} = 8.5 K.

Abelovu cenu za matematiku získal v roce 2014 Jakov G. Sinaj

Czech Academy of Sciences Publication Activity Database

Křížek, Michal

2014-01-01

Roč. 59, č. 4 (2014), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : billiards * entropy * binary sequences Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144076

Fast glomerular quantification of whole ex vivo mouse kidneys using Magnetic Resonance Imaging at 9.4 Tesla

Energy Technology Data Exchange (ETDEWEB)

Chacon-Caldera, Jorge; Kraemer, Philipp; Schad, Lothar R. [Heidelberg Univ., Mannheim (Germany). Computer Assisted Clinical Medicine; Geraci, Stefania; Gretz, Norbert [Heidelberg Univ., Mannheim (Germany). Medical Research Centre; Cullen-McEwen, Luise; Bertram, John F. [Monash Univ., Melbourne, VIC (Australia). Development and Stem Cells Program and Dept. of Anatomy and Developmental Biology

2016-05-01

A method to measure total glomerular number (N{sub glom}) in whole mouse kidneys using MRI is presented. The method relies on efficient acquisition times. A 9.4 T preclinical MRI system with a surface cryogenic coil and a 3D gradient echo sequence were used to image nine whole ex vivo BALB/c mouse kidneys labelled with cationized-ferritin (CF). A novel method to segment the glomeruli was developed. The quantification of glomeruli was achieved by identifying and fitting the probability distribution of glomeruli thus reducing variations due to noise. For validation, N{sub glom} of the same kidneys were also obtained using the gold standard: design-based stereology. Excellent agreement was found between the MRI and stereological measurements of N{sub glom}, with values differing by less than 4%: (mean ± SD) MRI = 15 606 ± 1 178; stereology = 16 273 ± 1 523. Using a robust segmentation method and a reliable quantification method, it was possible to acquire N{sub glom} with a scanning time of 33 minutes and 20 seconds. This was more than 8 times faster than previously presented MRI-based methods. Thus, an efficient approach to measure N{sub glom} ex vivo in health and disease is provided.

The Role of PAI-1 4G/5G Promoter Polymorphism and Its Levels in the Development of Ischemic Stroke in Young Indian Population.

Science.gov (United States)

Akhter, Mohammad Suhail; Biswas, Arijit; Abdullah, Saleh Mohammed; Behari, Madhuri; Saxena, Renu

2017-11-01

The plasminogen activator inhibitor-1 (PAI-1) gene has been found to be associated with the pathogenesis and progression of vascular diseases including stroke. A 4G/5G, PAI-1 gene polymorphism has been found to be associated with the plasma PAI-1 levels in different ethnic populations but results are still controversial. The aim of this study was to determine the potential association of 4G/5G polymorphism and plasma PAI-1 levels in the development of ischemic stroke (IS) in young Asian Indians. One hundred patients with IS and an equal number of age- and sex-matched controls were studied. The 4G/5G polymorphism was genotyped in the study population through allele-specific polymerase chain reaction. Plasma PAI-1 levels were evaluated using a commercial kit. The PAI-1 levels were significantly higher in patients when compared to the controls ( P = .03). The variant 4G allele for the PAI-I 4G/5G polymorphism showed both genotypic ( P = .0013, χ 2 = 10.303; odds ratio [OR] = 3.75) as well as allelic association ( P = .0004, χ 2 = 12.273; OR = 1.99) with IS. The homozygous variant 4G/4G also was found to be associated with the higher PAI-1 levels (0.005). The variant allele 4G of PAI-1 4G/5G polymorphism and higher plasma PAI-1 levels were found to be significantly associated with IS in young Asian Indians.

Adsorption mechanism of magnetically separable Fe{sub 3}O{sub 4}/graphene oxide hybrids

Energy Technology Data Exchange (ETDEWEB)

Ouyang, Ke [Department of Chemical and Environment Engineering, Wuyi University, Jiangmen, Guangdong 529020 (China); Zhu, Chuanhe [Department of Civil, Construction and Environmental Engineering, Department of Chemical and Biological Engineering, Iowa State University, Ames, IA 50011 (United States); Zhao, Ya; Wang, Leichao [Department of Chemical and Environment Engineering, Wuyi University, Jiangmen, Guangdong 529020 (China); Xie, Shan, E-mail: wyuchemxs@126.com [Department of Chemical and Environment Engineering, Wuyi University, Jiangmen, Guangdong 529020 (China); Wang, Qun, E-mail: qunwang@iastate.edu [Department of Civil, Construction and Environmental Engineering, Department of Chemical and Biological Engineering, Iowa State University, Ames, IA 50011 (United States)

2015-11-15

Graphical abstract: A recyclable Fe{sub 3}O{sub 4}/graphene oxide (GO) magnetic hybrid was successfully synthesized via a facile one-pot polylol approach and exhibited an effective adsorption of BPA in aqueous solution. - Highlights: • Magnetically separable Fe{sub 3}O{sub 4}/GO hybrids were synthesized via a facile one-pot polylol approach. • The Fe{sub 3}O{sub 4}/GO hybrid could be easily recovered and met the need of magnetic separation, exhibiting excellent reproducibility and reusability. • The hybrids showed excellent adsorption ability for bisphenol A in aqueous solution. • The effect of pH value, temperature and coexisting ions on the adsorption was studied. • π–π interactions were postulated to be the primary mechanisms of adsorption of BPA on Fe{sub 3}O{sub 4}/GO hybrids. - Abstract: A reclaimable Fe{sub 3}O{sub 4}/graphene oxide (GO) magnetic hybrid was successfully synthesized via a facile one-pot polyol approach and employed as a recyclable adsorbent for Bisphenol A (BPA) in aqueous solutions. The maximum adsorption capacity (q{sub m}) of the Fe{sub 3}O{sub 4}/GO hybrid for BPA was 72.80 mg/g at 273 K. The kinetics of the adsorption process and the adsorption isotherm data were fitted using the Freundlich equation and a pseudo-second-order kinetic model. The results of the thermodynamic parameters ΔH°, ΔS° and ΔG° showed that the adsorption process was exothermic and spontaneous. Furthermore, the reusability of the samples was investigated, and the results indicated that the samples exhibited high stability. The magnetic characterization demonstrated that hybrids were superparamagnetic and could be recovered conveniently by magnetic separation. The strong π–π interaction was determined to be the predominant driving force behind the adsorption of BPA onto the Fe{sub 3}O{sub 4}/GO hybrid. Therefore, the Fe{sub 3}O{sub 4}/GO hybrid could be regarded as a potential adsorbent for wastewater treatment and purification processes.

Assessment of myocardial infarction in mice by Late Gadolinium Enhancement MR imaging using an inversion recovery pulse sequence at 9.4T

Directory of Open Access Journals (Sweden)

Herlihy Amy H

2008-01-01

Full Text Available Abstract Purpose To demonstrate the feasibility of using an inversion recovery pulse sequence and to define the optimal inversion time (TI to assess myocardial infarction in mice by late gadolinium enhancement (LGE MRI at 9.4T, and to obtain the maximal contrast between the infarcted and the viable myocardium. Methods MRI was performed at 9.4T in mice, two days after induction of myocardial infarction (n = 4. For cardiovascular MR imaging, a segmented magnetization-prepared fast low angle shot (MP-FLASH sequence was used with varied TIs ranging from 40 to 420 ms following administration of gadolinium-DTPA at 0.6 mmol/kg. Contrast-to-noise (CNR and signal-to-noise ratio (SNR were measured and compared for each myocardial region of interest (ROI. Results The optimal TI, which corresponded to a minimum SNR in the normal myocardium, was 268 ms ± 27.3. The SNR in the viable myocardium was significantly different from that found in the infarcted myocardium (17.2 ± 2.4 vs 82.1 ± 10.8; p = 0.006 leading to a maximal relative SI (Signal Intensity between those two areas (344.9 ± 60.4. Conclusion Despite the rapid heart rate in mice, our study demonstrates that LGE MRI can be performed at 9.4T using a protocol similar to the one used for clinical MR diagnosis of myocardial infarction.

V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

Czech Academy of Sciences Publication Activity Database

Křížek, Michal; Markl, Martin; Somer, L.

2013-01-01

Roč. 58, č. 4 (2013), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

Experiment list: SRX524973 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available SRX524973 hg19 Histone H3K4me1 Uterus Endometrial stromal cells NA 30874750,99.0,35....9,273 GSM1372865: H3K4me1 case2 w/ EP; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

Enhancement of local species richness in tundra by seed dispersal through guts of muskox and barnacle goose

DEFF Research Database (Denmark)

Bruun, Hans Henrik; Lundgren, Rebekka; Philipp, Marianne

2008-01-01

The potential contribution of vertebrate-mediated seed rain to the maintenance of plant community richness in a High Arctic ecosystem was investigated. We analyzed viable seed content in dung of the four numerically most important terrestrial vertebrates in Northeast Greenland - muskox (Ovibos...... moschatus), barnacle goose (Branta leucopsis), Arctic fox (Alopex lagopus) and Arctic hare (Lepus arcticus). High numbers of plant propagules were found in the dung of muskox and barnacle goose. Seeds of many plant species were found in the faeces of one vertebrate species only. Propagule composition...... in barnacle goose droppings was relatively uniform over samples, with a high abundance of the nutritious bulbils of Polygonum viviparum (Bistorta vivipara), suggesting that geese have a narrow habitat preference and feed selectively. Propagule composition in muskox dung was diverse and heterogeneous among...

Characterization of the diatomite binding domain in the ribosomal protein L2 from E. coli and functions as an affinity tag.

Science.gov (United States)

Li, Junhua; Zhang, Yang; Yang, Yanjun

2013-03-01

The ribosomal protein L2, a constituent protein of the 50S large ribosomal subunit, can be used as Si-tag using silica particles for the immobilization and purification of recombinant proteins (Ikeda et al. (Protein Expr Purif 71:91-95, 2010); Taniguchi et al. (Biotechnol Bioeng 96:1023-1029, 2007)). We applied a diatomite powder, a sedimentary rock mainly composed with diatoms silica, as an affinity solid phase and small ubiquitin-like modifier (SUMO) technology to release a target protein from the solid phase. The L2 (203-273) was the sufficient region for the adsorption of ribosomal protein L2 on diatomite. We comparatively analyzed the different adsorption properties of the two deleted proteins of L2 (L2 (1-60, 203-273) and L2 (203-273)) on diatomite. The time required to reach adsorption equilibrium of L2 (203-273) fusion protein on diatomite was shorter than that of L2 (1-60, 203-273) fusion protein. The maximum adsorption capacity of L2 (203-273) fusion protein was larger than that of L2 (1-60, 203-273) fusion protein. In order to study whether the L2 (203-273) can function as an affinity purification tag, SUMO was introduced as one specific protease cleavage site between the target protein and the purification tags. The L2 (203-273) and SUMO fusion protein purification method was tested using enhanced green fluorescent protein as a model protein; the result shows that the purification performance of this affinity purification method was good. The strong adsorption characteristic of L2 (203-273) on diatomite also provides a potential protein fusion tag for the immobilization of enzyme.

β-1,3-1,4-glucanase gene from Bacillus velezensis ZJ20 exerts antifungal effect on plant pathogenic fungi.

Science.gov (United States)

Xu, Ting; Zhu, Tianhui; Li, Shujiang

2016-02-01

Bacillus velezensis is a known antifungal bacteria. To understand the role of β-1, 3-1, 4-glucanase played on B. velezensis about the mechanism which exerts effect on fungi, we isolated and cloned the β-1, 3-1, 4-glucanase gene (Bglu1) from B. velezensis ZJ20. The Bglu1 open reading frame was 732 bp that encoded a protein with 243 amino acids and a calculated molecular weight of 27.3 kDa. The same gene without the signal peptide, termed Bglu2, was also cloned and expressed in E. coli BL21. Among the two variants, only Bglu2 protein was expressed. Purified Bglu2 could be eluted with imidazole solution at concentrations ranging from 100 to 500 mM although the highest expression was observed at 150 and 200 mM and the purest was at 500 mM. In addition, activity of the crude enzyme was 1527 U ml(-1) and the highest activity of the purified enzyme was 1706 U ml(-1). The purified β-1, 3-1, 4-glucanase had activity on a wide range of pH and temperatures and displayed optimal activity at pH 5.0 and 35 °C. More importantly, the mycelial morphology of three pathogenic fungi was destroyed by the purified β-1, 3-1, 4-glucanase. In conclusion, β-1, 3-1, 4-glucanase from B. velezensis ZJ20 can be highly expressed in E. coli BL21 and the recombinant protein is pathogenic to fungi.

assessment of traffic flow on enugu highways using speed density

African Journals Online (AJOL)

HOD

Corresponding author, tel: +234 – 806 – 435 – 0200 ... construction, maintenance and optimization of the highways using the ...... Research Part A: Policy and Practice 29(4), 273-281. 1995. ... relationships: Quality and Theory of Traffic Flow.

Direct electrochemistry of hemoglobin entrapped in dextran film on ...

Indian Academy of Sciences (India)

Administrator

28. Li et al used single- walled carbon nanotube (SWCNT) and 1-hexyl-3- ... Electrochemistry of dextran/hemoglobin/carbon ionic liquid electrode. 273. 2.4 Procedures ..... used for the construction of H2O2 biosensor. Acknowledgement.

Effect of gamma irradiation on microbiological quality of japanese chicken meat and microflora change of irradiated chicken

International Nuclear Information System (INIS)

Prachasitthisak, Y.; Ito, H.

1996-01-01

The impact of gamma irradiation with doses between 0 and 8 kGy on microbiological quality of chicken meat produced in Japan and micro flora change of irradiated chicken meat were studied. Radiation at the dose 2 kGy resulted in 4 log cycles reduction of total aerobic bacteria, 5 - 6 log cycles reduction of lactic acid bacteria and 2 log cycles reduction of fungi and yeasts. For the coliforms, it could be eliminated below detectable level by irradiation dose of 1 kGy. For the chicken flora-analysis, it was found that chicken of each area had their own specific microbial community structure. Flavobacterium and Pseudomonas were found to be dominant organisms in the microflora of Japanese chicken meat. Irradiation with dose 2 kGy resulted in disappearance of Lactobacillus and Pseudomonas. The microorganisms which dominated in irradiated chickens with doses of 2 kGy and higher were Psychrobacter and yeast. These studies support the view that radiation improves the microbiological quality of chicken meat and substantiate that radiation does not present hazard resulting from a change in the microflora of irradiated chicken

Birth order and sibship composition as predictors of overweight or obesity among low-income 4- to 8-year-old children.

Science.gov (United States)

Mosli, R H; Miller, A L; Peterson, K E; Kaciroti, N; Rosenblum, K; Baylin, A; Lumeng, J C

2016-02-01

This study aimed to examine the association of birth order and number and sex of siblings with overweight or obesity among 4- to 8-year-olds. This is a cross-sectional study involving 273 low-income mother-child dyads. Questionnaires and anthropometry were completed. Multiple logistic regression was used to examine the association of birth order, having younger siblings, having older siblings, having at least one brother and having at least one sister with odds of overweight or obesity. Analyses were repeated to additionally include non-biological siblings. Models were adjusted for potential confounders and intermediate variables. Prevalence of child overweight or obesity was 42.5%. Adjusting for covariates, only children and youngest siblings had higher odds of overweight or obesity compared with oldest siblings (odds ratio [OR]: 4.18, 95% confidence interval [CI]: 1.67, 10.46 and OR: 3.21, 95% CI: 1.41, 7.33, respectively). Having one or more younger siblings and having at least one brother were associated with lower odds (OR: 0.38, 95% CI: 0.21, 0.69 and OR: 0.47, 95% CI: 0.28, 0.81, respectively). Including non-biological siblings did not meaningfully change the associations. Birth order and sibship composition are associated with overweight or obesity among 4- to 8-year-olds. Future studies identifying the underlying behavioural mechanism can help inform family-based intervention programmes. © 2015 World Obesity.

Design of glycopeptides used to investigate class II MHC binding and T-cell responses associated with autoimmune arthritis.

Directory of Open Access Journals (Sweden)

Ida E Andersson

Full Text Available The glycopeptide fragment CII259-273 from type II collagen (CII binds to the murine A(q and human DR4 class II Major Histocompatibility Complex (MHC II proteins, which are associated with development of murine collagen-induced arthritis (CIA and rheumatoid arthritis (RA, respectively. It has been shown that CII259-273 can be used in therapeutic vaccination of CIA. This glycopeptide also elicits responses from T-cells obtained from RA patients, which indicates that it has an important role in RA as well. We now present a methodology for studies of (glycopeptide-receptor interactions based on a combination of structure-based virtual screening, ligand-based statistical molecular design and biological evaluations. This methodology included the design of a CII259-273 glycopeptide library in which two anchor positions crucial for binding in pockets of A(q and DR4 were varied. Synthesis and biological evaluation of the designed glycopeptides provided novel structure-activity relationship (SAR understanding of binding to A(q and DR4. Glycopeptides that retained high affinities for these MHC II proteins and induced strong responses in panels of T-cell hybridomas were also identified. An analysis of all the responses revealed groups of glycopeptides with different response patterns that are of high interest for vaccination studies in CIA. Moreover, the SAR understanding obtained in this study provides a platform for the design of second-generation glycopeptides with tuned MHC affinities and T-cell responses.

Benchmark calculations with correlated molecular wave functions. VII. Binding energy and structure of the HF dimer

International Nuclear Information System (INIS)

Peterson, K.A.; Dunning, T.H. Jr.

1995-01-01

The hydrogen bond energy and geometry of the HF dimer have been investigated using the series of correlation consistent basis sets from aug-cc-pVDZ to aug-cc-pVQZ and several theoretical methods including Moller--Plesset perturbation and coupled cluster theories. Estimates of the complete basis set (CBS) limit have been derived for the binding energy of (HF) 2 at each level of theory by utilizing the regular convergence characteristics of the correlation consistent basis sets. CBS limit hydrogen bond energies of 3.72, 4.53, 4.55, and 4.60 kcal/mol are estimated at the SCF, MP2, MP4, and CCSD(T) levels of theory, respectively. CBS limits for the intermolecular F--F distance are estimated to be 2.82, 2.74, 2.73, and 2.73 A, respectively, for the same correlation methods. The effects of basis set superposition error (BSSE) on both the binding energies and structures have also been investigated for each basis set using the standard function counterpoise (CP) method. While BSSE has a negligible effect on the intramolecular geometries, the CP-corrected F--F distance and binding energy differ significantly from the uncorrected values for the aug-cc-pVDZ basis set; these differences decrease regularly with increasing basis set size, yielding the same limits in the CBS limit. Best estimates for the equilibrium properties of the HF dimer from CCSD(T) calculations are D e =4.60 kcal/mol, R FF =2.73 A, r 1 =0.922 A, r 2 =0.920 A, Θ 1 =7 degree, and Θ 2 =111 degree

Association of STAT4 with rheumatoid arthritis: a replication study in three European populations.

Science.gov (United States)

Orozco, Gisela; Alizadeh, Behrooz Z; Delgado-Vega, Angélica M; González-Gay, Miguel A; Balsa, Alejandro; Pascual-Salcedo, Dora; Fernández-Gutierrez, Benjamín; González-Escribano, María F; Petersson, Ingemar F; van Riel, Piet L C M; Barrera, Pilar; Coenen, Marieke J H; Radstake, Timothy R D J; van Leeuwen, Miek A; Wijmenga, Cisca; Koeleman, Bobby P C; Alarcón-Riquelme, Marta; Martín, Javier

2008-07-01

This study was undertaken to investigate the previously reported association of the STAT4 polymorphism rs7574865 with rheumatoid arthritis (RA) in 3 different European populations from Spain, Sweden, and The Netherlands, comprising a total of 2,072 patients and 2,474 controls. Three different cohorts were included in the study: 923 RA patients and 1,296 healthy controls from Spain, 273 RA patients and 285 healthy controls from Sweden, and 876 RA patients and 893 healthy controls from The Netherlands. DNA from patients and controls was obtained from peripheral blood. Samples were genotyped for the STAT4 single-nucleotide polymorphism rs7574865 using a TaqMan 5'-allele discrimination assay. The chi-square test was performed to compare allele and genotype distributions. Odds ratios (ORs) and 95% confidence intervals (95% CIs) were calculated. We observed a significantly increased frequency of the minor T allele in RA patients compared with healthy controls in the Spanish population (24.8% versus 20.8%; P = 0.001, OR 1.26 [95% CI 1.09-1.45]). This association was confirmed in both the Swedish population (P = 0.03, OR 1.35 [95% CI 1.03-1.77]) and the Dutch population (P = 0.03, OR 1.45 [95% CI 1.21-1.73]). The overall P value for all 3 populations was 9.79 x 10(-6) (OR 1.25 [95% CI 1.13-1.37]). No association between rs7574865 and the presence of rheumatoid factor or anti-cyclic citrullinated peptide autoantibodies was observed. A meta-analysis of all published STAT4 associations revealed an OR of 1.25 (95% CI 1.19-1.33) (P = 1 x 10(-5)). Our findings indicate an association between the STAT4 polymorphism rs7574865 and RA in 3 different populations, from Spain, Sweden, and The Netherlands, thereby confirming previous data.

K problému univerzalistických pretenzí v etice. Formalismus a některé pokusy o založení hodnotové etiky

Czech Academy of Sciences Publication Activity Database

Hála, Vlastimil

2007-01-01

Roč. 62, č. 4 (2007), s. 273-281 ISSN 0046-385X R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : ethics * values * universalism Subject RIV: AA - Philosophy ; Religion

Chromatographic enrichment of isotopes in hydrogen and water samples on palladium

International Nuclear Information System (INIS)

Andreev, B.M.; Polevoi, A.S.; Perevezentsev, A.N.

1987-01-01

Data on the isotopic enrichment of hydrogen and water samples by chromatography on palladium have been analyzed. Experimental data on the effect of temperature, hydrogen flow, volume of the enriched fraction, and length of the chromatographic column on the degree of separation attainable in the column have been obtained. It has been shown that the maximum separation achievable (regardless of the type of the isotope mixture) at 273 K falls with increase of hydrogen flow and volume of the enriched gas fraction recoverable from the column. A separation degree of ∼ 1040 has been achieved for a mixture of protium and deuterium in a 10-mm wide and 0.6-m long chromatographic column packed with palladium black with a grain size of 0.2-0.5 mm at 273 K and a specific hydrogen flow of 1.22 mole/m 2 x sec. For a protium-tritium mixture a separation degree of ∼ 90 has been reached in a similar column at 273 K and a specific hydrogen flow of 0.4 mole/m 2 x sec

Amorphous TiO2 doped with carbon for visible light photodegradation of rhodamine B and 4-chlorophenol

International Nuclear Information System (INIS)

Shao, Penghui; Tian, Jiayu; Zhao, Zhiwei; Shi, Wenxin; Gao, Shanshan; Cui, Fuyi

2015-01-01

Graphical abstract: - Highlights: • Amorphous TiO 2 doped with carbon is prepared as a visible photocatalyst. • RhB and 4-chlorophenol are decomposed effectively by carbon-doped amorphous TiO 2 . • The mechanism for visible light photocatalysis is discussed detailedly. - Abstract: Visible light photocatalytic activity of amorphous TiO 2 doped with carbon is prepared by a facile sol-gel route for the first time. The most active sample with mesostructure of amorphous phase, high surface area (273 m 2 g −1 ) and large pore volume (0.33 cm 3 g −1 ) is identified by X-ray diffractometer, Raman spectrometer, transmission electron microscope and N 2 adsorption–desorption isotherms. In addition, the most active sample is characterized by Fourier transform-infrared spectrometer, X-ray photoelectron spectrometer, UV–vis diffuse reflectance spectrometer and luminescence spectrometer. The results show that the most active sample with oxygenic groups has a narrower bandgap and lower recombination of electron–hole, due to the carbon doping and phase of amorphous. Effective photodegradation capability and stability of rhodamine B and colorless 4-chlorophenol are verified by photocatalytic tests under visible light irradiation. A possible mechanism of amorphous TiO 2 doped with carbon for visible light photocatalysis is proposed. The findings of this paper will provide new insights to design visible light-induced photocatalyst based on amorphous TiO 2 for organic removal

Serotype markers in a Streptococcus agalactiae strain collection from Zimbabwe

Directory of Open Access Journals (Sweden)

Mavenyengwa R

2010-01-01

Full Text Available Objective: Group B streptococci (GBS from Southern African areas have been less well characterized. Our objective was to study serotype and serovariant distribution of carrier GBS strains as part of a study of the epidemiology of GBS carriage in pregnant women from Zimbabwe. Materials and Methods: We studied GBS isolated from 121 healthy pregnant women living in Harare and surrounding areas, Zimbabwe. Capsular polysaccharide (CPS testing for serotype determination and surface-anchored protein testing for serosubtype determination were done by gene-based serotyping (PCR, except for the proteins R3 and a novel protein called Z, which were detected by antibody-based methods. Results: Strains of the CPS types Ia (15.7%, Ib (11.6%, II (8.3%, III (38.8%, V (24.0% and NT (1.7% were detected along with the strain-variable proteins Cί (15.7% of isolates, Cα (19.8%, Alp1 (epsilon-22.3%, Alp3 (5.0%, R4/Rib (46.3%, R3 (27.3%, Z (27.3%, and SAR5 (28.9%, which encodes the R5 protein. Up to four of the protein genes could be possessed or the gene product expressed by one and the same isolate. A total of 32 serovariants were detected. The findings assessed by us as most important were the very low prevalence of the gene Alp3 (Alp3 - 4.9%, high prevalence of R4 (Rib - 46.2%, the proteins R3 (27.3%, Z (27.3%, and of SAR5 (R5 - 28.9%. The low prevalence of Alp3, notably in GBS type V strains, differed from findings with CPS type V GBS from non-African areas. Bacteria of the various CPS types showed distinct CPS/protein-marker associations. Conclusion: The results are of importance in relation to regional variations of GBS phenotypes and genotypes and thus, of importance in planning and research in the context of future vaccine formulations.

49 CFR 192.150 - Passage of internal inspection devices.

Science.gov (United States)

2010-10-01

... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY... transmission lines 103/4 inches (273 millimeters) or more in outside diameter on which construction begins... on investigation or experience, that there is no reasonably practical alternative under the design...

Synthesis and characterization of Co3O4 and its performance for the detachment reaction of oxygen

International Nuclear Information System (INIS)

Morales G, P.; Fernandez V, S.M.

2001-01-01

The cobaltous cobaltic oxide was synthesized by the sol-gel technique. Therefore first the cobalt maleate was synthesized. The temperature of decarboxylation was determined by thermogravimetry. The obtained compound was characterized by X-ray diffraction, scanning electron microscopy Sem and the X-ray dispersive energy. The electrochemical tests were realized with a 273A potensiostate galvanostate, by using an electrochemical cell of three electrodes. The cobaltous cobaltic oxide prepared by this method, presented a major activity for the oxide detachment that those reported in the literature. (Author)

Microbial community in high arsenic shallow groundwater aquifers in Hetao Basin of Inner Mongolia, China.

Directory of Open Access Journals (Sweden)

Ping Li

Full Text Available A survey was carried out on the microbial community of 20 groundwater samples (4 low and 16 high arsenic groundwater and 19 sediments from three boreholes (two high arsenic and one low arsenic boreholes in a high arsenic groundwater system located in Hetao Basin, Inner Mongolia, using the 454 pyrosequencing approach. A total of 233,704 sequence reads were obtained and classified into 12-267 operational taxonomic units (OTUs. Groundwater and sediment samples were divided into low and high arsenic groups based on measured geochemical parameters and microbial communities, by hierarchical clustering and principal coordinates analysis. Richness and diversity of the microbial communities in high arsenic sediments are higher than those in high arsenic groundwater. Microbial community structure was significantly different either between low and high arsenic samples or between groundwater and sediments. Acinetobacter, Pseudomonas, Psychrobacter and Alishewanella were the top four genera in high arsenic groundwater, while Thiobacillus, Pseudomonas, Hydrogenophaga, Enterobacteriaceae, Sulfuricurvum and Arthrobacter dominated high arsenic sediments. Archaeal sequences in high arsenic groundwater were mostly related to methanogens. Biota-environment matching and co-inertia analyses showed that arsenic, total organic carbon, SO4(2-, SO4(2-/total sulfur ratio, and Fe(2+ were important environmental factors shaping the observed microbial communities. The results of this study expand our current understanding of microbial ecology in high arsenic groundwater aquifers and emphasize the potential importance of microbes in arsenic transformation in the Hetao Basin, Inner Mongolia.

Microbial community in high arsenic shallow groundwater aquifers in Hetao Basin of Inner Mongolia, China.

Science.gov (United States)

Li, Ping; Wang, Yanhong; Dai, Xinyue; Zhang, Rui; Jiang, Zhou; Jiang, Dawei; Wang, Shang; Jiang, Hongchen; Wang, Yanxin; Dong, Hailiang

2015-01-01

A survey was carried out on the microbial community of 20 groundwater samples (4 low and 16 high arsenic groundwater) and 19 sediments from three boreholes (two high arsenic and one low arsenic boreholes) in a high arsenic groundwater system located in Hetao Basin, Inner Mongolia, using the 454 pyrosequencing approach. A total of 233,704 sequence reads were obtained and classified into 12-267 operational taxonomic units (OTUs). Groundwater and sediment samples were divided into low and high arsenic groups based on measured geochemical parameters and microbial communities, by hierarchical clustering and principal coordinates analysis. Richness and diversity of the microbial communities in high arsenic sediments are higher than those in high arsenic groundwater. Microbial community structure was significantly different either between low and high arsenic samples or between groundwater and sediments. Acinetobacter, Pseudomonas, Psychrobacter and Alishewanella were the top four genera in high arsenic groundwater, while Thiobacillus, Pseudomonas, Hydrogenophaga, Enterobacteriaceae, Sulfuricurvum and Arthrobacter dominated high arsenic sediments. Archaeal sequences in high arsenic groundwater were mostly related to methanogens. Biota-environment matching and co-inertia analyses showed that arsenic, total organic carbon, SO4(2-), SO4(2-)/total sulfur ratio, and Fe(2+) were important environmental factors shaping the observed microbial communities. The results of this study expand our current understanding of microbial ecology in high arsenic groundwater aquifers and emphasize the potential importance of microbes in arsenic transformation in the Hetao Basin, Inner Mongolia.

Pilot evaluation of the text4baby mobile health program

Directory of Open Access Journals (Sweden)

Evans William Douglas

2012-11-01

Full Text Available Abstract Background Mobile phone technologies for health promotion and disease prevention have evolved rapidly, but few studies have tested the efficacy of mobile health in full-fledged programs. Text4baby is an example of mobile health based on behavioral theory, and it delivers text messages to traditionally underserved pregnant women and new mothers to change their health, health care beliefs, practices, and behaviors in order to improve clinical outcomes. The purpose of this pilot evaluation study is to assess the efficacy of this text messaging campaign. Methods We conducted a randomized pilot evaluation study. All participants were pregnant women first presenting for care at the Fairfax County, Virginia Health Department. We randomized participants to enroll in text4baby and receive usual health care (intervention, or continue simply to receive usual care (control. We then conducted a 24-item survey by telephone of attitudes and behaviors related to text4baby. We surveyed participants at baseline, before text4baby was delivered to the intervention group, and at follow-up at approximately 28 weeks of baby’s gestational age. Results We completed 123 baseline interviews in English and in Spanish. Overall, the sample was predominantly of Hispanic origin (79.7% with an average age of 27.6 years. We completed 90 follow-up interviews, and achieved a 73% retention rate. We used a logistic generalized estimating equation model to evaluate intervention effects on measured outcomes. We found a significant effect of text4baby intervention exposure on increased agreement with the attitude statement “I am prepared to be a new mother” (OR = 2.73, CI = 1.04, 7.18, p = 0.042 between baseline and follow-up. For those who had attained a high school education or greater, we observed a significantly higher overall agreement to attitudes against alcohol consumption during pregnancy (OR = 2.80, CI = 1.13, 6.90, p = 0.026. We also observed a

The microbiota of water buffalo milk during mastitis.

Science.gov (United States)

Catozzi, Carlotta; Sanchez Bonastre, Armand; Francino, Olga; Lecchi, Cristina; De Carlo, Esterina; Vecchio, Domenico; Martucciello, Alessandra; Fraulo, Pasquale; Bronzo, Valerio; Cuscó, Anna; D'Andreano, Sara; Ceciliani, Fabrizio

2017-01-01

The aim of this study was to define the microbiota of water buffalo milk during sub-clinical and clinical mastitis, as compared to healthy status, by using high-throughput sequencing of the 16S rRNA gene. A total of 137 quarter samples were included in the experimental design: 27 samples derived from healthy, culture negative quarters, with a Somatic Cell Count (SCC) of less than 200,000 cells/ml; 27 samples from quarters with clinical mastitis; 83 samples were collected from quarters with subclinical mastitis, with a SCC number greater of 200,000 cells/ml and/or culture positive for udder pathogens, without clinical signs of mastitis. Bacterial DNA was purified and the 16S rRNA genes were individually amplified and sequenced. Significant differences were found in milk samples from healthy quarters and those with sub-clinical and clinical mastitis. The microbiota diversity of milk from healthy quarters was richer as compared to samples with sub-clinical mastitis, whose microbiota diversity was in turn richer as compared to those from clinical mastitis. The core microbiota of water buffalo milk, defined as the asset of microorganisms shared by all healthy milk samples, includes 15 genera, namely Micrococcus, Propionibacterium, 5-7N15, Solibacillus, Staphylococcus, Aerococcus, Facklamia, Trichococcus, Turicibacter, 02d06, SMB53, Clostridium, Acinetobacter, Psychrobacter and Pseudomonas. Only two genera (Acinetobacter and Pseudomonas) were present in all the samples from sub-clinical mastitis, and no genus was shared across all in clinical mastitis milk samples. The presence of mastitis was found to be related to the change in the relative abundance of genera, such as Psychrobacter, whose relative abundance decreased from 16.26% in the milk samples from healthy quarters to 3.2% in clinical mastitis. Other genera, such as SMB53 and Solibacillus, were decreased as well. Discriminant analysis presents the evidence that the microbial community of healthy and clinical

7 CFR 273.5 - Students.

Science.gov (United States)

2010-01-01

... one natural, adoptive or stepparent (regardless of marital status) is in the same food stamp household... participating in a State or federally financed work study program during the regular school year. (i) To qualify under this provision, the student must be approved for work study at the time of application for food...

40 CFR 273.9 - Definitions.

Science.gov (United States)

2010-07-01

..., metal, or any combination of these materials. Battery means a device consisting of one or more... not limited to, fluorescent, high intensity discharge, neon, mercury vapor, high pressure sodium, and metal halide lamps. Large Quantity Handler of Universal Waste means a universal waste handler (as...

25 CFR 273.2 - Definitions.

Science.gov (United States)

2010-04-01

.... (e) “Economic enterprise” means any commercial, industrial, agricultural, or business activity that...) “Education plan” means a comprehensive plan for the programmatic and fiscal services of and accountability by.... 2203). (l) “Operational support” means those expenditures for school operational costs in order to meet...

Maďarský matematik Endre Szemerédi získal Abelovu cenu za rok 2012

Czech Academy of Sciences Publication Activity Database

Křížek, Michal; Pudlák, Pavel; Somer, L.

2012-01-01

Roč. 57, č. 4 (2012), s. 265-273 ISSN 0032-2423 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : Szemeredi theorem * chaos * upper asymptotic density Subject RIV: BA - General Mathematics http://dml.cz/dmlcz/402233

Navigation Method for Autonomous Robots in a Dynamic Indoor Environment

Czech Academy of Sciences Publication Activity Database

Věchet, Stanislav; Chen, K.-S.; Krejsa, Jiří

2013-01-01

Roč. 3, č. 4 (2013), s. 273-277 ISSN 2223-9766 Institutional support: RVO:61388998 Keywords : particle filters * autonomous mobile robots * mixed potential fields Subject RIV: JD - Computer Applications, Robotics http://www.ausmt.org/index.php/AUSMT/article/view/214/239

Effect of microwave-assisted sintering on dielectric properties of CaCu{sub 3}Ti{sub 4}O{sub 12} ceramic

Energy Technology Data Exchange (ETDEWEB)

Rani, Suman, E-mail: sumanranigju@gmail.com; Ahlawat, Neetu; Punia, R.; Kundu, R. S. [Department of Applied Physics, Guru Jambheshwar University of Science & Technology, Hissar 125001, Haryana (India); Ahlawat, N. [Matu Ram Institute of Engineering and Management, Rohtak (India)

2016-05-23

In this present work, CaCu{sub 3}Ti{sub 4}O{sub 12} (CCTO) was synthesized by conventional solid-state reaction technique. The synthesis process was carried out in two phases; by conventional process (calcination and sintering at 1080°C for 10 hours) and phase II involves the micro assisted pre sintering of conventionally calcined CCTO for very short soaking time of 30 min at 1080°C in a microwave furnace followed by sintering at 1080°C for 10 hours in conventional furnace. X-ray diffraction (XRD) patterns confirmed the formation of single phase ceramic. Dielectric properties were studied over the frequency range from 50Hz -5MHz at temperatures (273K-343K). It was observed that pre- microwave sintering enhance the dielectric constant values from 10900 to 11893 and respectively reduces the dielectric loss values from 0.49 to 0.34 at room temperature(1 KHz). CCTO ceramics which are found desirable for many technological applications. The effect is more pronounced at low frequencies of applied electric field.

Interglacial insects and their possible survival in Greenland during the last glacial stage

DEFF Research Database (Denmark)

Bøcher, Jens Jensenius

2012-01-01

Sediments from the last interglacial (Eemian) in Jameson Land, East Greenland, and the Thule area, NW Greenland, have revealed a number of insect fragments of both arctic and more or less warmth-demanding species. Altogether, the interglacial fauna of Coleoptera (beetles) indicates boreal...... beetle species such as Amara alpina and Isochnus arcticus did not survive the last glacial stage in Greenland. Two factors that have not been sufficiently considered when discussing survival contra extinction are the importance of microclimate and the number of sun-hours during the Arctic summer. Even...... among the Coleoptera, which as a group fares quite badly in the Arctic, there might be survivors, at least among those found both during the interglacial and as fossils during the early Holocene. First of all, glacial survival applies to the seed bug Nysius groenlandicus, which was widespread during...

Generation of a novel live rabies vaccine strain with a high level of safety by introducing attenuating mutations in the nucleoprotein and glycoprotein.

Science.gov (United States)

Nakagawa, Keisuke; Nakagawa, Kento; Omatsu, Tsutomu; Katayama, Yukie; Oba, Mami; Mitake, Hiromichi; Okada, Kazuma; Yamaoka, Satoko; Takashima, Yasuhiro; Masatani, Tatsunori; Okadera, Kota; Ito, Naoto; Mizutani, Tetsuya; Sugiyama, Makoto

2017-10-09

The current live rabies vaccine SAG2 is attenuated by only one mutation (Arg-to-Glu) at position 333 in the glycoprotein (G333). This fact generates a potential risk of the emergence of a pathogenic revertant by a back mutation at this position during viral propagation in the body. To circumvent this risk, it is desirable to generate a live vaccine strain highly and stably attenuated by multiple mutations. However, the information on attenuating mutations other than that at G333 is very limited. We previously reported that amino acids at positions 273 and 394 in the nucleoprotein (N273/394) (Leu and His, respectively) of fixed rabies virus Ni-CE are responsible for the attenuated phenotype by enhancing interferon (IFN)/chemokine gene expressions in infected neural cells. In this study, we found that amino acid substitutions at N273/394 (Phe-to-Leu and Tyr-to-His, respectively) attenuated the pathogenicity of the oral live vaccine ERA, which has a virulent-type Arg at G333. Then we generated ERA-N273/394-G333 attenuated by the combination of the above attenuating mutations at G333 and N273/394, and checked its safety. Similar to the ERA-G333, which is attenuated by only the mutation at G333, ERA-N273/394-G333 did not cause any symptoms in adult mice after intracerebral inoculation, indicating a low level of residual pathogenicity of ERA-N273/394-G333. Further examination revealed that infection with ERA-N273/394-G333 induces IFN-β and CXCL10 mRNA expressions more strongly than ERA-G333 infection in a neuroblastoma cell line. Importantly, we found that the ERA-N273/394-G333 stain has a lower risk for emergence of a pathogenic revertant than does the ERA-G333. These results indicate that ERA-N273/394-G333 has a potential to be a promising candidate for a live rabies vaccine strain with a high level of safety. Copyright © 2017 Elsevier Ltd. All rights reserved.

Effect of phosphorus doping on electronic structure and photocatalytic performance of g-C{sub 3}N{sub 4}: Insights from hybrid density functional calculation

Energy Technology Data Exchange (ETDEWEB)

Liu, Jianjun, E-mail: jjliu@chnu.edu.cn [State Key Laboratory of Advanced Technology for Materials Synthesis and Processing, Wuhan University of Technology, Wuhan 430070 (China); School of Physics and Electronic Information, Huaibei Normal University, Huaibei, Anhui 235000 (China)

2016-07-05

Graphitic carbon nitride (g-C{sub 3}N{sub 4}), as a promising visible-light photocatalyst, has wide applications on water splitting, pollutants decomposition and CO{sub 2} reduction. Herein, we investigated the electronic and optical property of pure and P doped g-C{sub 3}N{sub 4} using Heyd-Scuseria-Ernzerhof (HSE06) hybrid functional method. The valuable features such as, the band structure, density of states, band decomposed charged density and optical absorption were computed to explore the role of phosphorus substitute N2 and C1 sites of g-C{sub 3}N{sub 4}.The results indicated that pure g-C{sub 3}N{sub 4} has an indirect band gap of about 2.73 eV, which is in good agreement with the experimental value. By doping P into N2 and C1 sites of g-C{sub 3}N{sub 4}, the band gap reduces to 2.03 and 2.22 eV, respectively. Optical absorption intensity of g-C{sub 3}N{sub 4} had a greatly enhancement in the visible region by doping P. Though narrowing the energy band of g-C{sub 3}N{sub 4} by doping P, conduction band and valance band edge of g-C{sub 3}N{sub 4} doping system still had enough potential to split water. Therefore, phosphorus doped g-C{sub 3}N{sub 4} is effective strategy to improve visible light response photocatalytic performance of g-C{sub 3}N{sub 4}. - Highlights: • For the first time, calculated band structure of P doped g-C{sub 3N}4 by Hybrid DFT method. • P doped g-C{sub 3N}4 narrowed band gap and enhanced optical absorption. • P doped g-C3{sub N4} enhanced the oxidation capacity of the valence band edge.

Ursidibacter maritimus gen. nov., sp. nov. and Ursidibacter arcticus sp. nov., two new members of the family Pasteurellaceae isolated from the oral cavity of bears

DEFF Research Database (Denmark)

Hansen, Mie Johanne; Strøm Braaten, Mira; Bojesen, Anders Miki

2015-01-01

A total of 32 suspected Pasteurellaceae strains isolated from polar and brown bears were characterized by genotypic and phenotypic tests. Phylogenetic analysis of partial 16S rRNA and rpoB gene sequences showed that the isolates investigated formed two closely related monophyletic groups. Based...... on 16S rRNA gene sequence comparison Bibersteinia trehalosi was the closest related validly published species, with 95.4 % similarity to the polar bear group and 94.4 % similarity to the brown bear group. Otariodibacter oris was the closest related species based on rpoB sequence comparison with an rpo......B similarity at 89.8% with the polar bear group and 90% similarity with the brown bear group. Members of the bear genera could be separated from existing genera of the Pasteurellaceae by three to ten phenotypic characters and the two novel species could be separated from each other by two phenotypic characters...

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

... College Station, TX 77843. Present address: Barrens Consulting Co., 273 Pepe's Farm Road, Milford, CT 06470. Department of Physics, Sam Houston State University, Huntsville, TX 77341. Present address: SN4, NASA-JSC, Houston, TX 77858. Shell Development Corporation, P.O. Box 481, Houston, Texas 77001.

Removal of Carbon Dioxide from Gas Mixtures Using Ion-Exchanged Silicoaluminophosphates

Science.gov (United States)

Hernandez-Maldonado, Arturo J (Inventor); Rivera-Ramos, Milton E (Inventor); Arevalo-Hidalgo, Ana G (Inventor)

2017-01-01

Na+-SAPO-34 sorbents were ion-exchanged with several individual metal cations for CO2 absorption at different temperatures (273-348 K) and pressures (SAPO-34 sorbents are by far the best option for CO2 removal from CH4 mixtures, especially at low concentrations.

In pursuit of the rhabdophane crystal structure: from the hydrated monoclinic LnPO{sub 4}.0.667H{sub 2}O to the hexagonal LnPO{sub 4} (Ln = Nd, Sm, Gd, Eu and Dy)

Energy Technology Data Exchange (ETDEWEB)

Mesbah, Adel, E-mail: adel.mesbah@cea.fr [ICSM, UMR 5257 CNRS – CEA – ENSCM – Université de Montpellier, Site de Marcoule - Bât 426, BP 17171, 30207 Bagnols/Cèze (France); Clavier, Nicolas [ICSM, UMR 5257 CNRS – CEA – ENSCM – Université de Montpellier, Site de Marcoule - Bât 426, BP 17171, 30207 Bagnols/Cèze (France); Elkaim, Erik [Synchrotron SOLEIL, L' Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Szenknect, Stéphanie; Dacheux, Nicolas [ICSM, UMR 5257 CNRS – CEA – ENSCM – Université de Montpellier, Site de Marcoule - Bât 426, BP 17171, 30207 Bagnols/Cèze (France)

2017-05-15

The dehydration process of the hydrated rhabdophane LnPO{sub 4}.0.667H{sub 2}O (Ln = La to Dy) was thoroughly studied over the combination of in situ high resolution synchrotron powder diffraction and TGA experiments. In the case of SmPO{sub 4}.0.667H{sub 2}O (monoclinic, C2), a first dehydration step was identified around 80 °C leading to the formation of SmPO{sub 4}.0.5H{sub 2}O (Monoclinic, C2) with Z =12 and a =17.6264(1) Å, b =6.9704(1) Å, c =12.1141(1) Å, β=133.74(1) °, V =1075.33(1) Å{sup 3}. In agreement with the TGA and dilatometry experiments, all the water molecules were evacuated above 220 °C yielding to the anhydrous form, which crystallizes in the hexagonal P3{sub 1}21 space group with a =7.0389(1) Å, c =6.3702(1) Å and V =273.34(1) Å{sup 3}. This study was extended to selected LnPO{sub 4}.0.667H{sub 2}O samples (Ln= Nd, Gd, Eu, Dy) and the obtained results confirmed the existence of two dehydration steps before the stabilization of the anhydrous form, with the transitory formation of LnPO{sub 4}.0.5H{sub 2}O. - Graphical abstract: The dehydration process of the rhabdophane SmPO{sub 4}.0.667H{sub 2}O was studied over combination of in situ high resolution synchrotron powder diffraction and TGA techniques, a first dehydration was identified around 80 °C leading to the formation of SmPO{sub 4}.0.5H{sub 2}O (Monoclinic, C2). Then above 220 °C, the anhydrous form of the rhabdophane SmPO{sub 4} was stabilized and crystallizes in the hexagonal P3{sub 1}21 space group. - Highlights: • In situ synchrotron powder diffraction was carried out during the dehydration of the rhabdopahe LnPO{sub 4}.0.667H{sub 2}O. • The heat of the rhabdophane LnPO{sub 4}.0.667H{sub 2}O leads to LnPO{sub 4}.0.5H{sub 2}O then to anhydrous rhabdophane LnPO{sub 4}. • LnPO{sub 4}.0.5H{sub 2}O (monoclinic, C2) and LnPO{sub 4} (Hexagonal, P3{sub 1}21) were solved over the use of direct methods.

Rate Measurements of the Hydrolysis of Complex Organic Macromolecules in Cold Aqueous Solutions: Implications for Prebiotic Chemistry on the Early Earth and Titan

Science.gov (United States)

Neish, C. D.; Somogyi, Á.; Imanaka, H .; Lunine, J. I.; Smith, M. A.

2008-04-01

Organic macromolecules (``complex tholins'') were synthesized from a 0.95 N2 / 0.05 CH4 atmosphere in a high-voltage AC flow discharge reactor. When placed in liquid water, specific water soluble compounds in the macromolecules demonstrated Arrhenius type first order kinetics between 273 and 313 K and produced oxygenated organic species with activation energies in the range of ~60 +/- 10 kJ mol-1. These reactions displayed half lives between 0.3 and 17 days at 273 K. Oxygen incorporation into such materials-a necessary step toward the formation of biological molecules-is therefore fast compared to processes that occur on geologic timescales, which include the freezing of impact melt pools and possible cryovolcanic sites on Saturn's organic-rich moon Titan.

Análisis de puntos de rocío y contenidos de humedad de mezclas gaseosas N2-H2O y CH4-H2O

Directory of Open Access Journals (Sweden)

D. Bogoya M.

1995-01-01

Full Text Available EI conocimiento actual del contenido de humedad de mezclas gaseosas saturadas es aún incompleto, especialmente en la región de altas presiones y bajas temperaturas. Por tanto se realizaron medidas experimentales de punta de rocío con los sistemas nitrógeno-agua y metano-agua, a presiones de 3 y 6 MPa y a temperaturas de 258 K a 288 K. Los puntos de rocío se determinaron con el método del espejo de punta de rocío y los contenidos de humedad por medio de la titulación de Karl-Fischer. Los valores experimentales se compararon con correlaciones de la literatura. El método de Sharma-Campbell resultó ser la mejor descripción del sistema nitrógeno-agua. Para temperaturas inferiores a 273 K la suposición de comportamiento de gas ideal mostro ser suficiente para el sistema metano-agua, mientras que para temperaturas superiores a 273 K los cálculos mediante el principio de estados correspondientes con dos parámetros, en combinación con una corrección de fugacidad, manifestó ser la mejor.

Thermoluminescence dose response of quartz as a function of irradiation temperature

International Nuclear Information System (INIS)

Kitis, G.; Kaldoudi, E.; Charalambous, S.

1990-01-01

The thermoluminescence (TL) response of pure Norwegian quartz as a function of irradiation temperature (T irr ) and dose has been investigated. The TL response of the (150-230 o C) and (230-350 o C) glow curve intervals shows a strong dependence on T irr between 77 and 373 K in the dose range from 54 to 8.4 x 10 4 Gy. Both glow curve intervals also show temperature dependent dose response properties. The 150-230 o C interval is supralinear from the lowest dose (54 Gy). Its maximum supralinearity factor appears at T irr = 293 K. The 230-350 o C interval shows sublinear behaviour below T irr = + 193 K, while at T irr ≥ 273 K it shows the well known dose response curves. Its maximum supralinearity factor appears at T irr = 323 K. The linear response is extended up to 460 Gy at T irr = 273 K and falls to 80 Gy at T irr = 373 K. (author)

A facile method of preparing LiMnPO4/reduced graphene oxide aerogel as cathodic material for aqueous lithium-ion hybrid supercapacitors

Science.gov (United States)

Xu, Lin; Wang, Senlin; Zhang, Xiao; He, Taobin; Lu, Fengxia; Li, Huichang; Ye, Junhui

2018-01-01

A facile method of preparing LiMnPO4/reduced graphene oxide aerogel (LMP/rGO) as cathodic material was reported here. LiMnPO4 nano-particles were prepared using a facile polyvinyl pyrrolidone-assisted solvothermal route. Then LMP/rGO aerogel was prepared using the accessible restacking method. The influence of the cathodic electrode composition (ratio of rGO to LiMnPO4) on the performance of the LMP/rGO was evaluated by constant-current discharge tests. When compared with 217C g-1 for the pristine LMP, the best LMP/rGO (the content of rGO is 27.3 wt%) exhibits a higher capacity of 464.5C g-1 (at 0.5 A g-1), which presenting the capacity enhance of 114%. Moreover, a lithium-ion hybrid supercapacitor (LIHS) was successfully assembled by using LMP/rGO aerogel as the cathodic electrode and rGO aerogel as the anodic electrode. The LMP/rGO//rGO device achieves excellent specific energy of 16.46 W h kg-1 at a power density of 0.38 kW kg-1, even under the higher specific power of 4.52 kW kg-1, there still holds the specific energy of 11.79 W h kg-1. The LMP/rGO//rGO device maintains 91.2% of the initial capacity after 10,000 cycles (at 2 A g-1), which displays high rate performance and long cycle life. The 3D LMP/rGO aerogel could be a promising candidate material for the lithium-ion hybrid supercapacitors.

Novel biotransformation process of podophyllotoxin to 4 β-sulfur-substituted podophyllum derivates with anti-tumor activity by Penicillium purpurogenum Y.J. Tang.

Science.gov (United States)

Bai, J-K; Zhao, W; Li, H-M; Tang, Y-J

2012-01-01

According to the structure-function relationship of podophyllotoxin (PTOX) and its analogue of 4'- demethylepipodophyllotoxin (DMEP), the 4 β-substitution of sulfur-containing heterocyclic compounds with a carbon-sulfur bond at 4 position of PTOX or DMEP is an essential modification direction for improving the anti-tumor activity. So, four novel 4 β-sulfursubstituted podophyllum derivatives (i.e., 4β -(1,2,4-triazole-3-yl)sulfanyl-4-deoxy-podophyllotoxin (4-MT-PTOX), 4β-(1,3,4- thiadiazole-2-yl)sulfanyl-4-deoxy-podophyllotoxin (4-MTD-PTOX), 4β-(1,2,4-triazole-3-yl)sulfanyl-4-deoxy-4' -demethylepipodophyllotoxin (4-MT-DMEP), and 4β-(1,3,4-thiadiazole-2-yl)sulfanyl-4-deoxy-4'-demethylepipodophyllotoxin (4-MTD-DMEP)) were designed and then successfully biosynthesized in this work. In the novel sulfur-substituted biotransformation processes, PTOX and DMEP was linked with sulfur-containing compounds (i.e., 3-mercapto-1,2,4-triazole (MT) and 2-mercapto-1,3,4-thiadiazole (MTD)) at 4 position of cycloparaffin to produce 4-MT-PTOX (1), 4-MTD-PTOX (2), 4-MT-DMEP (3), and 4-MTD-DMEP (4) by Penicillium purpurogenum Y.J. Tang, respectively, which was screened out from Diphylleia sinensis Li (Hubei, China). All the novel compounds exhibited promising in vitro bioactivity, especially 4-MT-PTOX (1). Compared with etoposide (i.e., a 50 % effective concentration [EC(50)] of 25.72, 167.97, and 1.15 M), the EC(50) values of 4-MT-PTOX (1) against tumor cell line BGC-823, A549 and HepG2 (i.e., 0.28, 0.76, and 0.42 M) were significantly improved by 91, 221 and 2.73 times, respectively. Moreover, the EC(50) value of 4-MT-PTOX (1) against the normal human cell line HK-2 (i.e., 182.4 μM) was 19 times higher than that of etoposide (i.e., 9.17 μM). Based on the rational design, four novel 4 β-sulfur-substituted podophyllum derivatives with superior in vitro anti-tumor activity were obtained for the first time. The correctness of structure-function relationship and rational drug

Identities of epilithic hydrocarbon-utilizing diazotrophic bacteria from the Arabian Gulf Coasts, and their potential for oil bioremediation without nitrogen supplementation.

Science.gov (United States)

Radwan, Samir; Mahmoud, Huda; Khanafer, Majida; Al-Habib, Aamar; Al-Hasan, Redha

2010-08-01

Gravel particles from four sites along the Arabian Gulf coast in autumn, winter, and spring were naturally colonized with microbial consortia containing between 7 and 400 × 10(2) cm(-2) of cultivable oil-utilizing bacteria. The 16S rRNA gene sequences of 70 representatives of oil-utilizing bacteria revealed that they were predominantly affiliated with the Gammaproteobacteria and the Actinobacteria. The Gammaproteobacteria comprised among others, the genera Pseudomonas, Pseudoalteromonas, Shewanella, Marinobacter, Psychrobacter, Idiomarina, Alcanivorax, Cobetia, and others. Actinobacteria comprised the genera Dietzia, Kocuria, Isoptericola, Rhodococcus, Microbacterium, and others. In autumn, Firmicutes members were isolated from bay and nonbay stations while Alphaproteobacteria were detected only during winter from Anjefa bay station. Fingerprinting by denaturing gradient gel electrophoresis of amplified 16S rRNA genes of whole microbial consortia confirmed the culture-based bacterial diversities in the various epilithons in various sites and seasons. Most of the representative oil-utilizing bacteria isolated from the epilithons were diazotrophic and could attenuate oil also in nitrogen-rich (7.9-62%) and nitrogen-free (4-54%) cultures, which, makes the microbial consortia suitable for oil bioremediation in situ, without need for nitrogen supplementation. This was confirmed in bench-scale experiments in which unfertilized oily seawater was bioremediated by epilithon-coated gravel particles.

Preputial skin free graft as dorsal onlay urethroplasty: Our experience of 73 patients.

Science.gov (United States)

Bapat, Shivadeo S; Padhye, Abhijit S; Yadav, Pushkaraj B; Bhave, Ashish A

2007-10-01

To present the outcome of dorsal onlay urethroplasty in 73 patients for stricture urethra over a period of eight years. Seventy-three patients of stricture urethra have undergone dorsal onlay urethroplasty from July 1998 to February 2006. Age distribution: 14-58 years. Trauma 20/73 (27.39%), Balanitis Xerotica Obliterans 2/73 (2.73%), Iatrogenic 26/73(35.61%), Infection 3/73 (4.10%), Idiopathic 22/73 (30.13%). Site: Penobulbar-25/73, bulbar-38/73, membranous-8/73 and long length-2/73. Suprapubic catheter was inserted preoperatively: 21/73 patients. Preputial / distal penile skin was used in all patients. Buccal mucosa was not used in any patient. Hospitalization was for four to five days. Catheter was removed after 21 days. All patients had their first endoscopic checkup after three months. Subsequently they were followed up by uroflometry. Routine imaging of urethra for follow-up was not carried out. 63/73 (86.30%) patients had satisfactory outcome not requiring any further treatment, 8/73 (10.95%) developed anastomotic stricture (3/8-optical internal urethrotomy, 5/8 dilatation alone). 2/73 (2.75%) developed external meatal stenosis. None had urinary fistula and required repeat urethroplasty. Follow-up ranged from three months to eight years. Dorsal onlay urethroplasty using preputial/distal penile skin is a satisfactory procedure. Preputial/distal penile skin is devoid of hair and fat and hence an ideal graft material. Even in circumscribed patients distal penile skin can be harvested. Long-term follow-up is required in judging results of patients with stricture urethra.

Photoluminescence and thermoluminescence properties of Tb{sup 3+} doped K{sub 3}Gd(PO{sub 4}){sub 2} nanophosphor

Energy Technology Data Exchange (ETDEWEB)

Gupta, Palvi; Bedyal, A.K. [School of Physics, Shri Mata Vaishno Devi University, Katra, 182320 Jammu and Kashmir (India); Kumar, Vinay, E-mail: vinaykdhiman@yahoo.com [School of Physics, Shri Mata Vaishno Devi University, Katra, 182320 Jammu and Kashmir (India); Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein ZA9300 (South Africa); Khajuria, Y. [School of Physics, Shri Mata Vaishno Devi University, Katra, 182320 Jammu and Kashmir (India); Lochab, S.P. [Inter University Accelerator Centre, Anura Asaf Ali Marg, P. O. Box 10502, New Delhi 110067 (India); Pitale, S.S. [Crystal Technology Laboratory,TPD, Bhabha Atomic Research Centre Trombay, Mumbai 400085 (India); Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein ZA9300 (South Africa); Ntwaeaborwa, O.M.; Swart, H.C. [Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein ZA9300 (South Africa)

2014-12-15

Energy level diagram of Tb{sup 3+} ion in the K{sub 3}Gd(PO{sub 4}){sub 2} host lattice. - Highlights: • First time, a detailed TL and PL study on undoped and Tb{sup 3+} doped K{sub 3}Gd(PO{sub 4}){sub 2} nanophosphor. • Combustion method was employed to synthesize the Tb{sup 3+} doped K{sub 3}Gd(PO{sub 4}){sub 2} nanophosphor. • Mechanism of excitation and emission in undoped and Tb{sup 3+} doped K{sub 3}Gd(PO{sub 4}){sub 2} nanophosphor was given. - Abstract: Tb{sup 3+} doped nanoparticulate K{sub 3}Gd(PO{sub 4}){sub 2} phosphor was prepared by combustion method using urea as a fuel. The structure, optical and luminescent properties of the phosphor were studied by X-ray diffraction (XRD), scanning electron microscopy (SEM), diffuse reflectance spectroscopy (DRS), photoluminescence spectroscopy (PL), and thermoluminescence (TL) spectroscopy. In undoped K{sub 3}Gd(PO{sub 4}){sub 2}, the excitation and emission peaks at 273 nm and 323 nm belongs to the {sup 8}S{sub 7/2} → {sup 6}I{sub J(J=7/2)} and {sup 6}P{sub J(J=7/2)} → {sup 8} S{sub 7/2} transitions of Gd{sup 3+} while green emission was observed in the Tb{sup 3+} doped K{sub 3}Gd(PO{sub 4}){sub 2}. TL study was carried out after exposing the samples to γ-radiations (0.1–5 kGy) in the K{sub 3}Gd(PO{sub 4}){sub 2}:Tb{sup 3+} (1.5 mol%). The calculated kinetic parameters were compared with different methods. The band gap of the phosphor was estimated as 5.80 eV. The green shade of the Tb{sup 3+} ion with the CIE coordinates (x, y) as (0.29, 0.54) was in good agreement with the well known green phosphors.

Quantitative Determination of Telomerase Activity in Breast Cancer and Benign Breast Diseases

Czech Academy of Sciences Publication Activity Database

Šimíčková, M.; Nekulová, M.; Pecen, Ladislav; Černoch, M.; Vagundová, M.; Pačovský, Z.

2001-01-01

Roč. 48, č. 4 (2001), s. 267-273 ISSN 0028-2685 R&D Projects: GA MZd NM17 Institutional research plan: AV0Z1030915 Keywords : telomerase activity * quantitative analysis * breast cancer * benign breast diseases * prognisis Subject RIV: BA - General Mathematics Impact factor: 0.637, year: 2001

The Developmental Characteristics of Engagement in Service-Learning for Chinese College Students

Science.gov (United States)

Guo, Fangfang; Yao, Meilin; Zong, Xiaoli; Yan, Wenfan

2016-01-01

The purpose of this study was to investigate the development characteristics of Chinese college students' engagement during a service-learning project with a case study method: 273 reflective journals from 31 college students who participated in service-learning were analyzed. Results indicated that students' overall engagement showed 4…

New observations on Micropleura australiensis (Nematoda, Dracunculoidea), a parasite of crocodiles in Australia

Czech Academy of Sciences Publication Activity Database

Moravec, František; Spratt, D. M.; Kay, W. R.

2006-01-01

Roč. 51, č. 4 (2006), s. 273-278 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Micropleura * Crocodylus * Australia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.772, year: 2006

Tropical Journal

African Journals Online (AJOL)

Service purchase cost and care providers' attitude among others have been cited as major reasons .... 8.0. Not known. 16. Parity. 0. 164. 20.5. 1-2. 357. 44.6. 3-4. 155. 19.4. >5. 124. 15.5. Educational Status. No formal. 61. 7.6. Primary. 273. 34.1. Secondary. 266. 33.3 ... bias, but this might not have affected the overall power.

Astrocytes and glutamate homeostasis in Alzheimer's disease: a decrease in glutamine synthetase but not in glutamate transporter-1 in the prefrontal cortex.

Czech Academy of Sciences Publication Activity Database

Kulijewicz-Nawrot, Magdaléna; Syková, Eva; Chvátal, Alexandr; Verkhratsky, A.; Rodríguez, J. J.

2013-01-01

Roč. 5, č. 4 (2013), s. 273-282 ISSN 1759-0914 R&D Projects: GA ČR(CZ) GAP304/11/0184; GA ČR(CZ) GBP304/12/G069; GA ČR GA309/09/1696; GA ČR GA305/08/1384 Institutional support: RVO:68378041 Keywords : Alzheimer's disease * astroglia * GLT-1 Subject RIV: FH - Neuro logy Impact factor: 4.436, year: 2013

40 CFR 273.81 - Factors for petitions to include other wastes under 40 CFR part 273.

Science.gov (United States)

2010-07-01

... AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Petitions To Include... generic name to identify the waste category (e.g., batteries), the definition of universal waste in § 260..., and specific management standards proposed or referenced by the petitioner (e.g., waste management...

Generativity in College Students: Comparing and Explaining the Impact of Mentoring

Science.gov (United States)

Hastings, Lindsay J.; Griesen, James V.; Hoover, Richard E.; Creswell, John W.; Dlugosh, Larry L.

2015-01-01

Preparing college students to be active contributors to the next generation is an important function of higher education. This assumption about generativity forms a cornerstone in this mixed methods study that examined generativity levels among 273 college students at a 4-year public university. MANCOVA results indicated that college students who…

Highly Stable Porous Covalent Triazine-Piperazine Linked Nanoflower as a Feasible Adsorbent for Flue Gas CO2 Capture

KAUST Repository

Das, Swapan Kumar; Wang, Xinbo; Ostwal, Mayur; Zhao, Yunfeng; Han, Yu; Lai, Zhiping

2016-01-01

robustness under acidic and basic medium and high thermal stability up to 773 K. The CTPP possess high surface area (779 m2/g) and single-component gas adsorption study exhibited enhanced CO2 and CH4 uptake of 3.48 mmol/g, 1.09 mmol/g, respectively at 273 K

Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

Energy Technology Data Exchange (ETDEWEB)

Roser, T.

1999-04-19

The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

Climate of the upper atmosphere

Czech Academy of Sciences Publication Activity Database

Bremer, J.; Laštovička, Jan; Mikhailov, A. V.; Altadill, D.; Pal, B.; Burešová, Dalia; Franceschi de, G.; Jacobi, C.; Kouris, S. S.; Perrone, L.; Turunen, E.

2009-01-01

Roč. 52, 3/4 (2009), s. 273-299 ISSN 1593-5213 R&D Projects: GA MŠk OC 091 Institutional research plan: CEZ:AV0Z30420517 Keywords : Ionosphere * trends * atmospheric waves * ionospheric variability * incoherent radar * space weather Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.548, year: 2009

Enhancement of 9α-Hydroxy-4-androstene-3,17-dione Production from Soybean Phytosterols by Deficiency of a Regulated Intramembrane Proteolysis Metalloprotease in Mycobacterium neoaurum.

Science.gov (United States)

Xiong, Liang-Bin; Sun, Wan-Ju; Liu, Yong-Jun; Wang, Feng-Qing; Wei, Dong-Zhi

2017-12-06

Modification of the sterol catabolism pathway in mycobacteria may result in the accumulation of some valuable steroid pharmaceutical intermediates, such as 9α-hydroxy-4-androstene-3,17-dione (9-OHAD). In previous work, sigma factor D (SigD) was identified as a negative factor of the 9-OHAD production in Mycobacterium neoaurum. Here, the deficiency of rip1 putatively coding for a regulated intramembrane proteolysis metalloprotease (Rip1), which could cleave the negative regulator of SigD (anti-SigD), enhanced the transcription of some key genes (choM1, kshA, and hsd4A) in the sterol catabolic pathway. Furthermore, the deletion of rip1 increased the consumption of phytosterols by 37.8% after 96 h of growth in M. neoaurum. The production of 9-OHAD in the engineered M. neoaurumΔkstD1ΔkstD2ΔkstD3Δrip1 (MnΔk123Δrip1) strain was ultimately increased by 27.3% compared to that in its parental strain M. neoaurumΔkstD1ΔkstD2ΔkstD3 (MnΔk123). This study further confirms the important role of SigD-related factors in the catabolism of sterols.

Numerical Simulation of Transition in Hypersonic Boundary Layers

Science.gov (United States)

2011-02-01

sile domes. AGARD Report CP 493. Advisory Group for Aerospace Research and Development. 273 Horvath, T. 2002 Boundary layer transition on slender...reference skin-friction coefficient cp , cv Specific heats at constant pressure and volume, respectively cph Phase speed in propagation direction e...y)) 73 and two-dimensional (W = 0): u = U (y) + u′ , (4.9a) v = v′ , (4.9b) w = w′ , (4.9c) p = 1 + p′ , (4.9d) T = T (y) + T ′ , (4.9e) ρ = 1 T (y

Volatilization of selenium from agricultural evaporation pond sediments.

Science.gov (United States)

Karlson, U; Frankenberger, W T

1990-03-01

Microbial volatilization of Se was evaluated as a means of detoxifying Se-contaminated sediments. Sediment samples containing 60.7 (Kesterson Reservoir) and 9.0 mg Se kg-1 (Peck ponds) were incubated for 273 days in closed systems located in the greenhouse. Volatile Se was collected from a continuous air-exchange stream using activated carbon. Various economical and readily available organic and inorganic amendments were tested for their capacity to enhance the microbial process, including Citrus (orange) peel, Vitis (grape) pomace, feedlot manure, barley straw, chitin, pectin, ZnSO4, (NH4)2SO4, and an inoculum of Acremonium falciforme (an active Se methylating fungus). With the Kesterson sediment, the highest Se removal (44.0%) resulted from the combined application of citrus peel and ZnSO4, followed by citrus peal alone (39.6%), and citrus peel combined with ZnSO4, (NH4)2SO4 and A. falciforme (30.1%). Manure (19.5%), pectin (16.4%), chitin (9.8%) and straw plus N (8.8%) had less pronounced effects. Without the amendments, cumulative Se volatilization was 6.1% of the initial inventory. Grape pomace (3.0%) inhibited the process. With the Peck sediment, the highest amount of Se removed was observed with chitin (28.6%), manure (28.5%), and citrus peel alone (27.3%). Without amendments, 14.0% of the native Se was volatilized in 273 days. Cumulative Se volatilization was 24.7% with citrus plus Zn and N, 17.2% with citrus plus Zn, and 18.8% with citrus plus Zn, N and A. falciforme. Pectin (15.2%), straw plus N (16.4%), and grape pomace (7.3%) were among the less effective amendments for the Peck sediment. The differences in the effectiveness of each treatment between the two seleniferous soils may be a result of the residual N content of the sediments. With the Kesterson sediment, which was high in organic C and N, added N inhibited volatilization of Se, while with Peck sediments (low in organic C and N) N-rich materials tended to accelerate Se volatilization

A comparative clinical study of the failure rate of orthodontic brackets bonded with two adhesive systems: conventional and self-etching primer (SEP).

Science.gov (United States)

Dominguez, Gladys Cristina; Tortamano, André; Lopes, Luiz Vicente de Moura; Catharino, Priscilla Campanatti Chibebe; Morea, Camillo

2013-01-01

This study compared the clinical performance of orthodontic brackets bonded with Transbond adhesive paste after two primer systems: a two-stage conventional system (acid etching + Transbond XT adhesive primer) and a single-stage self-etching primer (SEP) (Transbond Plus). The sample comprised 480 metal brackets bonded to the teeth of 24 consecutive patients treated for 36 to 48 months. A split-mouth design was used for bonding, and both systems were used in each patient. Bracket failure rates for each system were analyzed; and failure causes as reported by the patients and the quadrant of teeth for which brackets failed were recorded. The conventional system group had a failure rate of 5.41%, whereas the rate for SEP was 4.58%. In this group, there were 5 failures (38.4%) in the right maxillary quadrant, 2 (15.4%) in the left maxillary quadrant, 4 (30.8%) in the right mandibular quadrant, and 2 (15.4%) in the left mandibular quadrant. In the SEP group, there were 4 (36.4%) failures in the right maxillary quadrant, 1 (9%) in the left maxillary quadrant, 3 (27.3%) in the right mandibular quadrant, and 3 (27.3%) in the left mandibular quadrant. Results of descriptive statistical analysis and odds ratio did not show any significant differences between rates (p = 0.67). The clinical efficiency of SEP was similar to that of the conventional system.

Porous carbon derived via KOH activation of a hypercrosslinked porous organic polymer for efficient CO_2, CH_4, H_2 adsorptions and high CO_2/N_2 selectivity

International Nuclear Information System (INIS)

Modak, Arindam; Bhaumik, Asim

2015-01-01

Microporous carbon having Brunauer-Emmett-Teller (BET) surface area of 2186 m"2 g"−"1 and micropore volume of 0.85 cm"3 g"−"1 has been synthesized via KOH induced high temperature carbonization of a non-conjugated hypercrosslinked organic polymer. Owing to the templating and activation by KOH, we have succeeded in making a microporous carbon from this porous polymer and the resultant carbon material showed high uptake for CO_2 (7.6 mmol g"−"1) and CH_4 (2.4 mmol g"−"1) at 1 atm, 273 K together with very good selectivity for the CO_2/N_2 (30.2) separation. Furthermore, low pressure (1 atm) H_2 (2.6 wt%, 77 K) and water uptake (57.4 wt%, 298 K) ability of this polymer derived porous activated carbon is noteworthy. - Graphical abstract: Microporous carbon with BET surface area of 2186 m"2 g"−"1 has been synthesized via KOH activation of a porous organic polymer and it showed high uptake for CO_2 (7.6 mmol g"−"1), CH_4 (2.4 mmol g"−"1) and H_2 (2.6 wt%) at 1 atm together with very good selectivity for CO_2. - Highlights: • Porous carbon from hypercrosslinked organic polymer. • KOH activated carbon with BET surface area 2186 m"2 g"−"1. • High CO2 uptake (7.6 mmol g"−"1) and CO_2/N_2 selectivity (30.2). • Porous carbon also showed high H_2 (2.6 wt%) and H_2O (57.4 wt%) uptakes.

Vital Signs-Preventing Teen Pregnancy

Centers for Disease Control (CDC) Podcasts

2015-04-07

This podcast is based on the April 2015 CDC Vital Signs report. Teen births in the U.S. have declined, but still, more than 273,000 infants were born to teens ages 15 to 19 in 2013. Learn about the most effective types of birth control.  Created: 4/7/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 4/7/2015.

Dynamic Protocol Reverse Engineering: A Grammatical Inference Approach

Science.gov (United States)

2008-03-01

domain-specific languages”. OOPSLA ’05: Companion to the 20th annual ACM SIGPLAN conference on Object-oriented programming, systems, languages, and...Representation to k-TSS Lan- guage Models”. Computación y Sistemas , 3(4):273–244, 2000. ISSN 1405-5546. 256. Trakhtenbrot, B.A. and Y.M. Barzdin. Finite

40 CFR 60.276 - Recordkeeping and reporting requirements.

Science.gov (United States)

2010-07-01

... values exceeding ±15 percent of the value established under § 60.274(c) or operation at flow rates lower...; (4) Flow diagram of process and emission capture equipment including other equipment or process(es... or operator shall maintain records of all shop opacity observations made in accordance with § 60.273...

Notch co-operates with Lozenge/Runx to lock hemocytes into a differentiation programme

Czech Academy of Sciences Publication Activity Database

Terriente-Felix, A.; Li, J.; Collins, S.; Mulligan, A.; Reekie, I.; Bernard, F.; Krejčí, Alena; Bray, S.

2013-01-01

Roč. 140, č. 4 (2013), s. 926-937 ISSN 0950-1991 R&D Projects: GA ČR(CZ) GAP305/11/0126 Grant - others:MRC programme(GB) G0800034 Institutional support: RVO:60077344 Keywords : Lozenge/Runx * Notch * chromatin immunoprecipitation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.273, year: 2013

Research

African Journals Online (AJOL)

abp

2017-09-27

Sep 27, 2017 ... protein, carotid intima -media thickness and asymmetric dimethyl arginine have been .... with LVH had a higher body mass index (27.3 vs 26.3, p=0.04) and were slightly .... adversely impacts cardiovascular morbidity and mortality in CKD patients [2-4]. ... conceptualized and designed the study. Yaw Ampem ...

Effects of the thickness of gold deposited on a source backing film in the 4πβ-counting

International Nuclear Information System (INIS)

Miyahara, Hiroshi; Yoshida, Makoto; Watanabe, Tamaki

1976-01-01

A gold deposited VYNS film as a source backing in the 4πβ-counting has generally been used for reducing the absorption of β-rays. The thickness of the film with the gold is usually a few times thicker than the VYNS film itself. However, Because the appropriate thickness of gold has not yet been determined, the effects of gold thickness on electrical resistivity, plateau characteristics and β-ray counting efficiency were studied. 198 Au (960 keV), 60 Co(315 keV), 59 Fe(273 keV) and 95 Nb(160 keV), which were prepared as sources by the aluminium chloride treatment method, were used. Gold was evaporated under a deposition rate of 1 - 5 μg/cm 2 /min at a pressure less than 1 x 10 -5 Torr. Results show that the gold deposition on the side opposite the source after source preparation is essential. In this case, a maximum counting efficiency is obtained at the mean thickness of 2 μg/cm 2 . When gold is deposited only on the same side as the source, a maximum counting efficiency, which is less than that in the former case, is obtained at the mean thickness of 20 μg/cm 2 . (Evans, J.)

Preputial skin free graft as dorsal onlay urethroplasty: Our experience of 73 patients

Directory of Open Access Journals (Sweden)

Shivadeo S Bapat

2007-01-01

Full Text Available Objective: To present the outcome of dorsal onlay urethroplasty in 73 patients for stricture urethra over a period of eight years. Materials and Methods: Seventy-three patients of stricture urethra have undergone dorsal onlay urethroplasty from July 1998 to February 2006. Age distribution: 14-58 years. Etiology: Trauma 20/73 (27.39%, Balanitis Xerotica Obliterans 2/73 (2.73%, Iatrogenic 26/73(35.61%, Infection 3/73 (4.10%, Idiopathic 22/73 (30.13%. Site: Penobulbar-25/73, bulbar-38/73, membranous-8/73 and long length-2/73. Suprapubic catheter was inserted preoperatively: 21/73 patients. Preputial / distal penile skin was used in all patients. Buccal mucosa was not used in any patient. Hospitalization was for four to five days. Catheter was removed after 21 days. All patients had their first endoscopic checkup after three months. Subsequently they were followed up by uroflometry. Routine imaging of urethra for follow-up was not carried out. Results: 63/73 (86.30% patients had satisfactory outcome not requiring any further treatment, 8/73 (10.95% developed anastomotic stricture (3/8-optical internal urethrotomy, 5/8 dilatation alone. 2/73 (2.75% developed external meatal stenosis. None had urinary fistula and required repeat urethroplasty. Follow-up ranged from three months to eight years. Conclusion: Dorsal onlay urethroplasty using preputial/distal penile skin is a satisfactory procedure. Preputial/distal penile skin is devoid of hair and fat and hence an ideal graft material. Even in circumscribed patients distal penile skin can be harvested. Long-term follow-up is required in judging results of patients with stricture urethra.

Adsorption behavior of rice husk for the decontamination of chromium from industrial effluents

International Nuclear Information System (INIS)

Khalid, N.; Rahman, A.; Ahmad, S.; Toheed, A.; Ahmed, J.

1999-01-01

Rice husk, an agricultural waste product, was studied as a potential decontaminant for chromium in the effluents of leather tanning industries. Physico-chemical parameters such as selection of appropriate electrolyte, shaking time, concentration of absorbent and absorbate were studied to optimize the best conditions in which this material can be utilized on commercial scale for the decontamination of effluents. The radiotracer technique was used to determine the distribution of chromium. In certain cases atomic absorption spectrophotometry was also employed. Maximum adsorption was observed at 0.01 mol x dm -3 acid solutions (HNO 3 , HCl, H 2 SO 4 and HClO 4 ) using 3.0 g of absorbent for 2.73 x 10 -3 mol x dm -3 chromium concentration in five minutes equilibration time. Studies show that the adsorption decreases with the increase in the concentrations of all acids. The adsorption data follows the Freundlich isotherm over the range of 2.73 x 10 -3 to 2.73 x 10 -2 mol x dm -3 chromium concentration. The characteristic Freundlich constants, i.e., 1/n = 0.86 ± 0.06 and A = 2.35 ± 0.06 mmol x g -1 have been computed for the sorption system. Thermodynamic parameters, i.e., ΔG deg, ΔS deg and ΔH deg have also been calculated for the system. Application of the method to a test case of a medium size industry showed that 21 kg of rice husk was sufficient to maintain the NEQS limits of chromium for industrial effluents. (author)

Presence of antioxidative agent, Pyrrolo[1,2-a]pyrazine-1,4-dione, hexahydro- in newly isolated Streptomyces mangrovisoli sp. nov.

Directory of Open Access Journals (Sweden)

Hooi-Leng eSer

2015-08-01

Full Text Available A novel Streptomyces, strain MUSC 149T was isolated from mangrove soil. A polyphasic approach was used to study the taxonomy of MUSC 149T, which shows a range of phylogenetic and chemotaxonomic properties consistent with those of the members of the genus Streptomyces. The diamino acid of the cell wall peptidoglycan was LL-diaminopimelic acid. The predominant menaquinones were identified as MK9(H8 and MK9(H6. Phylogenetic analysis indicated that closely related strains include Streptomyces rhizophilus NBRC 108885T (99.2 % sequence similarity, Streptomyces gramineus NBRC 107863T (98.7 % and Streptomyces graminisoli NBRC 108883T (98.5 %. The DNA–DNA relatedness values between MUSC 149T and closely related type strains ranged from 12.4 ± 3.3 % to 27.3 ± 1.9 %. The DNA G + C content was determined to be 72.7 mol%. The extract of MUSC 149T exhibited strong antioxidant activity and chemical analysis reported identification of an antioxidant agent, Pyrrolo[1,2-a]pyrazine-1,4-dione, hexahydro-. These data showed that metabolites of MUSC 149T shall be useful as preventive agent against free-radical associated diseases. Based on the polyphasic study of MUSC 149T, the strain merits assignment to a novel species, for which the name Streptomyces mangrovisoli sp. nov. is proposed. The type strain is MUSC 149T (= MCCC 1K00699T = DSM 100438T.

7 CFR 273.15 - Fair hearings.

Science.gov (United States)

2010-01-01

... in the event it is not possible for the household to attend the scheduled hearing. (2) Specify that... with due process to insure an orderly hearing; (v) Order, where relevant and useful, an independent..., shall constitute the exclusive record for a final decision by the hearing authority. This record shall...

7 CFR 273.7 - Work provisions.

Science.gov (United States)

2010-01-01

... office of the State employment services agency. (vi) A regular participant in a drug addiction or... and casework to facilitate the transition from economic dependency to self-sufficiency through work...

8 CFR 273.3 - Screening procedures.

Science.gov (United States)

2010-01-01

... this section apply to those owners, operators, or agents of carriers which transport passengers to the... examination of their travel documents to ensure that: (i) The passport or travel document presented is not...

Suicide Prevention: 1-800-273-8255

Science.gov (United States)

... Spanish: Informacion y Apoyo para los Sobrevivientes del Suicidio: Guía de Recursos del Departamento de Veteran Affairs para las familias que estén lidiando con el suicidio How to Talk to a Child about a ...

Publications | Page 273 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Visit the IDRC Digital Library now. ... initiative in Latin America and the Caribbean is tackling the environmental problem of e-waste disposal, providing computers for schools, and creating jobs at the same time. ... Several Latin American neighbours have toured this rural county in the mountains of Honduras to see.

3q27.3 microdeletional syndrome

DEFF Research Database (Denmark)

Thevenon, Julien; Callier, Patrick; Poquet, Hélène

2014-01-01

BACKGROUND: Since the advent of array-CGH, numerous new microdeletional syndromes have been delineated while others remain to be described. Although 3q29 subtelomeric deletion is a well-described syndrome, there is no report on 3q interstitial deletions. METHODS: We report for the first time seve...

48 CFR 719.273-2 - Definitions.

Science.gov (United States)

2010-10-01

..., small disadvantaged business, women-owned small business, veteran-owned and service-disabled veteran..., women-owned small business, HUBZone small business, veteran-owned small business or service-disabled... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Prot...

33 CFR 273.14 - Planning procedures.

Science.gov (United States)

2010-07-01

... control project programs which involve pest control operations, such as aquatic plant control, and affect... Environmental Policy Act. (The information outlined in Appendix C should be included in the analysis section of...

40 CFR 60.273 - Emission monitoring.

Science.gov (United States)

2010-07-01

... sensor must provide output of relative particulate matter loadings and the owner or operator shall... system including quality assurance procedures; (iv) How the bag leak detection system will be maintained... stack, the bag leak detection sensor must be installed downstream of the baghouse and upstream of any...

33 CFR 273.13 - Program policy.

Science.gov (United States)

2010-07-01

... project. (iii) Analysis based on sound economic principles clearly demonstrates that the project will... Program is designed to deal primarily with weed infestations of major economic significance including... infestation should constitute a known problem of economic importance in the area involved. Initial planning...

12 CFR 27.3 - Recordkeeping requirements.

Science.gov (United States)

2010-01-01

... work or profession for the applicant(s). (xii) Years on present job. Number of continuous years... accounts, stocks and bonds, cash value of life insurance, value of real estate owned, net worth of business... deposit balance is required, and if so, the amount. (iv) The note (simple) interest rate. (v) The number...

Publications | Page 273 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2009-04-20

Seeking justice: Women's police stations in Latin America. On April 20, 2009, in the small town of Diriomo, Nicaragua, Luz Marina Lezama Suazo, aged 47, was shot dead, allegedly by her husband. According to her sister, “She'd been having problems with him for a while and we had told her to leave.

Acute, reproductive toxicity and two-generation teratology studies of a standardized quassinoid-rich extract of Eurycoma longifolia Jack in Sprague-Dawley rats.

Science.gov (United States)

Low, Bin-Seng; Das, Prashanta Kumar; Chan, Kit-Lam

2014-07-01

The roots of Eurycoma longifolia Jack are popularly sought as herbal medicinal supplements to improve libido and general health amongst the local ethnic population. The major quassinoids of E. longifolia improved spermatogenesis and fertility but toxicity studies have not been well documented. The reproductive toxicity, two generation of foetus teratology and the up-and-down acute toxicity were investigated in Sprague-Dawley rats orally treated with quassinoid-rich E. longifolia extract (TAF273). The results showed that the median lethal dose (LD50 ) of TAF273 for female and male rats was 1293 and >2000 mg/kg, respectively. Fertility index and litter size of the TAF273 treated were significantly increased when compared with those of the non-treated animals. The TAF273-treated dams decreased in percentage of pre-implantation loss, post-implantation loss and late resorption. No toxic symptoms were observed on the TAF273-treated pregnant female rats and their foetuses were normal. The no-observed adverse effect level (NOAEL) obtained from reproductive toxicity and teratology studies of TAF273 in rats was 100 mg/kg body weight/day, being more than 10-fold lower than the LD50 value. Thus, any human dose derived from converting the rat doses of 100 mg/kg and below may be considered as safe for further clinical studies. Copyright © 2013 John Wiley & Sons, Ltd.

11

African Journals Online (AJOL)

a routine working week. Special ... day of the working week and retested after finishing work on ... 4. 3. Med. 11,8. 12. -ye. 0. 5. 5. Med. 27,3. 107. -ye. 2. 6. 6. Med. 17,1. 80. -Ye. 0. 7. 3 .... present hours after first exposure (e.g. at night), it is also.

Shumwayite,[(UO.sub.2./sub.)(SO.sub.4./sub.)(H.sub.2./sub.O).sub.2./sub.].sub.2./sub.·H.sub.2./sub.O, a new uranyl sulfate mineral from Red Canyon, San Juan County, Utah, USA

Czech Academy of Sciences Publication Activity Database

Kampf, A.R.; Plášil, Jakub; Kasatkin, A.V.; Marty, J.; Čejka, J.; Lapčák, L.

2017-01-01

Roč. 81, č. 2 (2017), s. 273-285 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : shumwayite * new mineral * uranyl sulfate * crystal structure * infrared and Raman spectroscopy Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.285, year: 2016

[Association between eye absent homolog 4 gene polymorphisms and occupational noise-induced hearing loss].

Science.gov (United States)

Yang, Q Y; Xu, X R; Jiao, J; Zheng, Y X; He, L H; Yu, S F; Gu, G Z; Chen, G S; Zhou, W H; Wu, H; Li, Y H; Zhang, H L; Zhang, Z R

2017-01-06

Objective: To identify the association between genetic polymorphisms in the eye absent homolog 4 (EYA4) gene and noise-induced hearing loss (NIHL). Method: A nested case control study was conducted based on a cohort of noise-exposed subjects. In total, 292 cases were selected from a steel factory from 6 297 subjects during Jan 1, 2006 to Dec 12, 2015,who had an average hearing threshold of more than 40 dB(A); 584 matched control subjects for each case were designated on the basis of matched criteria including same gender, age (±5 years) and duration of exposure to noise (±2 years). What's more, the control group had an average hearing threshold of less than 35 dB(A) in high frequency and less than 25 dB(A) in speech frequency. Four single nucleotide polymorphisms (SNPs) of the EYA4 gene were genotyped using a SNPscan TM multiplex SNP genotyping kit. Hardy-Weinberg equilibrium tests were performed using a χ 2 test for goodness-of-fit for each SNP among the control group, and the effects of genotypes of the EYA4 gene on NIHL were analyzed by logistic regression. The haplotypes were established and their frequencies in the two groups were assessed using Haploview 4.2 and Phase 2.1 software, and interactive effects between haplotypes and cumulative noise exposure were analyzed. Results: The average age of the subjects was (40.1±8.4) years and the average number of noise-exposed working years was 20.3 (8.4, 27.3) years. The range of noise exposure levels and the cumulative noise exposure were 80.2- 98.8 dB (A) and 86.6- 111.2 dB(A) · year, respectively. After adjustment for covariates including height, blood pressure, drinking status and smoking status, in the noise intensity>85 dB (A) group, subjects carrying the rs3813346 TT genotype had a higher NIHL risk than those carrying the GG genotype, and the adjusted OR (95% CI ) value was 2.12 (1.21- 3.69). In the cumulative noise exposure>98 dB (A) · year group, compared with haplotype TGC, haplotype CGT showed a

Effects of fish density and river fertilization on algal standing stocks, invertebrates communities, and fish production in an Arctic River

Science.gov (United States)

Deegan, Linda A.; Peterson, B.J.; Golden, H.; McIvor, C.C.; Miller, M.C.

1997-01-01

This study examined the relative importance of bottom-up and top-down controls of an arctic stream food web by simultaneous manipulation of the top predator and nutrient availability. We created a two-step trophic system (algae to insects) by removal of the top predator (Arctic grayling, Thymallus arcticus) in fertilized and control stream reaches. Fish abundance was also increased 10 times to examine the effect of high fish density on stream ecosystem dynamics and fish. We measured the response of epilithic algae, benthic and drifting insects, and fish to nutrient enrichment and to changes in fish density. Insect grazers had little effect on algae and fish had little effect on insects. In both the control and fertilized reaches, fish growth, energy storage, and reproductive response of females declined with increased fish density. Fish growth and energy storage were more closely correlated with per capita insect availability than with per capita algal standing stock

Preventing Teen Pregnancy PSA (:60)

Centers for Disease Control (CDC) Podcasts

2015-04-07

This 60 second public service announcement is based on the April 2015 CDC Vital Signs report. Teen births in the U.S. have declined, but still, more than 273,000 infants were born to teens ages 15 to 19 in 2013. Learn about the most effective types of birth control.  Created: 4/7/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 4/7/2015.

DoD Contractors’ Safety Manual for Ammunition and Explosives

Science.gov (United States)

1986-03-01

Trifluoride ClF ------------------------- II A3 Hydrogen Peroxide Greatel than 52% H202 II3 A Liquid Fluorine LF 2...7.3 68 Fluorine (Liquid) 12.6 -306 Furfuryl Alcohol 9.4 68 Hydrocarbon Fuel JP-4 6.35 60 Hydrocarbon Fuel JP-5 6.84 60 Hydrogen Peroxide (90%) 11.6...specifically authorized as process requirements. 2. Some flammable liquids such as paints, varnishes , and enamels may, under certain conditions, be

Characteristics of high- and low-risk individuals in the PRIORITY study

DEFF Research Database (Denmark)

Tofte, N; Lindhardt, M; Adamova, K

2018-01-01

variable. In a logistic regression model including clinical variables known to be associated with diabetic kidney disease, estimated GFR, gender, log urinary albumin:creatinine ratio and use of renin-angiotensin system-blocking agents remained significant determinants of the CKD273 high-risk group: area......AIM: To compare clinical baseline data in individuals with Type 2 diabetes and normoalbuminuria, who are at high or low risk of diabetic kidney disease based on the urinary proteomics classifier CKD273. METHODS: We conducted a prospective, randomized, double-blind, placebo-controlled international...... multicentre clinical trial and observational study in participants with Type 2 diabetes and normoalbuminuria, stratified into high- or low-risk groups based on CKD273 score. Clinical baseline data for the whole cohort and stratified by risk groups are reported. The associations between CKD273 and traditional...

Flavonoid constituents of Dobera glabra leaves: amelioration impact against CCl4-induced changes in the genetic materials in male rats.

Science.gov (United States)

Elkhateeb, Ahmed; Abdel Latif, Rasha R; Marzouk, Mona M; Hussein, Sameh R; Kassem, Mona E S; Khalil, Wagdy K B; El-Ansari, Mohamed A

2017-12-01

Dobera glabra (Forssk.) Poir (Salvadoraceae) is a highly valued tree with diverse importance as special mineral sourced feed and a folkloric tool for forecasting droughts. However, there are no reports on its phytochemical and biological investigations. Phytochemical investigation of D. glabra leaves and its protective potential against CCl 4 inducing changes in the genetic materials. D. glabra extract, DGE (70% MeOH/H 2 O), was applied to polyamide column chromatography, eluting with MeOH/H 2 O of decreasing polarities, followed by preparative chromatographic tools, yielded seven compounds. Three DGE doses (50, 100 and 200 mg/kg bw/d) were administrated for 8 weeks intragastrically to male albino rats prior treated with CCl 4 (0.5 mL/kg/bw). The reactive oxygen species (ROS) levels, expression changes of glutamate transporters (GLAST, GLT-1 and SNAT3) mRNA, DNA fragmentation and glutathione peroxidase (GPx) activity were investigated in the liver tissues of these rats. Isorhamnetin-3-O-β-glucopyranoside-7-O-α-rhamnopyranoside, isorhamnetin-3-O-α-rhamnopyranoside-7-O-β-glucopyranoside, kaempferol-3,7-di-O-α-rhamnopyranoside, isorhamnetin-3-O-β-glucopyranoside, kaempferol-3-O-β-glucopyranoside, isorhamnetin and kaempferol were identified. DGE (200 mg/kg bw) + CCl 4 exhibited the most significant reduction in ROS levels and DNA fragmentation with 251.3% and141% compared to 523.1% and 273.2% for CCl 4 , respectively. Additionally, it increased significantly the mRNA expression of GLAST, GLT-1 and SNAT3 to 2.16-, 1.72- and 2.09-fold, respectively. Also, GPx activity was increased to 4.8 U/mg protein/min compared to CCl 4 (1.8 U/mg protein/min). Flavonoid constituents, antioxidant effect and genotoxic protection activity of D. glabra were first reported. DGE may be valuable in the treatment and hindrance of hepatic oxidative stress and genotoxicity.

The Role of University Students' General Self-Efficacy, Depression and Psychological Well-Being in Predicting Their Exercise Behavior

Science.gov (United States)

Ersöz, Gözde

2017-01-01

The aim of this research is to examine the relationship between exercise and general self-efficacy, depression, and psychological well-being of college students. Five hundred and twenty-two university students (n[subscript male] = 273; X[subscript age] = 23.33 ± 4.36 and n[subscript female] = 279; X[subscript age] = 25.91 ± 7.11) have participated…

Russian wheat aphid, Diuraphis noxia in the Czech Republic – cause of the significant population decrease

Czech Academy of Sciences Publication Activity Database

Havelka, Jan; Žurovcová, Martina; Rychlý, S.; Starý, Petr

2014-01-01

Roč. 138, č. 4 (2014), s. 273-280 ISSN 0931-2048 R&D Projects: GA ČR GA522/09/1940 Institutional support: RVO:60077344 Keywords : alien aphid species * anholocyclic populations * aphids overwintering mortality Subject RIV: EH - Ecology, Behaviour Impact factor: 1.650, year: 2014 http://onlinelibrary.wiley.com/doi/10.1111/jen.12068/pdf

Livestock associated epidemiological information profiling in New Sandwip Island (Jahajerchar of the Meghna estuary, Noakhali using participatory disease searching tool

Directory of Open Access Journals (Sweden)

SK Shaheenur Islam

2017-09-01

Conclusion: This place is potential for sheep and buffalo raising rather than cattle. The study has validated the significance of accepting participatory disease searching tool in order to capture voluntarily submitted epidemiological data towards establishing a cost effective, unique national disease surveillance system in Bangladesh. [J Adv Vet Anim Res 2017; 4(3.000: 267-273

Molecular diversity and genetic relationships in Secale

Indian Academy of Sciences (India)

Molecular diversity and genetic relationships in Secale. E. Santos, M. Matos, P. Silva, A. M. Figueiras, C. Benito and O. Pinto-Carnide. J. Genet. 95, 273–281. Table 1. RAPD and ISSR primers used in this study. Primer. 5 –3. Primer. 5 –3. RAPDs (Operon). A1. CAGGCCCTTC. C5. CATGACCGCC. A4. AATCGGGCTG. C6.

Primary productivity of the Andaman Sea

Digital Repository Service at National Institute of Oceanography (India)

Bhattathiri, P.M.A.; Devassy, V.P.

The average surface and column primary productivity, chl a and particulate organic carbon, estimated at 24 stations during Feb. 1979, were respectively 5.3 mg C/m3/d and 273 mg C/m2 /d; 0.03 mg/m3 and 3.64 mg/m2; and 132mg/m3 and 4.59 g/m2...

Report of the International Ice Patrol Services in the North Atlantic Ocean, Season of 1985

Science.gov (United States)

1987-03-17

drift to a hydroahic surveys ( Scobie AscresuleIPmt ofthis re lyconna e constant 90-150km drift error In and Schultz, 1976). It is on a grid schedule,l...D.G., 1980. On Predicting Iceberg Drift, Cold Regions Science and Technology, Vol 1 (3/4): 273-282. Scobie , R.W., and R.H. Schultz, 1976. Oceanographyof

Computerized Method for the Generation of Molecular Transmittance Functions in the Infrared.

Science.gov (United States)

1980-04-01

RUGAS ,TX 103 FORMAT(I2,FlO.3,E1 .4,F9.3,E11.4,El3.6,E1.4,F7.4) RUGAS = RUGAS /CF WRITE(6,205) KGAS,FREQ,RPRES,RTEMP,PPM,RANGE, RUGAS ,TX 205 FORMAT(TlO,I2...10. GO TO.15 14 CONTINUE PRES(M,J,K)=ALOG10(RPRES/10 13.) TEMP(M,J,K)=ALOG1O(273. 15/RTEMP) UGAS(M,J,K)=ALOG10( RUGAS ) 15 CONTINUE C T=T+TX IT=IT+l RI(M

Vaginal Yeast Infections

Science.gov (United States)

... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ...

Density, refractive index, interfacial tension, and viscosity of ionic liquids [EMIM][EtSO4], [EMIM][NTf2], [EMIM][N(CN)2], and [OMA][NTf2] in dependence on temperature at atmospheric pressure.

Science.gov (United States)

Fröba, Andreas P; Kremer, Heiko; Leipertz, Alfred

2008-10-02

The density, refractive index, interfacial tension, and viscosity of ionic liquids (ILs) [EMIM][EtSO 4] (1-ethyl-3-methylimidazolium ethylsulfate), [EMIM][NTf 2] (1-ethyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide), [EMIM][N(CN) 2] (1-ethyl-3-methylimidazolium dicyanimide), and [OMA][NTf 2] (trioctylmethylammonium bis(trifluoromethylsulfonyl)imide) were studied in dependence on temperature at atmospheric pressure both by conventional techniques and by surface light scattering (SLS). A vibrating tube densimeter was used for the measurement of density at temperatures from (273.15 to 363.15) K and the results have an expanded uncertainty ( k = 2) of +/-0.02%. Using an Abbe refractometer, the refractive index was measured for temperatures between (283.15 and 313.15) K with an expanded uncertainty ( k = 2) of about +/-0.0005. The interfacial tension was obtained from the pendant drop technique at a temperature of 293.15 K with an expanded uncertainty ( k = 2) of +/-1%. For higher and lower temperatures, the interfacial tension was estimated by an adequate prediction scheme based on the datum at 293.15 K and the temperature dependence of density. For the ILs studied within this work, at a first order approximation, the quantity directly accessible by the SLS technique was the ratio of surface tension to dynamic viscosity. By combining the experimental results of the SLS technique with density and interfacial tension from conventional techniques, the dynamic viscosity could be obtained for temperatures between (273.15 and 333.15) K with an estimated expanded uncertainty ( k = 2) of less than +/-3%. The measured density, refractive index, and viscosity are represented by interpolating expressions with differences between the experimental and calculated values that are comparable with but always smaller than the expanded uncertainties ( k = 2). Besides a comparison with the literature, the influence of structural variations on the thermophysical properties of the

A comparative clinical study of the failure rate of orthodontic brackets bonded with two adhesive systems: conventional and self-etching primer (SEP

Directory of Open Access Journals (Sweden)

Gladys Cristina Dominguez

2013-04-01

Full Text Available OBJECTIVE: This study compared the clinical performance of orthodontic brackets bonded with Transbond adhesive paste after two priming systems: a two-stage conventional system (acid etching + Transbond XT adhesive primer and a singlestage self-etching primer (SEP (Transbond Plus. METHODS: The sample comprised 480 metal brackets bonded to the teeth of 24 consecutive patients treated for 36 to 48 months. A split-mouth design was used for bonding, and both systems were used in each patient. Bracket failure rates for each system were analyzed; and failure causes as reported by the patients and the quadrant of teeth for which brackets failed were recorded. RESULTS: The conventional system group had a failure rate of 5.41%, whereas the rate for SEP was 4.58%. In this group, there were 5 failures (38.4% in the right maxillary quadrant, 2 (15.4% in the left maxillary quadrant, 4 (30.8% in the right mandibular quadrant, and 2 (15.4% in the left mandibular quadrant. In the SEP group, there were 4 (36.4% failures in the right maxillary quadrant, 1 (9% in the left maxillary quadrant, 3 (27.3% in the right mandibular quadrant, and 3 (27.3% in the left mandibular quadrant. Results of descriptive statistical analysis and odds ratio did not show any significant differences between rates (p = 0.67. CONCLUSION: The clinical efficiency of SEP was similar to that of the conventional system.

Association of day 4 cumulative fluid balance with mortality in critically ill patients with influenza: A multicenter retrospective cohort study in Taiwan

Science.gov (United States)

Chien, Ying-Chun; Sheu, Chau-Chyun; Tsai, Ming-Ju; Fang, Wen-Feng; Chen, Yu-Mu; Kao, Kuo-Chin; Hu, Han-Chung; Perng, Wann-Cherng; Yang, Kuang-Yao; Chen, Wei-Chih; Liang, Shinn-Jye; Wu, Chieh-Liang; Wang, Hao-Chien; Chan, Ming-Cheng

2018-01-01

Background Fluid balance is a fundamental management of patients with sepsis, and this study aimed to investigate the impact of cumulative fluid balance on critically ill patients with influenza admitted to an intensive care unit (ICU). Methods This multicenter retrospective cohort study was conducted by the Taiwan Severe Influenza Research Consortium (TSIRC) which includes eight medical centers. Patients with virology-proven influenza infection admitted to ICUs between October 2015 and March 2016 were included for analysis. Results A total of 296 patients were enrolled (mean age: 61.4±15.6 years; 62.8% men), and 92.2% (273/296) of them required mechanical ventilation. In the survivors, the daily fluid balance was positive from day 1 to day 3, and then gradually became negative from day 4 to day 7, whereas daily fluid balance was continuously positive in the non-survivors. Using the cumulative fluid balance from day 1–4 as a cut-off point, we found that a negative cumulative day 1–4 fluid balance was associated with a lower 30-day mortality rate (log-rank test, P = 0.003). To evaluate the impact of shock on this association, we divided the patients into shock and non-shock groups. The positive correlation between negative day 1–4 fluid balance and mortality was significant in the non-shock group (log-rank test, P = 0.008), but not in the shock group (log-rank test, P = 0.396). In a multivariate Cox proportional hazard regression model adjusted for age, sex, cerebrovascular disease, and PaO2/FiO2, day 1–4 fluid balance was independently associated with a higher 30-day mortality rate (aHR 1.088, 95% CI: 1.007–1.174). Conclusions A negative day 1–4 cumulative fluid balance was associated with a lower mortality rate in critically ill patients with influenza. Our findings indicate the critical role of conservative fluid strategy in the management of patients with complicated influenza. PMID:29315320

Association of day 4 cumulative fluid balance with mortality in critically ill patients with influenza: A multicenter retrospective cohort study in Taiwan.

Science.gov (United States)

Chao, Wen-Cheng; Tseng, Chien-Hua; Chien, Ying-Chun; Sheu, Chau-Chyun; Tsai, Ming-Ju; Fang, Wen-Feng; Chen, Yu-Mu; Kao, Kuo-Chin; Hu, Han-Chung; Perng, Wann-Cherng; Yang, Kuang-Yao; Chen, Wei-Chih; Liang, Shinn-Jye; Wu, Chieh-Liang; Wang, Hao-Chien; Chan, Ming-Cheng

2018-01-01

Fluid balance is a fundamental management of patients with sepsis, and this study aimed to investigate the impact of cumulative fluid balance on critically ill patients with influenza admitted to an intensive care unit (ICU). This multicenter retrospective cohort study was conducted by the Taiwan Severe Influenza Research Consortium (TSIRC) which includes eight medical centers. Patients with virology-proven influenza infection admitted to ICUs between October 2015 and March 2016 were included for analysis. A total of 296 patients were enrolled (mean age: 61.4±15.6 years; 62.8% men), and 92.2% (273/296) of them required mechanical ventilation. In the survivors, the daily fluid balance was positive from day 1 to day 3, and then gradually became negative from day 4 to day 7, whereas daily fluid balance was continuously positive in the non-survivors. Using the cumulative fluid balance from day 1-4 as a cut-off point, we found that a negative cumulative day 1-4 fluid balance was associated with a lower 30-day mortality rate (log-rank test, P = 0.003). To evaluate the impact of shock on this association, we divided the patients into shock and non-shock groups. The positive correlation between negative day 1-4 fluid balance and mortality was significant in the non-shock group (log-rank test, P = 0.008), but not in the shock group (log-rank test, P = 0.396). In a multivariate Cox proportional hazard regression model adjusted for age, sex, cerebrovascular disease, and PaO2/FiO2, day 1-4 fluid balance was independently associated with a higher 30-day mortality rate (aHR 1.088, 95% CI: 1.007-1.174). A negative day 1-4 cumulative fluid balance was associated with a lower mortality rate in critically ill patients with influenza. Our findings indicate the critical role of conservative fluid strategy in the management of patients with complicated influenza.

Anisotropic lattice softening near the structural phase transition in the thermosalient crystal 1,2,4,5-tetrabromobenzene.

Science.gov (United States)

Zakharov, Boris A; Michalchuk, Adam A L; Morrison, Carole A; Boldyreva, Elena V

2018-03-28

The thermosalient effect (crystal jumping on heating) attracts much attention as both an intriguing academic phenomenon and in relation to its potential for the development of molecular actuators but its mechanism remains unclear. 1,2,4,5-Tetrabromobenzene (TBB) is one of the most extensively studied thermosalient compounds that has been shown previously to undergo a phase transition on heating, accompanied by crystal jumping and cracking. The difference in the crystal structures and intermolecular interaction energies of the low- and high-temperature phases is, however, too small to account for the large stress that arises over the course of the transformation. The energy is released spontaneously, and crystals jump across distances that exceed the crystal size by orders of magnitude. In the present work, the anisotropy of lattice strain is followed across the phase transition by single-crystal X-ray diffraction, focusing on the structural evolution from 273 to 343 K. A pronounced lattice softening is observed close to the transition point, with the structure becoming more rigid immediately after the phase transition. The diffraction studies are further supported by theoretical analysis of pairwise intermolecular energies and zone-centre lattice vibrations. Only three modes are found to monotonically soften up to the phase transition, with complex behaviour exhibited by the remaining lattice modes. The thermosalient effect is delayed with respect to the structural transformation itself. This can originate from the martensitic mechanism of the transformation, and the accumulation of stress associated with vibrational switching across the phase transition. The finding of this study sheds more light on the nature of the thermosalient effect in 1,2,4,5-tetrabromobenzene and can be applicable also to other thermosalient compounds.

Are You Thinking about Suicide? How to Stay Safe and Find Treatment

Science.gov (United States)

... number — in the United States, call the National Suicide Prevention Lifeline at 800-273-TALK (800-273-8255) ... www.dbsalliance.org/site/PageServer?pagename=education_brochures_suicide_prevention. Accessed April 30, 2015. McDowell AK, et al. ...

Chemical and biological evaluation of Sm-153 and Ho-166 complexes with tetraethylester of DOTP ( DOTPOEt )

Czech Academy of Sciences Publication Activity Database

Forsterová, Michaela; Margues, M. M.; Jandurová, Z.; Gano, L.; Hermann, P.; Melichar, František

2007-01-01

Roč. 50, č. 1 (2007), s. 273-273 ISSN 0362-4803 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : Phosphonate Complexes Subject RIV: FR - Pharmacology ; Medidal Chemistry

L-Glutamic acid production by Bacillus spp. isolated from vegetable ...

African Journals Online (AJOL)

Ogiri” (fermented vegetable proteins) in Nigeria. The isolates were identified as Bacillus subtilis (6), (27.3%), Bacillus pumilus (5), (22.7%), Bacillus licheniformis (5), (27.3%) and Bacillus polymyxa (6), (22.7%). Four species of the Bacillus isolates ...

The importance and measurement of new production

Digital Repository Service at National Institute of Oceanography (India)

Platt, T.; Jauhari, P.; Sathyendranath, S.

stream_size 12 stream_content_type text/plain stream_name Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt stream_source_info Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

Role of Nuclear Matrix in Estrogen Regulated Gene Expression in Human Breast Cancer Cells

Science.gov (United States)

1998-08-01

reticular pattern evenly distributed throughout the nucleus, excluding the nucleolus (Figure 4A). This is not so for T47D cells where a composite pattern...acetylation is required to maintain the unfolded nucleosome structure associated with transcribing DNA. Journal of Biological Chemistry 273:14516...nuclear matrix include ER, YY1, AML-1, Spl, Oct1, mutant p53, and Rb [25,28,31,34-40]. Appendix A, part 4 reviews alterations in nuclear matrix composition

Morphometric Studies Of The Reproductive Organs And Sperm ...

African Journals Online (AJOL)

... testicular sperm reserves was 27.3±3.1 x 109. The mean weights of the accessory glands were: Seminal Vesicles, 42.2±4g; ampullae, 12.4±2.0g; Prostate gland, 2.2±0.29g and 1.3±0.3g for the bulbourethral gland. The mean penile length was 80.9±2.9cm while the glans penis and the urethral process measured 3.1 ±0.1 ...

Too large or too small? Returns to scale in a retail network

Czech Academy of Sciences Publication Activity Database

Brázdik, František; Druska, V.

-, č. 273 (2005), s. 1-45 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : data envelopment analysis application * linear programming * retail units Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp273.pdf

Post-Synthesis Modification of SSZ-35 Zeolite to Enhance the Selectivity in p-Xylene Alkylation with Isopropyl Alcohol

Czech Academy of Sciences Publication Activity Database

Musilová, Zuzana; Zones, S. I.; Čejka, Jiří

2010-01-01

Roč. 53, 3-4 (2010), s. 273-282 ISSN 1022-5528 R&D Projects: GA AV ČR 1QS400400560; GA ČR GD203/08/H032 Institutional research plan: CEZ:AV0Z40400503 Keywords : SSZ-35 * surface modification * p-xylene * 2,5-dimethylcumene Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.359, year: 2010

The Space Telescope Looks for Black Holes v V V V V v

Indian Academy of Sciences (India)

The sun emits about 4 x 1033 erg/sec, a typical galaxy 1043 erg/sec. But an active galaxy may easily emit 1046ergs/sec, all from a small region near its centre. An early example is the object known as 3C273, which appeared like a bright star in photographs. (hence the name quasi stellar radio source shortened to quasar).

Jan Dullaert of Ghent on the Foundations of Propositional Logic

Czech Academy of Sciences Publication Activity Database

Hanke, Miroslav

2017-01-01

Roč. 55, č. 4 (2017), s. 273-306 ISSN 0042-7543 R&D Projects: GA ČR GB14-37038G Institutional support: RVO:67985955 Keywords : Jan Dullaert of Ghent * the circle of John Mair * scholastic logic * propositional logic * Bradwardine’s principle * infinite expressions Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

Rozdíly v klinickém obraze a laboratorních nálezech v časné fázi aseptického zánětu CNS dle vyvolávajícího agens

Czech Academy of Sciences Publication Activity Database

Heinige, P.; Fajt, M.; Šilhánková, I.; Halašková, P.; Jiroušová, M.; Matějčková, Eva; Ješina, Pavel

2006-01-01

Roč. 61, č. 5 (2006), s. 273-273 ISSN 0069-2328. [Český pediatrický kongres s mezinárodní účastí /7./. 08.06.2006-11.06.2006, Praha] Keywords : CNS * aseptic inflammation Subject RIV: FG - Pediatrics

Transcriptome profiling of resistant and susceptible Cavendish banana roots following inoculation with Fusarium oxysporum f. sp. cubense tropical race 4

Directory of Open Access Journals (Sweden)

Li Chun-yu

2012-08-01

Full Text Available Abstract Background Fusarium wilt, caused by the fungal pathogen Fusarium oxysporum f. sp. cubense tropical race 4 (Foc TR4, is considered the most lethal disease of Cavendish bananas in the world. The disease can be managed in the field by planting resistant Cavendish plants generated by somaclonal variation. However, little information is available on the genetic basis of plant resistance to Foc TR4. To a better understand the defense response of resistant banana plants to the Fusarium wilt pathogen, the transcriptome profiles in roots of resistant and susceptible Cavendish banana challenged with Foc TR4 were compared. Results RNA-seq analysis generated more than 103 million 90-bp clean pair end (PE reads, which were assembled into 88,161 unigenes (mean size = 554 bp. Based on sequence similarity searches, 61,706 (69.99% genes were identified, among which 21,273 and 50,410 unigenes were assigned to gene ontology (GO categories and clusters of orthologous groups (COG, respectively. Searches in the Kyoto Encyclopedia of Genes and Genomes Pathway database (KEGG mapped 33,243 (37.71% unigenes to 119 KEGG pathways. A total of 5,008 genes were assigned to plant-pathogen interactions, including disease defense and signal transduction. Digital gene expression (DGE analysis revealed large differences in the transcriptome profiles of the Foc TR4-resistant somaclonal variant and its susceptible wild-type. Expression patterns of genes involved in pathogen-associated molecular pattern (PAMP recognition, activation of effector-triggered immunity (ETI, ion influx, and biosynthesis of hormones as well as pathogenesis-related (PR genes, transcription factors, signaling/regulatory genes, cell wall modification genes and genes with other functions were analyzed and compared. The results indicated that basal defense mechanisms are involved in the recognition of PAMPs, and that high levels of defense-related transcripts may contribute to Foc TR4 resistance in

Complete genomic sequences for hepatitis C virus subtypes 4b, 4c, 4d, 4g, 4k, 4l, 4m, 4n, 4o, 4p, 4q, 4r and 4t.

Science.gov (United States)

Li, Chunhua; Lu, Ling; Wu, Xianghong; Wang, Chuanxi; Bennett, Phil; Lu, Teng; Murphy, Donald

2009-08-01

In this study, we characterized the full-length genomic sequences of 13 distinct hepatitis C virus (HCV) genotype 4 isolates/subtypes: QC264/4b, QC381/4c, QC382/4d, QC193/4g, QC383/4k, QC274/4l, QC249/4m, QC97/4n, QC93/4o, QC139/4p, QC262/4q, QC384/4r and QC155/4t. These were amplified, using RT-PCR, from the sera of patients now residing in Canada, 11 of which were African immigrants. The resulting genomes varied between 9421 and 9475 nt in length and each contains a single ORF of 9018-9069 nt. The sequences showed nucleotide similarities of 77.3-84.3 % in comparison with subtypes 4a (GenBank accession no. Y11604) and 4f (EF589160) and 70.6-72.8 % in comparison with genotype 1 (M62321/1a, M58335/1b, D14853/1c, and 1?/AJ851228) reference sequences. These similarities were often higher than those currently defined by HCV classification criteria for subtype (75.0-80.0 %) and genotype (67.0-70.0 %) division, respectively. Further analyses of the complete and partial E1 and partial NS5B sequences confirmed these 13 'provisionally assigned subtypes'.

Catalytic isotope exchange reaction between deuterium gas and water pre-adsorbed on platinum/alumina

International Nuclear Information System (INIS)

Iida, Itsuo; Kato, Junko; Tamaru, Kenzi.

1976-01-01

The catalytic isotope exchange reaction between deuterium gas and the water pre-adsorbed on Pt/Al 2 O 3 was studied. At reaction temperatures above 273 K, the exchange rate was proportional to the deuterium pressure and independent of the amount of adsorbed water, which suggests that the rate determining step is the supply of deuterium from the gas phase. Its apparent activation energy was 38 kJ mol -1 . Below freezing point of water, the kinetic behaviour was different from that above freezing point. At higher deuterium pressures the rate dropped abruptly at 273 K. Below the temperature the apparent activation energy was 54 kJ mol -1 and the exchange rate depended not on the deuterium pressure but on the amount of the pre-adsorbed water. At lower pressures, however, the kinetic behaviour was the same as the above 273 K, till the rate of the supply of deuterium from the gas phase exceeded the supply of hydrogen from adsorbed water to platinum surface. These results suggest that below 273 K the supply of hydrogen is markedly retarded, the state of the adsorbed water differing from that above 273 K. It was also demonstrated that when the adsorbed water is in the state of capillary condensation, the exchange rate becomes very small. (auth.)

IDENTIFIKASI BAKTERI DARI IKAN TONGKOL (Euthynnus affinis YANG DIPERDAGANGKAN DI PASAR IKAN KEDONGANAN BALI

Directory of Open Access Journals (Sweden)

Gusti Ayu Dianti Violentina

2016-06-01

Full Text Available Ikan tongkol (Euthynnus affinis merupakan ikan konsumsi yang disukai masyarakat.Pengetahuan tentang bakteri yang ditemukan pada tubuh ikan ini sangat penting untuk tujuan kesehatan masyarakat dan kajian biologi ikan.  Penelitian ini bertujuan untuk mengidentifikasi bakteri yang berasosiasi dengan ikan tersebut.Bakteri dari usus ikan diambil secara aseptis dan ditumbuhkan pada Blood Agar dan Nutrient Broth. DNA total dari kultur agar cair diisolasi dengan chelax, gen 16S RNA diamplifikasi dengan PCR menggunakan primer universal dengan produk sekitar 1300 bp. Produk PCR dirunut dengan metode Big-Dye termination. Hasilnya disepadankan dan dianalisis dengan MEGA 6.0. Pada penelitian ini, 14 spesies bakteri yang memiliki > 99% kesamaan dengan data GenBankteridentifikasi, yaitu Photobacterium leiognathi, Uruburuella testudinis, Aeromonas molluscorum, Psychrobacter celer, Psychrobacer faecalis, Acinetobacter johnsonii, Vibrio gallicus, Bacillus megaterium, Vagococcus fessus, Shewanella baltica, Shewanella algae, Rothia nasimurium, Myroides phaeus dan Yersinia ruckeri. Peran bakteribakteri tersebut dalam biologi ikan dan kesehatan masyarakat perlu dikaji lebih lanjut.

Isolation of Aureimonas altamirensis, a Brucella canis-like bacterium, from an edematous canine testicle.

Science.gov (United States)

Reilly, Thomas J; Calcutt, Michael J; Wennerdahl, Laura A; Williams, Fred; Evans, Tim J; Ganjam, Irene K; Bowman, Jesse W; Fales, William H

2014-11-01

Microbiological and histological analysis of a sample from a swollen testicle of a 2-year-old Border Collie dog revealed a mixed infection of the fungus Blastomyces dermatitidis and the Gram-negative bacterium Aureimonas altamirensis. When subjected to an automated microbial identification system, the latter isolate was provisionally identified as Psychrobacter phenylpyruvicus, but the organism shared several biochemical features with Brucella canis and exhibited agglutination, albeit weakly, with anti-B. canis antiserum. Unequivocal identification of the organism was only achieved by 16S ribosomal RNA gene sequencing, ultimately establishing the identity as A. altamirensis. Since its first description in 2006, this organism has been isolated infrequently from human clinical samples, but, to the authors' knowledge, has not been reported from a veterinary clinical sample. While of unknown clinical significance with respect to the pathology observed for the polymicrobial infection described herein, it highlights the critical importance to unambiguously identify the microbe for diagnostic, epidemiological, infection control, and public health purposes. © 2014 The Author(s).

Medical Effects and Dosimetric Data from Nuclear Tests at Semipalatinsk

Science.gov (United States)

2006-10-01

5 7 2 Displaced sex organs 3 11 7 Uterine prolapse and varicose labial veins 5 7 7 Total 130 273 119 The colpitis observed in middle-aged women was...breathing, and eye irritation. The skies were overcast and dusk fell; the cattle were restless, and howling dogs , their tails between their legs, would...Fibrocystic changes of the ovary 4 5 -- Cervical canal polyps 2 2 6 Uterine fi bromyoma 8 10 4 Posthysterectomy changes (radical hys- terectomy for cancer

76 FR 59927 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

Science.gov (United States)

2011-09-28

...-0029] RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were... qualifying aliens whose employment-creation immigrant petitions were approved by the former Immigration and...-273 Provisions C. Summary of the Adjudications Required by Public Law 107-273 III. Aliens Eligible To...

Study of dilute aluminum--gold alloys for superconducting stabilizer applications

International Nuclear Information System (INIS)

Hartwig, K.T. Jr.

1977-01-01

Control over a wide variation in mechanical and physical characteristics was achieved by subjecting Al--Au alloys to precipitation hardening treatments. Annealing phenomena were monitored by resistivity measurements at 273, 77, and 4.2 K and by yield strength measurements at 296, 77, and 4.2 K. Transmission electron microscopy was employed to confirm the presence of an intermetallic precipitate dispersion in aged Al--Au. Artificial aging of Al--Au results in a remarkable strength increase and a large decrease in resistivity at 4.2 K as numerous Al 2 Au precipitates form. The precipitation mechanism is independent of composition up to at least 0.2 wt % Au. Regardless of the heat treatment used to induce aging the alloy resistivity is directly proportional to gold concentration. At long aging times the residual resistivity ratio (RRR identical with rho/sub 273 K//rho sub 4.2 K/) of Al--0.2 wt % Au approaches 1000. The yield strength of Al--Au alloys at 4.2 K is shown to be directly proportional to gold concentration for aged alloy and is six to seven times greater than that of pure aluminum. The optimum strength-resistivity relationship was defined for Al--0.2 wt % Au. Thus, Al--Au seems to be comparable to other materials now used as stabilizers. Consideration was also given to the potential stabilizer use of dilute Al--Sb alloys, the prospect for use was not promising

Flight activity and habitat preference of bats in a karstic area, as revealed by bat detectors

Czech Academy of Sciences Publication Activity Database

Zukal, Jan; Řehák, Z.

2006-01-01

Roč. 55, č. 3 (2006), s. 273-281 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : Moravian Karst * echolocation calls * bat community * detectoring Subject RIV: EG - Zoology Impact factor: 0.529, year: 2006 http://www.ivb.cz/folia/55/3/273-281.pdf

It’s Easy to Recycle at NCI at Frederick | Poster

Science.gov (United States)

From 2013 through the first quarter of 2018, NCI at Frederick has recycled over 1,667 tons of material, while incinerating or landfilling over 4,273 tons of trash. This earns us a recycling rate close to 28 percent, which is below the national average of 32 percent, according to the Environmental Protection Agency, and well below our goal of 50 percent. (These numbers only

Summary Review of the Aquatic Toxicology of Munitions Constituents

Science.gov (United States)

2013-06-01

to be related to explosives-induced changes in the nutritional status of the sediment and biochemical and physiological alterations in invertebrates...vitro reaction of 2,4,6-trinitrotoluene with human hemoglobin using electrospray ionization mass spectrometry. J. Inorg. Biochem., 68:273-278. Belden...Maryland System, Agricultural Experiment Station, Wye Research and Education Center. Burton, D. T., S. D. Turley, G. T. Peters. 1994. The acute and

Res Cover Sep 07

Indian Academy of Sciences (India)

THOLASI

[1] N D Kazarinoff, Analytic Inequalities, Holt, New York, pp.63–64, 1961. [2] D S Mitrinovic, Analytic Inequalities, Springer-Verlag, Berlin, pp. 272–. 273, 1970. [3] B C Carlson, Amer. Math. Monthly, Vol.79, pp.615–618, 1972. [4] Tung-Po Lin, Amer. Math. Monthly, Vol.81, pp.879–883, 1974. From (2) and (3),w e have log p ! 0.

Extrapyramidal disease

Institute of Scientific and Technical Information of China (English)

2010-01-01

2010380 Evaluation non-motor symptoms in Parkinson’s disease and its influence on ability of daily living. WANG Rongfei(王荣飞),et al. Dept Neurol,1st Hosp,Guangzhou Med Coll,Guangzhou 510000. Chin J Neurol 2010;43(4):273-276. Objective To evaluate the non-motor symptoms (NMS) in Parkinson’s disease (PD),and its influence on ability of daily living (ADL) in PD

The Effect of Gas Density on Gas Transport during High Frequency Oscillation

Science.gov (United States)

1985-04-04

found that as alveolar ventilation increased the rate of uptake of halothane increased. Papper and Kitz (1963) used conventiot~al positive pressure...coefficient (halothane) = 2.3 ( Papper and Kitz, 1963; Wylie and Churchill-Davidson, 1972; Eger, 1976) [ 11] v2 =Volume (L), (310)(22.4)/ 273...there is an increase in alveolar concentration of halothane with conventional ventilation (Kety, 1951; Papper and Kitz, 1963). Our halothane uptake

The Accuracy of Anthropometric Equations to Assess Body Fat in Adults with Down Syndrome

Science.gov (United States)

Rossato, Mateus; Dellagrana, Rodolfo André; da Costa, Rafael Martins; de Souza Bezerra, Ewertton; dos Santos, João Otacílio Libardoni; Rech, Cassiano Ricardo

2018-01-01

Background: The aim of this study was to verify the accuracy of anthropometric equations to estimate the body density (BD) of adults with Down syndrome (DS), and propose new regression equations. Materials and methods: Twenty-one males (30.5 ± 9.4 years) and 17 females (27.3 ± 7.7 years) with DS participated in this study. The reference method for…

Veterans Crisis Line: 1-800-273-8255

Science.gov (United States)

Veterans Crisis Line Skip to Main Content SuicidePreventionLifeline.org Get Help Materials Get Involved Crisis Centers About Be There ... Line FAQs Veteran Suicide Welcome to the Veterans Crisis Line Website The Veterans Crisis Line connects Veterans ...

273 LEKSIKOGRAFIE EN LINGUISTIEK Piet Swanepoel UNISA ...

African Journals Online (AJOL)

daar die neiging bestaan om die leksikografie eenvoudig te reduseer tot die toegepaste been van die .... vakgebied, wat dit uitsluit dat enige toegepaste taaldissipJine eenvoudig tot die praktiese komponent van die ..... examples of each phenomenon that they study, remaining oblivious to how large or small a set of lexical ...

25 CFR 273.49 - Freedom of information.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE... disclosure only when both of the following conditions exist: (1) The reports and information fall within one... where disclosure would be a clearly unwarranted invasion of personal privacy. (2) Disclosure is...

Flow-induced vibration -- 1994. PVP-Volume 273

International Nuclear Information System (INIS)

Au-Yang, M.K.; Fujita, K.

1994-01-01

Flow-induced vibration is a subject of practical interest to many engineering disciplines, including the power generation, process, and petrochemical industries. In the nuclear industry, flow-induced vibration reaches a higher level of concern because of safety issues and the huge cost associated with down time and site repair. Not surprisingly, during the last 25 years a tremendous amount of effort has been spent in the study of flow-induced vibration phenomena related to nuclear plant components, notably nuclear steam generator tube banks and nuclear fuel bundles. Yet, in spite of this concentrated effort, the industry is still not free from flow-induced vibration-related problems. This explains why in this volume almost half of the papers address the issue of cross-flow induced vibration in tube bundles, with applications to the nuclear steam generator and nuclear fuel bundles in mind. Unlike 10 or 15 years ago, when flow-induced vibration studies almost always involved experimentation and empirical studies, the advent of high-speed computers has enabled numerical calculation and simulation of this complex phenomenon to take place. Separate abstracts were prepared for 27 papers in this volume

40 CFR 60.273a - Emission monitoring.

Science.gov (United States)

2010-07-01

... sensor must provide output of relative particulate matter loadings and the owner or operator shall... the bag leak detection system including quality assurance procedures; (iv) How the bag leak detection... discharged to the atmosphere through a stack, the bag leak detection sensor must be installed downstream of...

7 CFR 273.18 - Claims against households.

Science.gov (United States)

2010-01-01

..., referrals to collection and/or other similar private and public sector agencies, state tax refund and... different type of claim (e.g., as an IHE rather than an IPV claim). (B) all adult household members die must... public service This form of payment must be ordered by a court and specifically be in lieu of paying any...

7 CFR 273.8 - Resource eligibility standards.

Science.gov (United States)

2010-01-01

... by the Department of Housing and Urban Development through the individual and family grant program or... any business or corporation under the control, direction, or influence of a household member; and (iv...

Measurement of Aerosol Optical Properties by Integrating Cavity Ring-Down Spectroscopy and Nephelometry

Science.gov (United States)

2013-01-01

Getachew Tedela North Carolina A&T State University 1601 East Market Street Greensboro, NC 27411 -3209 REPORT DOCUMENTATION PAGE b. ABSTRACT UU c. THIS...2.1013 3.273 )( P TSTPgasKgasK  (18) Where, the standard temperature and pressure ( STP ) are 273.2 k and 1013.2 mb

A short synthesis and its application to the preparation of radio labelled leukotriene inhibitor Sch 37224

International Nuclear Information System (INIS)

Duelfer, T.; Gala, D.

1991-01-01

A new, short synthesis of 1-(1,2-dihydro-4-hydroxyl-1-phenyl-2-oxo-1,8-naphthyridin-3-yl)-pyrrolidinium hydroxide, inner salt, 1, was achieved by condensing methyl 2-phenylamino-3-pyridine carboxylate 2 with ethyl 1-pyrrolidine acetate 4. This gave highly pure product in 60% yield. This synthesis was applied to the preparation of 14 C labelled 1. Radiolabelled 1 was synthesized from u-[ 14 C]-aniline in three steps at 97% radiochemical purity and 27.3% radiochemical yield. (author)

Interventional studies in childhood dystonia do not address the concerns of children and their carers.

Science.gov (United States)

Lumsden, Daniel E; Gimeno, Hortensia; Tustin, Kylee; Kaminska, Margaret; Lin, Jean-Pierre

2015-05-01

This study aimed to determine the main concerns/priorities of the parents and carers of children with dystonia referred to our service and whether medical interventional studies addressed these concerns. Records of children assessed by our service from June 2005-December 2012 were reviewed and expressed parental/carer concerns at initial assessment categorized using the International Classification of Functioning (ICF) Framework. Medline, CINAHL and Embase databases were searched for outcome measures of medical and surgical interventional studies in childhood dystonia. Data was collected from 273 children and young people with dystonia. The most commonly expressed concerns were: pain (104/273, 38.1%); difficulties in delivering activities of daily-living (66/273, 24.2%), difficulties with hand-use (59/273, 21.6%) and seating (41/273, 15.0%). Literature review identified 70 interventional studies, 46 neurosurgical and 24 pharmacological. The majority of neurosurgical studies (34/46) used impairment scales to measure change, with pharmacological studies typically reporting more subjective changes in motor symptoms. Only a minority of studies used assessments or scales capable of objectively addressing the concerns reported by our cohort. Existing interventional studies in childhood dystonia poorly address the main concerns of children with dystonia and their carers, limiting the conclusions which may be drawn as to true impact of these interventions in childhood. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.

Characterization of direct methanol fuel cell (DMFC) applications with H{sub 2}SO{sub 4} modified chitosan membrane

Energy Technology Data Exchange (ETDEWEB)

Osifo, Peter O.; Masala, Aluwani [Department of Chemical Engineering, Vaal University of Technology, Andries Potgieter Bolevald, P/Bag X021, Vanderbijlpark 1900, Gauteng (South Africa)

2010-08-01

Chitosan (Chs) flakes were prepared from chitin materials that were extracted from the exoskeleton of Cape rock lobsters in South Africa. The Chs flakes were prepared into membranes and the Chs membranes were modified by cross-linking with H{sub 2}SO{sub 4}. The cross-linked Chs membranes were characterized for the application in direct methanol fuel cells. The Chs membrane characteristics such as water uptake, thermal stability, proton resistance and methanol permeability were compared to that of high performance conventional Nafion 117 membranes. Under the temperature range studied 20-60 C, the membrane water uptake for Chs was found to be higher than that of Nafion. Thermal analysis revealed that Chs membranes could withstand temperature as high as 230 C whereas Nafion 117 membranes were stable to 320 C under nitrogen. Nafion 117 membranes were found to exhibit high proton resistance of 284 s cm{sup -1} than Chs membranes of 204 s cm{sup -1}. The proton fluxes across the membranes were 2.73 mol cm{sup -2} s{sup -1} for Chs- and 1.12 mol cm{sup -2} s{sup -1} Nafion membranes. Methanol (MeOH) permeability through Chs membrane was less, 1.4 x 10{sup -6} cm{sup 2} s{sup -1} for Chs membranes and 3.9 x 10{sup -6} cm{sup 2} s{sup -1} for Nafion 117 membranes at 20 C. Chs and Nafion membranes were fabricated into membrane electrode assemblies (MAE) and their performances measure in a free-breathing commercial single cell DMFC. The Nafion membranes showed a better performance as the power density determined for Nafion membranes of 0.0075 W cm{sup -2} was 2.7 times higher than in the case of Chs MEA. (author)

Microbial community of high arsenic groundwater in agricultural irrigation area of Hetao Plain, Inner Mongolia

Directory of Open Access Journals (Sweden)

Yanhong Wang

2016-12-01

Full Text Available Microbial communities can play important role in arsenic release in groundwater aquifers. To investigate the microbial communities in high arsenic groundwater aquifers in agricultural irrigation area, 17 groundwater samples with different arsenic concentrations were collected along the agricultural drainage channels of Hangjinhouqi County, Inner Mongolia and examined by illumina Miseq sequencing approach targeting the V4 region of the 16S rRNA gene. Both principal component analysis and hierarchical clustering results indicated that these samples were divided into two groups (high and low arsenic groups according to the variation of geochemical characteristics. Arsenic concentrations showed strongly positive correlations with NH4+ and TOC. Sequencing results revealed that a total of 329-2823 OTUs were observed at the 97% OTU level. Microbial richness and diversity of high arsenic groundwater samples along the drainage channels were lower than those of low arsenic groundwater samples but higher than those of high arsenic groundwaters from strongly reducing areas. The microbial community structure in groundwater along the drainage channels was different from those in strongly reducing As-rich aquifers of Hetao Plain and other high As groundwater aquifers including Bangladesh, West Bengal and Vietnam. Acinetobacter and Pseudomonas dominated with high percentages in both high and low arsenic groundwaters. Alishewanella, Psychrobacter, Methylotenera and Crenothrix showed relatively high abundances in high arsenic groundwater, while Rheinheimera and the unidentified OP3 were predominant populations in low arsenic groundwater. Archaeal populations displayed a low occurrence and mainly dominated by methanogens such as Methanocorpusculum and Methanospirillum. Microbial community compositions were different between high and low arsenic groundwater samples based on the results of principal coordinate analysis and co-inertia analysis. Other geochemical

Progress in Primary Acoustic Thermometry at NIST: 273 K to 505 K

Science.gov (United States)

Strouse, G. F.; Defibaugh, D. R.; Moldover, M. R.; Ripple, D. C.

2003-09-01

The NIST Acoustic Thermometer determines the thermodynamic temperature by measuring the speed of sound of argon in a spherical cavity. We obtained the thermodynamic temperature of three fixed points on the International Temperature Scale of 1990: the melting point of gallium [T(Ga) = 302.9146 K] and the freezing points of indium [T(In) = 429.7485 K] and tin [T(Sn) = 505.078 K]. The deviations of thermodynamic temperature from the ITS-90 defined temperatures are T - T90 = (4.7 ± 0.6) mK at T(Ga) , T - T90 = (8.8 ± 1.5) mK at T(In) , and T - T90 = (10.7 ± 3.0) mK at T(Sn) , where the uncertainties are for a coverage factor of k = 1. Our results at T(In) and T(Sn) reduce the uncertainty of T - T90 by a factor of two in this range. Both T - T90 at T(Ga) and the measured thermal expansion of the resonator between the triple point of water and T(Ga) are in excellent agreement with the 1992 determination at NIST. The dominant uncertainties in the present data come from frequency-dependent and time-dependent crosstalk between the electroacoustic transducers. We plan to reduce these uncertainties and extend this work to 800 K.

Reactive oxygen metabolites (ROMs) are associated with cardiovascular disease in chronic hemodialysis patients.

Science.gov (United States)

Bossola, Maurizio; Vulpio, Carlo; Colacicco, Luigi; Scribano, Donata; Zuppi, Cecilia; Tazza, Luigi

2012-02-11

The aim of our study was to measure reactive oxygen metabolites (ROMs) in chronic hemodialysis (HD) patients and evaluate the possible association with cardiovascular disease (CVD) and mortality. We measured ROMs in 76 HD patients and correlated with CVD, cardiovascular (CV) events in the follow-up and all-cause and CVD-related mortality. The levels of ROMs presented a median value of 270 (238.2-303.2) CARR U (interquartile range). We created a ROC curve (ROMs levels vs. CVD) and we identified a cut-off point of 273 CARR U. Patients with ROMs levels ≥273 CARR U were significantly older, had higher C-reactive protein levels and lower creatinine concentrations. The prevalence of CVD was higher in patients with ROMs levels ≥273 (87.1%) than in those with ROMs levels <273 CARR U (17.7%; p<0.0001). ROMs levels were significantly higher in patients with CVD (317±63.8) than in those without (242.7±49.1; p<0.0001). At multiple regression analysis, age, creatinine and C-reactive protein were independent factors associated with ROMs. At multiple logistic regression analysis the association between ROMs and CVD was independent (OR: 1.02, 95% CI: 1.00-1.05; p=0.03). Twenty six patients developed cardiovascular (CV) events during the follow-up. Of these, seven were in the group with ROMs levels <273 CARR U and 19 in the group with ROMs levels ≥273 CARR U. The logistic regression analysis showed that both age (OR: 1.06, 95% CI: 1.01-1.12; p=0.013) and ROMs levels (OR: 1.10, 95% CI: 1.00-1.02; p=0.045) were independently associated with CV events in the follow-up. ROMs are independently associated with CVD and predict CV events in chronic HD patients.

Project CHECO Southeast Asia Report. Operation Attleboro

Science.gov (United States)

1967-04-14

By the early morning of the 5th, the 273rd VC Regiment was once again 3 18-.... I A~POALI ~~llajor Enemy Contacts 0 S& , Ir iT~~~g I~c Srok Ca6 s6o...321 machetes, 1 VC flag, 1 chemical agent treatment kit, 1 -ton trail- er, 4 gas masks, 1 farm tractor, 1 pig, 1 set scales, 1 pr binoculars, 2

El episodio virgiliano de Aristeo y las Metamorfosis de Ovidio

Directory of Open Access Journals (Sweden)

Cristina Martín Puente

2000-06-01

Full Text Available Ovid recreates in different ways and mesure, motives, characters and scenes of the episode of the Aristaeus’ entrance into the river Peneus and the welcome that his mother and the nymphs give him in the Georgics (IV 315 ss. in several passages of the Metamorphoses, namely in IV 32- 273; I 1-4; I 569-576; VIII 547-573; XIV 248-285 and III 138-252.

AcEST: BP913708 [AcEST

Lifescience Database Archive (English)

Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

Frequency of autoimmune disorders and autoantibodies in patients with neuromyelitis optica.

Science.gov (United States)

Pereira, Wildéa Lice de Carvalho Jennings; Reiche, Edna Maria Vissoci; Kallaur, Ana Paula; Oliveira, Sayonara Rangel; Simão, Andréa Name Colado; Lozovoy, Marcell Alysson Batisti; Schiavão, Lucas José Vaz; Rodrigues, Paula Raquel do Vale Pascoal; Alfieri, Daniela Frizon; Flauzino, Tamires; Kaimen-Maciel, Damacio Ramón

2017-06-01

The aim of this study was to report the frequency of autoimmune disorders and autoantibodies in 22 patients with neuromyelitis optica (NMO), as well as whether the seropositivity for autoantibodies differs between anti-aquaporin 4 (AQP4) positive and AQP4 negative NMO patients. Demographic, medical records, and a profile of autoantibodies were evaluated in 22 NMO patients, including AQP4, anti-thyroid-stimulating hormone receptor, antinuclear antibodies (ANA), anti-thyroperoxidase (anti-TPO), anti-thyroglobulin (anti-Tg), anti-double-stranded DNA, anti-neutrophil cytoplasmic, anti-cyclic citrullinate peptide, rheumatoid factor, anti-SSA/Ro, anti-SSB/La, anti-Smith antibodies (anti-Sm), anti-ribonucleoprotein, anti-nucleosome, and anti-Scl70. Thyroid-stimulating hormone and free thyroxin were measured. The frequency of women was higher than men (95.5% vs. 4.5%) and 68.2% were Afro-Brazilians. Six (27.3%) patients presented other autoimmune disorders, such as Hashimoto thyroiditis (n=2), Graves' disease (n=1), juvenile idiopathic arthritis (n=1), systemic lupus erythematosus and systemic sclerosis (n=1), and Raynaud's phenomenon (n=1). The most frequent autoantibodies were anti-AQP4 (54.5%), anti-nucleosome (31.8%), ANA (27.3%), anti-TPO (22.7%), and anti-Tg (22.7%). Difference was not observed in the frequency of autoimmune disorders when the patients were compared according to their anti-AQP4 status. The results of the present study underscored that the NMO patients present high frequency of autoantibodies against cellular antigens and the presence of autoimmune disorders. Further studies with large number of NMO patients may contribute to advances in the understanding of NMO disease mechanisms.

Improvement of the Bacterial Pure Culture 3A by Gamma Irradiation for Increasing Efficiency in Degrading Pesticides

International Nuclear Information System (INIS)

Tongpim, Saowanit; Piadaeng, Nattaya

2006-09-01

This research work had an objective to improve bacterial activity in degrading a herbicide: 2,4-dichlorophenoxyacetic acid (2,4-D). The bacterial isolate 3 A , kept in the culture collection of Khon Kaen University that could degrade 2,4-D, was employed in this experiment. Cell suspension of isolate 3 A was exposed to gamma irradiation at various doses (1-5 kGy). The isolated survivors were screened on the basis of forming larger colonies than the parent strain 3 A when grown on mineral salts agar containing 2,4-D (MS + 2,4-D) as the sole carbon source. We obtained 70 effective isolates which 6 isolates called 3 A I2-21, 3 A I2-23, 3 A I1-51, 3 A I2-71, 3 A I1-52 and 3 A I2-73 were chosen for further studies. These 6 irradiated isolates together with the parent strain were characterized using morphological, physiological and biochemical tests. They were all identified as Pseudomonas cepacia. All isolates had optimal growth pH of 7 and grew best at 30 o C. Biodegradation experiments performed in mineral salts medium containing 200 ppm of 2,4-D showed that after 20 days of incubation 36.9%, 65.3%, 57.2%, 54.8%, 53.4%, 47.3% and 45.8% of 2,4- D was degraded by isolates 3 A , 3 A I2-21, 3 A I2-23, 3 A I1-51, 3 A I2-71, 3 A I1-52 and 3 A I2-73, respectively. Comparing the irradiated strains with parent strain 3 A revealed that the isolate 3 A I2-21 was the most effective one as it could degrade 2,4-D about 28.4% greater than the parent strain 3 A .

Porous carbon derived via KOH activation of a hypercrosslinked porous organic polymer for efficient CO{sub 2}, CH{sub 4}, H{sub 2} adsorptions and high CO{sub 2}/N{sub 2} selectivity

Energy Technology Data Exchange (ETDEWEB)

Modak, Arindam; Bhaumik, Asim, E-mail: msab@iacs.res.in

2015-12-15

Microporous carbon having Brunauer-Emmett-Teller (BET) surface area of 2186 m{sup 2} g{sup −1} and micropore volume of 0.85 cm{sup 3} g{sup −1} has been synthesized via KOH induced high temperature carbonization of a non-conjugated hypercrosslinked organic polymer. Owing to the templating and activation by KOH, we have succeeded in making a microporous carbon from this porous polymer and the resultant carbon material showed high uptake for CO{sub 2} (7.6 mmol g{sup −1}) and CH{sub 4} (2.4 mmol g{sup −1}) at 1 atm, 273 K together with very good selectivity for the CO{sub 2}/N{sub 2} (30.2) separation. Furthermore, low pressure (1 atm) H{sub 2} (2.6 wt%, 77 K) and water uptake (57.4 wt%, 298 K) ability of this polymer derived porous activated carbon is noteworthy. - Graphical abstract: Microporous carbon with BET surface area of 2186 m{sup 2} g{sup −1} has been synthesized via KOH activation of a porous organic polymer and it showed high uptake for CO{sub 2} (7.6 mmol g{sup −1}), CH{sub 4} (2.4 mmol g{sup −1}) and H{sub 2} (2.6 wt%) at 1 atm together with very good selectivity for CO{sub 2}. - Highlights: • Porous carbon from hypercrosslinked organic polymer. • KOH activated carbon with BET surface area 2186 m{sup 2} g{sup −1}. • High CO2 uptake (7.6 mmol g{sup −1}) and CO{sub 2}/N{sub 2} selectivity (30.2). • Porous carbon also showed high H{sub 2} (2.6 wt%) and H{sub 2}O (57.4 wt%) uptakes.

Glutathionylation of Yersinia pestis LcrV and Its Effects on Plague Pathogenesis

Directory of Open Access Journals (Sweden)

Anthony Mitchell

2017-05-01

Full Text Available Glutathionylation, the formation of reversible mixed disulfides between glutathione and protein cysteine residues, is a posttranslational modification previously observed for intracellular proteins of bacteria. Here we show that Yersinia pestis LcrV, a secreted protein capping the type III secretion machine, is glutathionylated at Cys273 and that this modification promotes association with host ribosomal protein S3 (RPS3, moderates Y. pestis type III effector transport and killing of macrophages, and enhances bubonic plague pathogenesis in mice and rats. Secreted LcrV was purified and analyzed by mass spectrometry to reveal glutathionylation, a modification that is abolished by the codon substitution Cys273Ala in lcrV. Moreover, the lcrVC273A mutation enhanced the survival of animals in models of bubonic plague. Investigating the molecular mechanism responsible for these virulence attributes, we identified macrophage RPS3 as a ligand of LcrV, an association that is perturbed by the Cys273Ala substitution. Furthermore, macrophages infected by the lcrVC273A variant displayed accelerated apoptotic death and diminished proinflammatory cytokine release. Deletion of gshB, which encodes glutathione synthetase of Y. pestis, resulted in undetectable levels of intracellular glutathione, and we used a Y. pestis ΔgshB mutant to characterize the biochemical pathway of LcrV glutathionylation, establishing that LcrV is modified after its transport to the type III needle via disulfide bond formation with extracellular oxidized glutathione.

Expanding the spectrum of mutations in GH1 and GHRHR: genetic screening in a large cohort of patients with congenital isolated growth hormone deficiency

DEFF Research Database (Denmark)

Alatzoglou, Kyriaki S; Turton, James P; Kelberman, Daniel

2009-01-01

mutations in GH1 (C182X, G120V, R178H, IVS3+4nt, a>t) and GHRHR (W273S, R94L, R162W). Autosomal dominant, type II IGHD was the commonest form (52.4%), followed by type IB (42.8%) and type IA (4.8%). Patients with type II IGHD had highly variable phenotypes. There was no difference in the endocrinology...... or magnetic resonance imaging appearance between patients with and without mutations, although those with mutations presented with more significant growth failure (height, -4.7 +/- 1.6 SDS vs. -3.4 +/- 1.7 SDS) (P = 0.001). There was no apparent difference between patients with mutations in GH1 and GHRHR...

Lean Six Sigma: Optimizing Operating Room Utilization at Bayne-Jones Army Community Hospital

Science.gov (United States)

2006-07-01

392 160 Opthalmology 2 1.5 0 0 0 0 Oral surgery 0 1 0 0 0 273 Orthopedics 15 11 0 0 903 864 Otorhinolaryngology 4 4.5 0 0 0 263 Podiatry 1 3 0 0 136...BBA) 5.21 2.94 855 Otorhinolaryngology(BBF) 4.25 3.41 369 Opthalmology (BBD) 6.92 1.81 154 Gynecology(BCB) 5.29 3.39 124 Podiatry(BEF) 6.00 3.31 45 Note...241.32 $320.67 4 Radiology 2.76 2.86 137 $189.75 $174.97 137 Optometrist 2.20 2.12 99 $109.27 $119.80 99 Opthalmology 7.15 4.61 88 $379.45 $349.48 88

Ecological Factors Influencing Emotional/Behavioral Problems and Self-Concept in Adolescents from Low-Income Families in South Korea.

Science.gov (United States)

Baek, Suyon; Yoo, Haewon

2017-09-01

In this study, we examined emotional/behavioral problems and self-concept in adolescents from low-income families in Korea; additionally, we identified ecological factors associated with these traits. This descriptive study employed an ecological model to analyze data from the Korean Children and Youth Panel Survey. A nationwide stratified multistage cluster sampling methodology was used. Overall, 2534 first-year middle school students were included in the survey, and the survey was conducted from 2010 to 2016. Hierarchical multiple regression models were generated. The mean score of emotional/behavioral problem has been changed from 2.20 (2011), 2.15 (2013), to 2.11 (2015) out of 4, and the mean score of self-concept has been changed from 2.73 (2012), 2.73 (2014), to 2.77 (2015) out of 4. Factors that influenced emotional/behavioral problems and self-concept among adolescents were health perception and academic achievement (only associated with self-concept) at the intrapersonal level and parenting style, peer attachment (only associated with self-concept), and relationships with teachers at the interpersonal level. These results may be used to inform the development of interventions designed to decrease emotional/behavioral problems and improve positive self-concept in adolescents from low-income families.

Archean crustal evolution in the central Minto block, northern Quebec

Energy Technology Data Exchange (ETDEWEB)

Skulski, T; Percival, J A; Stern, R A [Geological Survey of Canada, Ottawa, ON (Canada)

1997-12-31

The central Minto block contains three volcano-sedimentary successions. Near Lake Qalluviartuuq, an isotopically primitive ({sup 2.83} {sup Ga}{epsilon}{sub Nd} +3.8 to +2.3) 2.83 Ga volcano-plutonic sequence comprises depleted tholeiitic basalts, anorthositic gabbro, and diorite-granodiorite that is unconformably overlain by <2.77 Ga conglomerates. Overlying the conglomerate is a more evolved ({sup 2.76} {sup Ga}{epsilon}{sub Nd} +1.8) calc-alkaline sequence of pillow basalts, andesites, and peridotite cut by 2.73 Ga diorite. To the west, and in inferred tectonic contact, the sediment-dominated Kogaluc sequence includes both isotopically evolved calc-alkaline rocks ({sup 2.76} {sup Ga}{epsilon}{sub Nd} +1.6 to -0.1) including <2.76 Ga rhyolitic tuff, pillowed andesites, and 2.76 Ga quartz-feldspar porphyry, and less abundant, depleted tholeiitic basalts (2.76 GaF-Nd +2.4). These are interlain with sedimentary rocks including banded iron-formation, quartzite, and metagreywacke. Calc-alkaline batholiths include 2.78 Ga pyroxene-bearing intermediate and felsic plutons ({sup 2.78Ga}{epsilon}{sub Nd} <+2.7) and younger, peraluminous tonalites ({epsilon}{sub Nd} <+1.3). Late, 2.73 Ga peraluminous granitoids are isotopically evolved ({sup 2.725Ga}{epsilon}{sub Nd} - 1. 6). (author). 19 refs., 4 tabs., 5 figs.

Clinical negligence in foot and ankle surgery: A 17-year review of claims to the NHS Litigation Authority.

Science.gov (United States)

Ring, J; Talbot, C L; Clough, T M

2014-11-01

We present a review of litigation claims relating to foot and ankle surgery in the NHS in England during the 17-year period between 1995 and 2012. A freedom of information request was made to obtain data from the NHS litigation authority (NHSLA) relating to orthopaedic claims, and the foot and ankle claims were reviewed. During this period of time, a total of 10 273 orthopaedic claims were made, of which 1294 (12.6%) were related to the foot and ankle. 1036 were closed, which comprised of 1104 specific complaints. Analysis was performed using the complaints as the denominator. The cost of settling these claims was more than £36 million. There were 372 complaints (33.7%) involving the ankle, of which 273 (73.4%) were related to trauma. Conditions affecting the first ray accounted for 236 (21.4%), of which 232 (98.3%) concerned elective practice. Overall, claims due to diagnostic errors accounted for 210 (19.0%) complaints, 208 (18.8%) from alleged incompetent surgery and 149 (13.5%) from alleged mismanagement. Our findings show that the incorrect, delayed or missed diagnosis of conditions affecting the foot and ankle is a key area for improvement, especially in trauma practice. ©2014 The British Editorial Society of Bone & Joint Surgery.

Molecular beam electric deflection of the tetrahalides CF4, CCl4, SiF4, SiCl4, GeCl4, TiF4, TiCl4, VF4, and VCl4

International Nuclear Information System (INIS)

Muenter, A.A.; Dyke, T.R.; Falconer, W.E.; Klemperer, W.

1975-01-01

Using molecular beam electric deflection, the temperature dependence of polar behavior has been studied for the molecules CF 4 , CCl 4 , SiF 4 , SiCl 4 , GeCl 4 , TiF 4 TiCl 4 , VF 4 , VF 4 , and VCl 4 . A number of these molecules show polar behavior consistent with a vibrationally induced dipole moment for states with one or both of the triply degenerate vibrations excited. In four of the tetrachloride species, the presence of a vibrationally induced dipole moment was confirmed by the change in polar behavior with isotopic substituion of the Cl atoms. The deflection behavior of the transition metal tetrahalides varied from nonpolar in VCl 4 to very polar in TiF 4

Photochemistry of U(BH4)4 and U(BD4)4

International Nuclear Information System (INIS)

Paine, R.T.; Schonberg, P.R.; Light, R.W.; Danen, W.C.; Freund, S.M.

1979-01-01

U(BH 4 ) 4 and U(BD 4 ) 4 are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH 4 ) 3 , B 2 H 6 , H 2 , U(BD 4 ) 3 , B 2 D 6 and D 2 . Further, U(BD 4 ) 4 undergoes a related decomposition reaction under the influence of CO 2 laser irradiation at 924.97 cm -1 . (author)

Stability and Rheology of Dilute TiO2 – Water Nanofluids

Czech Academy of Sciences Publication Activity Database

Pěnkavová, Věra; Tihon, Jaroslav; Wein, Ondřej

2011-01-01

Roč. 6, č. 1 (2011), s. 273 ISSN 1931-7573 R&D Projects: GA ČR GA104/08/0428; GA ČR GA104/09/0972 Institutional research plan: CEZ:AV0Z40720504 Keywords : nanofluids * zeta potential * aws viscometry Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.726, year: 2011 http://www.nanoscalereslett.com/content/6/1/273

Spectral Variability in Hard X-rays and the Evidence for a 13.5 Years ...

Indian Academy of Sciences (India)

R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

fit in the X-ray and gamma ray energy bands points to a common origin of these photons and the ... relativistic jets in relation to BL Lac objects in general, and 3C273 in particular has ..... emission must also explain the long term period of ∼ 5000 days in 3C273 as discussed above. .... data available on public archives.

Electrically injected GaAsBi/GaAs single quantum well laser diodes

Directory of Open Access Journals (Sweden)

Juanjuan Liu

2017-11-01

Full Text Available We present electrically injected GaAs/GaAsBi single quantum well laser diodes (LDs emitting at a record long wavelength of 1141 nm at room temperature grown by molecular beam epitaxy. The LDs have excellent device performances with internal quantum efficiency of 86%, internal loss of 10 cm-1 and transparency current density of 196 A/cm2. The LDs can operate under continuous-wave mode up to 273 K. The characteristic temperature are extracted to be 125 K in the temperature range of 77∼150 K, and reduced to 90 K in the range of 150∼273 K. The temperature coefficient of 0.3 nm/K is extracted in the temperature range of 77∼273 K.

A Developmental Approach to Characterizing the Tissue-Invasion Gene Program in Breast Cancer

Science.gov (United States)

2001-09-01

OF PAGES Breast Cancer 24 16. PRICE CODE 17. SECURITY CLASSIFICATION 18. SECURITY CLASSIFICATION 19. SECURITY CLASSIFICATION 20. LIMITATION OF...induced host response. Am J. Pathol. 149:273-282, 1996. 4. Wolf, c., Rouyer, N., Lutz, Y., Adida , C., Loriot, M., Bellocq, J.P., Chambon, P., and Basset...following a 5 d incubation period. (upper left and right panels). In contrast, MT1-MMP-transfected cells perforated the BM in representative TEM and

Ways of Civil Society Institutes Interaction with Local Governments in the Sphere of Anti-Corruption

Directory of Open Access Journals (Sweden)

Kristina V. Кondrashova

2016-06-01

Full Text Available In this article author analyzes ways of civil society institutes interaction with local government bodies in the sphere of anti-corruption, legal regulation in the sphere of anti-corruption is analyzed (including the Federal law of December 25, 2008 No. 273-FZ "About anti-corruption", opinions of scientists-jurists are researched. In the conclusion the author reviews 4 examples mutually beneficial cooperation of institutes of civil society and local government bodies.

Fault Tolerance for Fight Through (FTFT)

Science.gov (United States)

2013-02-01

eventually to the lowest level. Now this information pyramid is being inverted: the lowest, most populated level is being “elevated” so that it is the... Egypt , December 2010, pp. 269-273. 8. Roger Myerson, Game Theory: Analysis of Conflict, Harvard University Press, 1997. 9. Li Wang, Zheng Li...Published by Springer, Delhi, India, May 2012, pp. 883-896. 27. “Inverting the Information Pyramid ,” Federal Computer Week, Vol. 26, No.4, March

HIV-infected adolescents have low adherence to antiretroviral therapy: a cross-sectional study in Addis Ababa, Ethiopia.

Science.gov (United States)

Firdu, Naod; Enquselassie, Fikre; Jerene, Degu

2017-01-01

For antiretroviral therapy (ART) to work effectively, adherence is very crucial. However, most studies done on ART adherence are either on children or on adults. There is limited information on the level of adherence among adolescents. Using a cross-sectional study design, we interviewed 273 HIV-infected adolescents receiving ART from three hospitals in Addis Ababa. We used a structured questionnaire to measure adherence levels using patient self-reports. Bivariate and multivariate methods were used for analysis. We interviewed 273 adolescents aged 13 to 19 years, and 144 (52.7%) of the participants were girls. Their mean age was 15.4 years (SD± 1.75). The self-reported adherence rate of the respondents was 79.1% (216/273). On bivariate analysis, variables like WHO clinical stage, being on Cotrimoxazole Prophylactic Therapy (CPT), marital and living status of the parent, whether parent was on ART or not and having special instructions for ART medications were associated with optimum adherence. However of those, only WHO stage IV (adjusted OR, 12.874 95% CI, 2.079-79.706), being on CPT (adjusted OR, 0.339 95% CI, 0.124-0.97) and adolescents with widowed parent (adjusted OR, 0.087 with 95% CI, 0.021-0.359) were found to be significantly associated with optimum ART adherence. The level of self-reported ART adherence among HIV-infected adolescents at the three hospitals was below the recommended threshold. Though earlier presentation of adolescents to care should be encouraged, more targeted adherence support should be planned for those who present at an early stage of their illness.

Prevalence of antibodies against measles, mumps, and rubella before and after vaccination of school-age children with three different triple combined viral vaccines, Rio Grande do Sul, Brazil, 1996 Prevalencia de anticuerpos contra sarampión, paperas y rubéola en niños en edad escolar antes y después de la vacunación con tres vacunas triples antivirales combinadas diferentes, Rio Grande do Sul, Brasil, 1996

Directory of Open Access Journals (Sweden)

Boaventura Antônio dos Santos

2006-11-01

Full Text Available OBJECTIVE: We evaluated the seroprevalence for measles, mumps, and rubella in school-age children (6-12 years old before and after the administration of three triple combined viral vaccines. METHODS: In two municipal schools of Rio Grande do Sul, Brazil, 692 blood samples were collected before vaccination and 636 samples 21 to 30 days after vaccination during 1996. IgG antibody seropositivity was investigated by enzyme-linked immunosorbent assay (measles and mumps with Enzygnost [Behring, Marburg, Germany]; rubella with Rubenostika [Organon Teknica, Boxtel, the Netherlands]. The vaccines compared were: A: E-Zagreb, L-Zagreb, and Wistar RA 27/3 (Tresivac; B: Moraten, J-Lynn, and Wistar RA 27/3 (M-M-R II; and C: Schwarz, Urabe AM-9, and Wistar RA 27/3 (Trimovax. RESULTS: Before vaccination, 79.2% [95% confidence interval (CI = 76.0%-82.2%] of the samples were positive for measles, 69.4% (95% CI = 65.8%-72.8% for mumps, and 55.4% (95% CI = 51.6%-59.2% for rubella. After vaccination with the A, B, and C vaccines, seropositivity was 100.0%, 99.5%, and 100.0%, respectively for measles; 99.5%, 94.5%, and 92.0% for mumps; and 92.6%, 91.3%, and 88.6% for rubella. CONCLUSIONS: About one-fifth (20.8% of the schoolchildren who could have been vaccinated against measles at age 9 months had levels of antibodies insufficient for protection. In the sample of schoolchildren without previous vaccination against mumps and rubella, high proportions of susceptible levels were found. All vaccines were immunogenic, but vaccine A yielded a seroconversion rate of 99.5% for the mumps component, which was significantly higher than the other two vaccines (P OBJETIVO: Se evaluó la seroprevalencia para sarampión, paperas y rubéola en niños en edad escolar (6-12 años antes y después de la administración de tres vacunas triples antivirales combinadas. MÉTODOS: Se colectaron 692 muestras de sangre antes de la vacunación y 636 muestras entre 21 y 30 días después de la

Self-association of caffeine in aqueous solution. Study of dilute solutions by normal and second derivative UV absorption spectroscopy.

Science.gov (United States)

Iza, N.; Gil, M.; Montero, J. L.; Morcillo, J.

1988-05-01

The concentration dependence of the spectral parameters of caffeine bands at ˜205 and 273 nm has been studied in aqueous solution by normal and second derivative spectroscopy. The concentration range was 5 x 10 -6 - 5 x 10 -3 M and thirty-five different concentrations were used. Discontinuities in parameter variation of these two bands at ˜7.5 x 10 -5, ˜2 x 10 -4, and ˜1 x 10 -3M were observed as concentration was increased. These "limiting" concentrations define three quite differenciated hyper- or hipochromic effects: the first one can be explained as caffeine-water molecule interaction and the second and third as dimer and (dimer + polymer) stacking, respectively. Apparent self-association constants using the isodesmic model have been obtained K= 160 M -1 (for the second hypochromic effect) and K= 13.6 M -1 (for the third hypochromic effect), for the 273 nm band. It is noteworthy that the three "limiting" concentrations coincide with changes in DNA-caffeine interaction modes (H. Lang , 1976) and biological activity (I.B. Syed , 1976).

Gas adsorption/separation properties of metal directed self-assembly of two coordination polymers with 5-nitroisophthalate

Energy Technology Data Exchange (ETDEWEB)

Arıcı, Mürsel [Department of Chemistry, Faculty of Arts and Sciences, Eskişehir Osmangazi University, 26480 Eskişehir (Turkey); Yeşilel, Okan Zafer, E-mail: yesilel@ogu.edu.tr [Department of Chemistry, Faculty of Arts and Sciences, Eskişehir Osmangazi University, 26480 Eskişehir (Turkey); Keskin, Seda [Department of Chemical and Biological Engineering, Koç University, İstanbul (Turkey); Şahin, Onur [Scientific and Technological Research Application and Research Center, Sinop University, 57010 Sinop (Turkey)

2014-02-15

Two new coordination polymers, namely, [Co(µ-nip)(µ-bpe)]{sub n} (1) and [Zn(µ-nip)(µ-bpe)]{sub n} (2) (nip: 5-nitroisophthalate, bpe: 1,2-bis(4-pyridyl)ethane) were hydrothermally synthesized and structurally characterized by single crystal X-ray diffraction, IR spectroscopy, elemental analysis and thermal analysis. Moreover, atomically detailed simulation studies of complex 2 for CO{sub 2}/CH{sub 4} adsorption and separation were performed. Complex 1 consists of two dimensional (2D) (4,4) grid networks with the point symbol of 4{sup 4}.6{sup 2}. Complex 2 exhibits a 3-fold interpenetrating 3D framework with 6{sup 5}.8-dmp topology. Thermal properties of the complexes showed that both complexes were stable over 320 °C. Simulation studies demonstrated that complex 2 can separate CO{sub 2} from CH{sub 4} at low pressures at 273 K. - Graphical abstract: In this study, two new coordination polymers, namely, [Co(µ-nip)(µ-bpe)]{sub n} (1) and [Zn(µ-nip)(µ-bpe)]{sub n} (2) (nip: 5-nitroisophthalate, bpe: 1,2-bis(4-pyridyl)ethane) were hydrothermally synthesized and structurally characterized by single crystal X-ray diffraction, IR spectroscopy, elemental analysis and thermal analysis. Moreover, atomically detailed simulation studies of complex 2 for CO{sub 2}/CH{sub 4} adsorption and separation were performed. Complex 1 consists of two dimensional (2D) (4,4) grid networks with the point symbol of 4{sup 4}.6{sup 2}. Complex 2 exhibits a 3-fold interpenetrating 3D framework with 6{sup 5}.8-dmp topology. Simulation studies demonstrated that complex 2 can separate CO{sub 2} from CH{sub 4} at low pressures at 273 K. Display Omitted - Highlights: • Two new coordination polymers with 5-nitroisophthalate and 1,2-bis(4-pyridyl)ethane. • Atomically detailed simulation studies of the complexes. • Complex 2 can be proposed as molecular sieve to separate CO{sub 2} from CH{sub 4} at low pressures.

Antifungal Activity of Aqueous Extracts from Ferula Assa foetida Aerial parts on Candida Albicans and its Comparison with Fluconazole in vitro

Directory of Open Access Journals (Sweden)

AA Jafari

2014-09-01

Results:Concentrations of 8.75 mg/ml aerial parts of Ferula assafoetida completely inhibited the growth of Candida albicans and killed all viable cells (MFC. Concentrations of 0.273 and 4.4 mg/ml Ferula aqueous extracts were also determined as MIC50 and MIC90. In case of Fluconazole, 128 µg/ml concentrationis determined as MFC and 0.5 µg/ml concentration is also known as MIC50. Conclusion:Results of the current study showed that the aqueous extract of Ferula assafoetida aerial parts has inhibitory and candidacidal effect against Candida albicans and further in vivo studies are suggested.

Signos Vitales-Prevención de embarazos en adolescentes (Preventing Teen Pregnancy)

Centers for Disease Control (CDC) Podcasts

2015-04-07

Este podcast se basa en la edición de abril del 2015 del informe Signos Vitales de los CDC. En los Estados Unidos ha descendido la tasa de nacimientos en adolescentes, sin embargo, en el 2013 nacieron más de 273 000 bebés de madres adolescentes de entre 15 y 19 años. Infórmese sobre los tipos de anticonceptivos más eficaces.  Created: 4/7/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 4/7/2015.

4 CFR 22.4 - Appeal File [Rule 4].

Science.gov (United States)

2010-01-01

... alternative organization of the appeal file is permitted, such as by document type or topic, documents within... 4 Accounts 1 2010-01-01 2010-01-01 false Appeal File [Rule 4]. 22.4 Section 22.4 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.4 Appeal File [Rule 4]. (a) Duties of the Contracting Officer. (1...

Crystal structure of 4-RbHo(PO3)4, 4-RbTm(PO3)4 and 4-CsEr(PO3)4

International Nuclear Information System (INIS)

Maksimova, S.I.; Palkina, K.K.; Chibiskova, N.T.

1982-01-01

X-ray structural study of 4-RbLn(PO 3 ) 4 (Ln=Mo, Tm) and 4-CsEr(PO 3 ) 4 is carried out. The compounds are crystallized in monoclinic crystal system, sp. gr P2 1 /n. Parameters of their unit cell, atom coordinates, anisotropic heat parameters, interatomic distances and valent angles are given. 4-RbHo(PO 3 ) 4 , 4-RbTm(PO 3 ) 4 , 4-CsEr(PO 3 ) 4 are isostructural to previously studied TlNd(PO 3 ) and 4-RbNd(PO 3 ) 4 . Using as an example the structural type 4-M 1 Ln(PO 3 ) 4 it is shown that the change of the shortest distances Ln-Ln, M 1 -M 1 and M 1 -Ln, as well as of degree of polymorphous chain corrugation to a higher extent depends on rare earth atom dimensions, than on monovalent metal ion dimensions [ru

Transforming Reserve Officers’ Training Corps for Tomorrow’s Officer

Science.gov (United States)

2013-03-01

at more than 273 colleges and universities across the United States, to include the District of Columbia and Puerto Rico.4 In 2012, more than 41% of... uneducated to understand.16 His model looks at how to apply different leadership styles as a persuasive technique rather than the directed approach the...applies to the average ROTC cadet. Although the cadet’s exposure to a coach, teacher , or boss may have generated an admiration that inspired them in

The Role of Tumor Metastases Suppressor Gene, Drg-1, in Breast Cancer

Science.gov (United States)

2008-03-01

evidence to validate 14 our data of breast cancer. However, these prostate cells and reagents were existing materials in our lab or purchased by using...J. Lab . Clin. Med. 133, 265–273. Sloane, B.F., Honn, K.V., 1984. Cysteine proteinases and metastasis. Cancer Metastasis Rev. 3, 249–263. Sridhar, S.C... Beest , P. Moerer, K. van der Horn, R. Goldschmeding, T. Logtenberg and H. Clevers: Synergy between tumor suppressor APC and the beta- catenin-Tcf4

Air-to-Ground Gunnery: A-77, A-78, A-79, and B-7 Final Programmatic Environmental Assessment

Science.gov (United States)

2004-07-01

Lead µg/L (1.273(in hardness) – 4. 705) Zinc µg/L (0.8473(in hardness) + 0.7614) Mercury µg/L ≤0.012 Source: FDEP, 2000 3.3.3 Climate and...mm of mercury ; ppm refers to parts per million by volume. 3. National Primary Standards: The levels of air quality necessary, with an adequate...Assessment Eglin Air Force Base, Florida Phytoremediation serves as an ecologically sound remediation tool for explosives-contaminated soil and

A simple method for labelling proteins with 211At via diazotized aromatic diamine

International Nuclear Information System (INIS)

Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

1987-01-01

A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

Pollutant Concentrations in the Rime and Fog Water at the Milesovka Observatory

Czech Academy of Sciences Publication Activity Database

Fišák, Jaroslav; Tesař, Miroslav; Fottová, D.

2009-01-01

Roč. 196, 1-4 (2009), s. 273-285 ISSN 0049-6979 R&D Projects: GA AV ČR IAA3042301; GA AV ČR 1QS200420562 Institutional research plan: CEZ:AV0Z30420517; CEZ:AV0Z20600510 Keywords : Deposited precipitation * Fog collection * Fog water * Milesovka observatory * Rime water Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.676, year: 2009 http://springerlink.metapress.com/content/18q3lr7681736qp2/fulltext.pdf

Department of Defense Environmental Policy in Afghanistan During Operation Enduring Freedom

Science.gov (United States)

2008-08-31

human waste, and hazardous waste. 175 OPLANs should also address flora and fauna protection, archaeological and historical preservation, and a base...Article 18 of The Vienna Convention on the Law of Treaties, May 23, 1969, 1155 U.N.T.S. 331; Phelps, supra note 86, at 72-73; Takako Morita, N.LM.B. Y ...one nation. 272 See id at para. 4.b(1) [hereinafter CENTCOM Regulation]. 273 The CENTCOM AOR includes eastern Africa , the Middle East, and Central

Advances in data reduction of high-pressure x-ray powder diffraction data from two-dimensional detectors: a case study of schafarzikite (FeSb{sub 2}O{sub 4})

Energy Technology Data Exchange (ETDEWEB)

Hinrichsen, B [Max-Planck-Institute for Solid State Research, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Dinnebier, R E [Max-Planck-Institute for Solid State Research, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Rajiv, P [Max-Planck-Institute for Solid State Research, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Hanfland, M [European Synchrotron Radiation Facility, 6 rue Jules Horowitz, BP220, 38043 Grenoble Cedex (France); Grzechnik, A [Departamento de Fisica de la Materia Condensada, Facultad de Ciencia y Technologia, Universidad del Pais Vasco, Apartado 644, E-48080 Bilbao (Spain); Jansen, M [Max-Planck-Institute for Solid State Research, Heisenbergstrasse 1, D-70569 Stuttgart (Germany)

2006-06-28

Methods have been developed to facilitate the data analysis of multiple two-dimensional powder diffraction images. These include, among others, automatic detection and calibration of Debye-Scherrer ellipses using pattern recognition techniques, and signal filtering employing established statistical procedures like fractile statistics. All algorithms are implemented in the freely available program package Powder3D developed for the evaluation and graphical presentation of large powder diffraction data sets. As a case study, we report the pressure dependence of the crystal structure of iron antimony oxide FeSb{sub 2}O{sub 4} (p{<=}21 GPa, T = 298 K) using high-resolution angle dispersive x-ray powder diffraction. FeSb{sub 2}O{sub 4} shows two phase transitions in the measured pressure range. The crystal structures of all modifications consist of frameworks of Fe{sup 2+}O{sub 6} octahedra and irregular Sb{sup 3+}O{sub 4} polyhedra. At ambient conditions, FeSb{sub 2}O{sub 4} crystallizes in space group P4{sub 2}/mbc (phase I). Between p = 3.2 GPa and 4.1 GPa it exhibits a displacive second order phase transition to a structure of space group P 2{sub 1}/c (phase II, a = 5.7792(4) A, b = 8.3134(9) A, c = 8.4545(11) A, {beta} = 91.879(10){sup 0}, at p = 4.2 GPa). A second phase transition occurs between p = 6.4 GPa and 7.4 GPa to a structure of space group P4{sub 2}/m (phase III, a = 7.8498(4) A, c = 5.7452(5) A, at p = 10.5 GPa). A nonlinear compression behaviour over the entire pressure range is observed, which can be described by three Vinet equations in the ranges from p = 0.52 GPa to p 3.12 GPa, p = 4.2 GPa to p = 6.3 GPa and from p = 7.5 GPa to p = 19.8 GPa. The extrapolated bulk moduli of the high-pressure phases were determined to K{sub 0} = 49(2) GPa for phase I, K{sub 0} = 27(3) GPa for phase II and K{sub 0} = 45(2) GPa for phase III. The crystal structures of all phases are refined against x-ray powder data measured at several pressures between p = 0.52 GPa

4,4′-Bipyridinium bis(perchlorate–4-aminobenzoic acid–4,4′-bipyridine–water (1/4/2/2

Directory of Open Access Journals (Sweden)

Qun-Hui Meng

2009-01-01

Full Text Available In the structure of the title compound, C10H10N22+·2ClO4−·4C7H7NO2·2C10H8N2·2H2O, the 4,4′-bipyridinium cation has a crystallographically imposed centre of symmetry. The cation is linked by N—H...N hydrogen bonds to adjacent 4,4′-bipyridine molecules, which in turn interact via O—H...N hydrogen bonds with 4-aminobenzoic acid molecules, forming chains running parallel to [30overline{2}]. The chains are further connected into a three-dimensional network by N—H...O and O—H...O hydrogen-bonding interactions involving the perchlorate anion, the water molecules and the 4-aminobenzoic acid molecules. In addition, π–π stacking interactions with centroid–centroid distances ranging from 3.663 (6 to 3.695 (6 Å are present. The O atoms of the perchlorate anion are disordered over two sets of positions, with refined site occupancies of 0.724 (9 and 0.276 (9.

Synthesis of symmetrical 2,2',4,4'-tetrasubstituted [4,4'-bithiazole]-5,5'(4H,4'H)-diones and their reactions with some nucleophiles

DEFF Research Database (Denmark)

Andersen, Kenneth K.; Bray, Diana D.; Kjær, Anders

1997-01-01

steric factors. X-Ray crystallography established the structure of the dehydrodimer (4R*,4R'*)-2,2'-diethoxy-4,4'-dibenzyl-[4,4'-bithiazole]-5,5'(4H,4 'H)-dione. One stereoisomer of 2,2'-diphenyl-4,4'-dimethyl-[4,4'-bithiazole]-5,5'(4H,4'H)-dione and a mixture of the stereoisomers 2,2'-diphenyl-4......-carboxylic acid and piperidylamide, was established by X-ray crystallography. Treatment of stereoisomeric mixtures of 2,2'-diethoxy-4,4'-bithiazolones with HCl in benzene gave the corresponding racemic and meso bis-(N-carboxythioanhydride)s. A stereoisomeric mixture of the bis...

Mercury removal from natural gas and associated condensates

Energy Technology Data Exchange (ETDEWEB)

Hennico, A.; Barthel, Y.; Courty, P. (Institut Francais du Petrole, 31 - Rueil-Malmaison (France). Direction Industrielle)

1990-01-01

IFP mercury trapping systems are based on CMG 273, the recently developed Procatalyse product which is the heart of IFP's gas phase and liquid phase mercury removal technology. This material, made of highly macroporous alumina supporting a metal sulfide, presents a very high reactivity towards mecury within a broad range of operating conditions, including those operating in the liquid phase. Characteristics of CMG 273 are presented. (orig.).

Human Rights and Internal Security in Malaysia: Rhetoric and Reality

Science.gov (United States)

2006-03-01

government is to integrate the population. According to Lauder and Mansor, population integration is seen as a sine qua non for nation building.273 Also, as...273 Kathleen Lauder and Norma Mansor, “Effective States and Engaged Societies: Capacity Development for Growth, Source Delivery...There are several reasons. People are not willing to lose what they have (property, money and good employment, for example). They are not willing

40 CFR 264.273 - Design and operating requirements.

Science.gov (United States)

2010-07-01

... the facility permit how the owner or operator will design, construct, operate, and maintain the land..., construct, operate, and maintain the treatment zone to minimize run-off of hazardous constituents during the... maintain a run-on control system capable of preventing flow onto the treatment zone during peak discharge...

77 FR 273 - Combined Notice of Filings #1

Science.gov (United States)

2012-01-04

... Numbers: QF12-120-000. Applicants: The Coca-Cola Company. Description: Form 556--Notice of self-certification of qualifying cogeneration facility status of The Coca-Cola Company. Filed Date: 12/21/2011...

31 CFR 27.3 - Assessment of civil penalties.

Science.gov (United States)

2010-07-01

..., Tobacco and Firearms,” “Bureau of the Public Debt,” “Bureau of Engraving and Printing,” “Comptroller of the Currency,” “Federal Law Enforcement Training Center,” “Financial Crimes Enforcement Network... Engraving and Printing,” “Comptroller of the Currency,” “Director of the Federal Law Enforcement Training...

47 CFR 27.3 - Other applicable rule parts.

Science.gov (United States)

2010-10-01

... standards and procedures concerning the marketing and importation of radio frequency devices, and for.... This part sets forth the requirements and conditions applicable to commercial mobile radio service providers. (h) Part 22. This part sets forth the requirements and conditions applicable to public mobile...

Translations on Narcotics and Dangerous Drug No. 273

Science.gov (United States)

1976-11-26

address Farahnaz Avenue, Mehrabad, age 25; Naser Aarakhani, butcher , age 2k; Mansur Sa’adatbakhsh; Da’ud Amini, age l8; Hoseyn Dastani...a police uniform was not to show off. Also arrested were: Hassan Nezam ’Ali, age 30, a poultry dealer living in Sarcheshmeh, with 3

Programming MIL-101Cr for selective and enhanced CO2 adsorption at low pressure by postsynthetic amine functionalization.

Science.gov (United States)

Khutia, Anupam; Janiak, Christoph

2014-01-21

MIL-101Cr fully or partially (p) postsynthetically modified with nitro (-NO2) or amino (-NH2) groups was shown to be a robust, water stable, selective and enhanced carbon dioxide (CO2) adsorption material with the amine-functionality. The highly microporous amine-modified frameworks (up to 1.6 cm(3) g(-1) total pore volume) exhibit excellent thermal stability (>300 °C) with BET surface areas up to 2680 m(2) g(-1). At 1 bar (at 273 K) the gases CO2, CH4 and N2 are adsorbed up to 22.2 wt%, 1.67 wt% and 2.27 wt%, respectively. The two amine-modified MIL-101Cr-NH2 (4) and MIL-101Cr-pNH2 (5) showed the highest gas uptake capacities in the series with high ratios for the CO2 : N2 and CO2 : CH4 selectivities (up to 119 : 1 and 75 : 1, respectively, at 273 K). Comparison with non-modified MIL-101Cr traces the favorable CO2 adsorption properties of MIL-101Cr-NH2 (4) and MIL-101Cr-pNH2 (5) to the presence of the Lewis-basic amine groups. MIL-101Cr-NH2 (4) has a high isosteric heat of adsorption of 43 kJ mol(-1) at zero surface coverage and also >23 kJ mol(-1) over the entire adsorption range, which is well above the heat of liquefaction of bulk CO2. Large CO2 uptake capacities of amine-functionalized 4 and 5, coupled with high adsorption enthalpy, high selectivities and proven long-term water stability, make them suitable candidates for capturing CO2 at low pressure from gas mixtures including the use as a CO2 sorbent from moist air.

A kinetic study of the formation of organic solids from formaldehyde: Implications for the origin of extraterrestrial organic solids in primitive Solar System objects

Science.gov (United States)

Kebukawa, Yoko; Cody, George D.

2015-03-01

Aqueous organic solid formation from formaldehyde via the formose reaction and subsequent reactions is a possible candidate for the origin of complex primitive chondritic insoluble organic matter (IOM) and refractory carbon in comets. The rate of formation of organic solids from formaldehyde was studied as a function of temperature and time, with and without ammonia, in order to derive kinetic expressions for polymer yield. The evolution in molecular structure as a function of time and temperature was studied using infrared spectroscopy. Using these kinetic expressions, the yield of organic solids is estimated for extended time and temperature ranges. For example, the half-life for organic solid formation is ∼5 days at 373 K, ∼200 days at 323 K, and ∼70 years at 273 K with ammonia, and ∼25 days at 373 K, ∼13 years at 323 K, and ∼2 × 104 years at 273 K without ammonia. These results indicate that organic solids could form during the aqueous alteration in meteorite parent bodies. If liquid water existed early in the interiors of Kuiper belt objects (KBOs), formaldehyde could convert into organic solids at temperatures close to 273 K, and possibly even below 273 K in the ammonia-water system.

Predictive Value of Triglyceride Glucose Index for the Risk of Incident Diabetes: A 4-Year Retrospective Longitudinal Study.

Science.gov (United States)

Lee, Da Young; Lee, Eun Seo; Kim, Ji Hyun; Park, Se Eun; Park, Cheol-Young; Oh, Ki-Won; Park, Sung-Woo; Rhee, Eun-Jung; Lee, Won-Young

The Triglyceride Glucose Index (TyG index) is considered a surrogate marker of insulin resistance. The aim of this study is to investigate whether the TyG index has a predictive role in identifying individuals with a high risk of incident diabetes and to compare it with other indicators of metabolic health. A total 2900 non-diabetic adults who attended five consecutive annual health check-ups at Kangbuk Samsung Hospital was divided into four subgroups using three methods: (1) baseline TyG index; (2) obesity status (body mass index ≥25 kg/m2) and cutoff value of TyG index; (3) obesity status and metabolic health, defined as having fewer than two of the five components of high blood pressure, fasting blood glucose, triglyceride, low high-density lipoprotein cholesterol, and highest decile of homeostasis model assessment-insulin resistance. The development of diabetes was assessed annually using self-questionnaire, fasting glucose, and glycated hemoglobin. We compared the risk of incident diabetes using multivariate Cox analysis. During 11623 person-years there were 101 case of incident diabetes. Subjects with high TyG index had a high risk of diabetes. For TyG index quartiles, hazard ratios (HRs) of quartiles 3 and 4 were 4.06 (p = 0.033) and 5.65 (p = 0.006) respectively. When the subjects were divided by obesity status and cutoff value of TyG index of 8.8, the subgroups with TyG index ≥ 8.8 regardless of obesity had a significantly high risk for diabetes (HR 2.40 [p = 0.024] and 2.25 [p = 0.048]). For obesity status and metabolic health, the two metabolically unhealthy subgroups regardless of obesity had a significantly high risk for diabetes (HRs 2.54 [p = 0.024] and 2.73 [p = 0.021]). In conclusion, the TyG index measured at a single time point may be an indicator of the risk for incident diabetes. The predictive value of the TyG index was comparable to that of metabolic health.

Effects of the inclusion of a mixed Psychrotrophic bacteria strain for sewage treatment in constructed wetland in winter seasons.

Science.gov (United States)

Tang, Meizhen; Li, Zhengtao; Yang, Yuewei; Chen, Junfeng; Jiang, Jie

2018-04-01

Constructed wetlands (CWs) have been used globally in wastewater treatment for years. CWs represent an efficient ecological system which is both energy-saving and low in investment for construction and operational cost. In addition, CWs also have the advantage of being easy to operate and maintain. However, the operation of CWs at northern latitudes (both mid and high) is sometimes quite demanding, due to the inhibitory effect of low temperatures that often occur in winter. To evaluate the wastewater treatment performance of a culture of mixed Psychrotrophic bacteria strains in an integrated vertical-flow CW, the removal rates of ammonia nitrogen (NH 3 -N), chemical oxygen demand (COD), nitrite nitrogen [Formula: see text], nitrate nitrogen [Formula: see text] and total phosphorus (TP) were quantified at different bacterial dosages to determine the best bacterial dosage and establish kinetic degradation models of the mixed strains. The bacterial culture was made up of Psychrobacter TM-1, Sphingobacterium TM-2 and Pseudomonas TM-3, mixed together at a volume/volume ratio of 1 : 1 : 1 (at bacterial suspension concentrations of 4.4 × 10 9  ml -1 ). Results showed that the organic pollutants (nitrogen and phosphorus) in the sewage could be efficiently removed by the culture of mixed Psychrotrophic bacteria. The optimal dosage of this mixed bacteria strain was 2.5%, and the treatment efficiency of COD, NH 3 -N, [Formula: see text], [Formula: see text], total nitrogen and TP were stable at 91.8%, 91.1%, 88.0%, 93.8%, 94.8% and 95.2%, respectively, which were 1.5, 2.0, 2.1, 1.5, 2.2 and 1.3 times those of the control group. In addition, a pseudo-first-order degradation model was a good fit for the degradation pattern observed for each of these pollutants.

Risk and Resilience Factors for Combat-Related Posttraumatic Psychopathology and Post Combat Adjustment

Science.gov (United States)

2011-06-01

E2 E3 E4 E5 E6 E7 E8 1 5 6 4 6 0 1 JFHQs 37th 16th 174th 73d 371st 1 5 8 4 2 3 Age of Soldier Suicides Ave Age = 30.56 Years Grade of Soldier...vulnerability (i.e. gene x environment interactions). This will also allow for integrated research utilizing neuroimaging, psychophysiological, and...and Non‐Veterans. International Journal of Social Psychiatry  1980; 27(3): 204‐212.  24.  Kuh D, Ben‐Shlomo  Y , Lynch J, Hallqvist J, and Power C. Life

Characterization of multiple antibiotic resistance of culturable microorganisms and metagenomic analysis of total microbial diversity of marine fish sold in retail shops in Mumbai, India.

Science.gov (United States)

Naik, Onkar A; Shashidhar, Ravindranath; Rath, Devashish; Bandekar, Jayant R; Rath, Archana

2018-03-01

Marine fish species were analyzed for culturable and total metagenomic microbial diversity, antibiotic resistance (AR) pattern, and horizontal gene transfer in culturable microorganisms. We observed a high AR microbial load of 3 to 4 log CFU g -1 . Many fish pathogens like Providencia, Staphylococcus, Klebsiella pneumoniae, Enterobacter, Vagococcus, and Aeromonas veronii were isolated. Photobacterium and Vibrio were two major fish and human pathogens which were identified in the fish metagenome. Other pathogens that were identified were Shewanella, Acinetobacter, Psychrobacter, and Flavobacterium. Most of these pathogens were resistant to multiple antibiotics such as erythromycin, kanamycin, neomycin, streptomycin, penicillin, cefotaxime, bacitracin, rifampicin, trimethoprim, ciprofloxacin, and doxycycline with a high multiple antibiotic resistance index of 0.54-0.77. The fish microflora showed high prevalence of AR genes like bla TEM , Class I integron, tetA, aph(3')-IIIa, ermB, aadA, and sul1. Nineteen of 26 AR isolates harbored Class I integrons showing high co-resistance to trimethoprim, kanamycin, doxycycline, and cefotaxime. Mobile R-plasmids from 6 of the 12 AR pathogens were transferred to recipient E. coli after conjugation. The transconjugants harbored the same R-plasmid carrying bla CTX-M , dfr1, tetA, bla TEM , and cat genes. This study confirms that fish is a potential carrier of AR pathogens which can enter the human gut via food chain. To the best of our knowledge, this is the first study in the Indian subcontinent reporting a direct evidence of spread of AR pathogens to humans from specific marine fish consumption.

Crystal structures of Er4Ni13C4 and UW4C4

International Nuclear Information System (INIS)

Khalili, M.M.; Bodak, O.I.; Marusin, E.P.; Pecharskaya, A.O.

1990-01-01

Crystal structures of Er 4 Ni 13 C 4 (1) (sp.gr. Cmmm, a=1.1975(4), b=1.1694(3), c=0.3856(1) nm, Z=2) and UW 4 C 4 (2) (sp.gr. P4/m, a=0.8328(8), c=0.31345(9) nm, Z=2), relating to new types are determined. Structural type (1) is a derivative of La 2 Ni 5 C 3 structure, structural type (2) is close to UCr 4 C 4 structure

Common clay and shale

Science.gov (United States)

Virta, R.L.

2000-01-01

Part of the 1999 Industrial Minerals Review. The clay and shale market in 1999 is reviewed. In the U.S., sales or use of clay and shale increased from 26.4 million st in 1998 to 27.3 million st in 1999, with an estimated 1999 value of production of $143 million. These materials were used to produce structural clay products, lightweight aggregates, cement, and ceramics and refractories. Production statistics for clays and shales and for their uses in 1999 are presented.

Comparison of thallium scintiscanning of heart and coronarography in ischemic heart disease patients

International Nuclear Information System (INIS)

Duska, F.; Kvasnicka, J.; Kubicek, J.; Vizda, J.; Kafka, P.; Bartak, K.; Mazurova, Y.; Palicka, V.

1986-01-01

In 22 patients with the preliminary diagnosis of ischemic heart disease, coronarography and thallium scintigraphy of the heart muscle were performed. In seven patients (31.8%) the two methods were in agreement, partial agreement was recorded in nine instances (40.9%) and disagreement in six patients (27.3%). When only one artery was affected the results were better (agreement in 71.4%). From the aspect of practical application it is thus obvious that our scintigraphic technique cannot replace coronarography, not even partly. (author)

Regulation of MDM2 Activity by Nucleolin

Science.gov (United States)

2007-06-01

plicated in the binding of HIV particles to CD4 cells. J. Biol. Chem. 273:21988–21997. 8. Carty, M. P., M. Zernik -Kobak, S. McGrath, and K. Dixon. 1994...replication products and not due to repair synthesis (Fig. 3D ). RPARPA2D is therefore functionally active in supporting DNA replication in vitro...Further intermediate RPA2 mutants were designed to roughly follow the phosphor- ylation pathway, as suggested by the data of Zernik -Kobak and colleagues

Kinetics of lactate and pyruvate transport in cultured rat myotubes

DEFF Research Database (Denmark)

von Grumbckow, Lena; Elsner, Peter; Hellsten, Ylva

1999-01-01

, respectively. Furthermore, it was observed that the two monocarboxylate transporter isoforms present in mature skeletal muscles, MCT1 and MCT4 (formerly called MCT3 (M.C. Wilson, V.N. Jackson, C. Heddle, N.T. Price, H. Pilegaard, C. Juel, A. Bonen, I. Montgomery, O.F. Hutter, A.P. Halestrap, Lactic acid efflux...... from white skeletal muscle is catalyzed by the monocarboxylate transporter isoform MCT3, J. Biol. Chem. 273 (1998) 15920-15926)), were also expressed in primary culture of myotubes....

Distribution of corazonin and pigment-dispersing factor in the cephalic ganglia of termites

Czech Academy of Sciences Publication Activity Database

Závodská, Radka; Wen, C.-J.; Hrdý, Ivan; Šauman, Ivo; Lee, H.-J.; Sehnal, František

2008-01-01

Roč. 37, č. 4 (2008), s. 273-286 ISSN 1467-8039 R&D Projects: GA MŠk LC07032 Grant - others:National Taiwan University(TW) NSC 92-2313-B-002-069; National Taiwan University(TW) NSC 93-2313-B-002-045; National Taiwan University(TW) NSC 2313-B-002-015 Institutional research plan: CEZ:AV0Z50070508; CEZ:AV0Z40550506 Keywords : brain * insect nervous system * neuropeptides Subject RIV: CE - Biochemistry Impact factor: 1.200, year: 2008

Towards a Theoretical Basis for Energy Economics.

Science.gov (United States)

1980-08-01

8217- scale scal.e Absolute zero -273: Freezing point of L7 727 water Body temperature 7?; .’ Boiling point of 3 water Melti4ng point of 352.: iron Surf...the view that the word "exergy" should be limited in usage to the function ,’- . Berg Lop cit] uses the term "thermodynamic availabilit ,wh Ahearn [1...generatcr .60 Fuel cells .90 Radiation cell .10 Domestic space heating (electrical) .03 Domestic space heating (gas, oil) .07 Water electically heated

Synthesis of N-(5-(Substitutedphenyl-4,5-dihydro-1H-pyrazol-3-yl-4H-1,2,4-triazol-4-amine from 4-Amino-4H-1,2,4-triazole

Directory of Open Access Journals (Sweden)

Ashvin D. Panchal

2011-01-01

Full Text Available N-(4H-1,2,4-Triazol-4-ylacetamide (2 were prepared by reaction of 4-amino-4H-1,2,4-triazole (1 with acetyl chloride in dry benzene. It has been reacted with various aromatic aldehyde to afford 3-(substitutedphenyl-N-(4H-1,2,4-triazol-4-ylacrylamide (3a-e. The synthesis of N-(5-substitutedphenyl-4,5-dihydro-1H-pyrazol-3-yl-4H-1,2,4-triazol-4-amine (4a-e is achieved by the cyclisation of 3a-e with hydrazine hydrate in ethanol. The structures of synthesized compounds were characterized by 1H NMR and IR spectroscopic studies. The purity of the compounds was checked by thin layer chromatography.

Tic disorder in children aged 4-16 years in Laiyang:a cross-sectional study%莱阳市城乡4～16岁儿童抽动障碍现状调查

Institute of Scientific and Technical Information of China (English)

冷丽梅; 衣明纪; 张柱海

2012-01-01

目的 调查莱阳市城乡(城区、农村)4～16岁儿童抽动障碍(tic disorders,TD)的流行病学特征、家庭环境以及伴发的行为问题,为TD的科学干预创造条件.方法 2010年4-10月采用分层整群随机抽样的方法,从莱阳市城区和农村68 396名4～16岁儿童中抽取1 752名进行TD横断面调查.采用问卷调查和专科访谈相结合的方式,回收有效问卷1 588份.TD患儿作为TD组,相应条件的无TD儿童作为对照组.结果 4～16岁儿童TD总患病率1.70％,短暂性抽动障碍(transient tic disorders,TTD)患病率0.94％、慢性抽动障碍(chronic tic disorders,CTD)患病率0.57％、多发性抽动症(tourette syndrome,TS)患病率0.19％.男生患病率2.43％,女生患病率0.99％,差异有统计学意义(P＜0.05).平均发病年龄为(7.52±2.73)岁.TD组患儿家庭环境中的亲密度、知识性、道德宗教观评分与对照组比较差异有统计学意义(P＜0.05).6～11岁TD组男性患儿抑郁、交往不良、强迫性、社交退缩、多动、攻击性、违纪评分以及总分高于同年龄、同性别对照组,差异均有统计学意义(均P＜ 0.05)；6～11岁TD组女性患儿抑郁、社交退缩、多动、攻击性评分以及总分高于同年龄、同性别对照组,差异均有统计学意义(均P＜ 0.05).结论 TD在莱阳市城乡儿童中并不少见,男性患病率较女性高.TD患儿家庭环境较差,且伴有较多行为问题.

SU-E-J-273: Skin Temperature Recovery Rate as a Potential Predictor for Radiation-Induced Skin Reactions

Energy Technology Data Exchange (ETDEWEB)

Biswal, N C; Wu, Z; Chu, J [Rush University Medical Center, Chicago, IL (United States); Sun, J [Argonne National Laboratory, Lemont, IL (United States)

2015-06-15

Purpose: To assess the potential of dynamic infrared imaging to evaluate early skin reactions during radiation therapy in cancer patients. Methods: Thermal images were captured by our home-built system consisting of two flash lamps and an infrared (IR) camera. The surface temperature of the skin was first raised by ∼ 6 °C from ∼1 ms short flashes; the camera then captured a series of IR images for 10 seconds. For each image series, a basal temperature was recorded for 0.5 seconds before flash was triggered. The temperature gradients (ε) were calculated between a reference point (immediately after the flash) and at a time point of 2sec, 4sec and 9sec after that. A 1.0 cm region of interest (ROI) on the skin was drawn; the mean and standard deviations of the ROIs were calculated. The standard ε values for normal human skins were evaluated by imaging 3 healthy subjects with different skin colors. All of them were imaged on 3 separate days for consistency checks. Results: The temperature gradient, which is the temperature recovery rate, depends on the thermal properties of underlying tissue, i.e. thermal conductivity. The average ε for three volunteers averaged over 3 measurements were 0.64±0.1, 0.72±0.2 and 0.80±0.3 at 2sec, 4sec and 9sec respectively. The standard deviations were within 1.5%–3.2%. One of the volunteers had a prior small skin burn on the left wrist and the ε values for the burned site were around 9% (at 4sec) and 13% (at 9sec) lower than that from the nearby normal skin. Conclusion: The temperature gradients from the healthy subjects were reproducible within 1.5%–3.2 % and that from a burned skin showed a significant difference (9%–13%) from the normal skin. We have an IRB approved protocol to image head and neck patients scheduled for radiation therapy.

SU-E-J-273: Skin Temperature Recovery Rate as a Potential Predictor for Radiation-Induced Skin Reactions

International Nuclear Information System (INIS)

Biswal, N C; Wu, Z; Chu, J; Sun, J

2015-01-01

Purpose: To assess the potential of dynamic infrared imaging to evaluate early skin reactions during radiation therapy in cancer patients. Methods: Thermal images were captured by our home-built system consisting of two flash lamps and an infrared (IR) camera. The surface temperature of the skin was first raised by ∼ 6 °C from ∼1 ms short flashes; the camera then captured a series of IR images for 10 seconds. For each image series, a basal temperature was recorded for 0.5 seconds before flash was triggered. The temperature gradients (ε) were calculated between a reference point (immediately after the flash) and at a time point of 2sec, 4sec and 9sec after that. A 1.0 cm region of interest (ROI) on the skin was drawn; the mean and standard deviations of the ROIs were calculated. The standard ε values for normal human skins were evaluated by imaging 3 healthy subjects with different skin colors. All of them were imaged on 3 separate days for consistency checks. Results: The temperature gradient, which is the temperature recovery rate, depends on the thermal properties of underlying tissue, i.e. thermal conductivity. The average ε for three volunteers averaged over 3 measurements were 0.64±0.1, 0.72±0.2 and 0.80±0.3 at 2sec, 4sec and 9sec respectively. The standard deviations were within 1.5%–3.2%. One of the volunteers had a prior small skin burn on the left wrist and the ε values for the burned site were around 9% (at 4sec) and 13% (at 9sec) lower than that from the nearby normal skin. Conclusion: The temperature gradients from the healthy subjects were reproducible within 1.5%–3.2 % and that from a burned skin showed a significant difference (9%–13%) from the normal skin. We have an IRB approved protocol to image head and neck patients scheduled for radiation therapy

Heart retransplantation: a 23-year single-center clinical experience.

Science.gov (United States)

Schnetzler, B; Pavie, A; Dorent, R; Camproux, A C; Leger, P; Delcourt, A; Gandjbakhch, I

1998-04-01

The main causes of allograft failure after cardiac transplantation are primary graft dysfunction, intractable acute rejection, and coronary graft disease. Despite the important progress in the last several years in graft preservation, surgical techniques, immunosuppression, and treatment of coronary graft disease, retransplantation in selected cases is the only way to achieve long-term recipient survival. We compare here in a case-control study 24 retransplantations with 47 first transplants in patients matched for date of transplantation. Between 1973 and 1996, 1,063 patients underwent cardiac transplantation in our institution. In this cohort, 22 patients had a total of 24 retransplantations (2 second-time retransplantations). The causes of retransplantations were primary graft failure (n=4), acute rejection (n=7), coronary graft disease (n=11), and miscellaneous (n=2). Survival at 1 and 5 years of patients with retransplantations is 45.5% and 31.2%, and survival of control patients is 59.4% and 38.8% (p=0.07). An interval between first transplantation and retransplantation shorter (n=11) or longer (n=13) than 1 year is associated with a 1-year survival of 27.3% and 61.5% and a 4-year survival of 27.3% and 46%, respectively (not significant). Intervals shorter than 1 year between first transplantation and retransplantation were exclusively secondary to primary graft failure or intractable acute rejection. In the face of lack of donor grafts, these and other data indicate that retransplantation should be considered cautiously, especially when the interval between the first transplantation and retransplantation is short.

Nanoporous spongy graphene: Potential applications for hydrogen adsorption and selective gas separation

Energy Technology Data Exchange (ETDEWEB)

Kostoglou, Nikolaos, E-mail: nikolaos.kostoglou@stud.unileoben.ac.at [Department of Mechanical and Manufacturing Engineering, University of Cyprus, 1678 Nicosia (Cyprus); Department of Physical Metallurgy and Materials Testing, Montanuniversität Leoben, 8700 Leoben (Austria); Constantinides, Georgios [Research Unit for Nanostructured Materials Systems, Department of Mechanical Engineering and Materials Science and Engineering, Cyprus University of Technology, 3036 Lemesos (Cyprus); Charalambopoulou, Georgia; Steriotis, Theodore [National Center for Scientific Research Demokritos, Agia Paraskevi Attikis, 15310 Athens (Greece); Polychronopoulou, Kyriaki [Department of Mechanical Engineering, Khalifa University of Science, Technology and Research, Abu Dhabi (United Arab Emirates); Li, Yuanqing; Liao, Kin [Department of Aerospace Engineering, Khalifa University of Science, Technology and Research, Abu Dhabi (United Arab Emirates); Ryzhkov, Vladislav [Nanotube Production Department, Fibrtec Incorporation, TX, 75551 Atlanta (United States); Mitterer, Christian [Department of Physical Metallurgy and Materials Testing, Montanuniversität Leoben, 8700 Leoben (Austria); Rebholz, Claus, E-mail: claus@ucy.ac.cy [Department of Mechanical and Manufacturing Engineering, University of Cyprus, 1678 Nicosia (Cyprus)

2015-12-01

In the present work, a nanoporous (pore width ~ 0.7 nm) graphene-based sponge-like material with large surface area (~ 350 m{sup 2}/g) was synthesized by wet chemical reduction of graphene oxide in combination with freeze-drying. Surface morphology and elemental composition were studied by scanning and transmission electron microscopy combined with energy dispersive X-ray spectroscopy. Surface chemistry was qualitatively examined by Fourier-transform infrared spectroscopy, while the respective structure was investigated by X-ray diffraction analysis. Textural properties, including Brunauer–Emmet–Teller (BET) surface area, micropore volume and surface area as well as pore size distribution, were deduced from nitrogen gas adsorption/desorption data obtained at 77 K and up to 1 bar. Potential use of the spongy graphene for gas storage and separation applications was preliminarily assessed by low-pressure (0–1 bar) H{sub 2}, CO{sub 2} and CH{sub 4} sorption measurements at different temperatures (77, 273 and 298 K). The adsorption capacities for each gas were evaluated up to ~ 1 bar, the isosteric enthalpies of adsorption for CO{sub 2} (28–33 kJ/mol) and CH{sub 4} (30–38 kJ/mol) were calculated using the Clausius–Clapeyron equation, while the CO{sub 2}/CH{sub 4} gas selectivity (up to 95:1) was estimated using the Ideal Adsorbed Solution Theory (IAST). - Highlights: • Nanoporous sponge produced by chemical reduction of graphene oxide and freeze-drying • Characterization performed using SEM, EDS, TEM, FT-IR, BET and XRD methods • Gas storage performance evaluated towards H{sub 2}, CO{sub 2} and CH{sub 4} adsorption up to 1 bar • CO{sub 2} over CH{sub 4} gas selectivity estimated between 45 and 95 at 273 K using the IAST model.

Estimation of patient-specific imaging dose for real-time tumour monitoring in lung patients during respiratory-gated radiotherapy

Science.gov (United States)

Shiinoki, Takehiro; Onizuka, Ryota; Kawahara, Daisuke; Suzuki, Tatsuhiko; Yuasa, Yuki; Fujimoto, Koya; Uehara, Takuya; Hanazawa, Hideki; Shibuya, Keiko

2018-03-01

Purpose: To quantify the patient-specific imaging dose for real-time tumour monitoring in the lung during respiratory-gated stereotactic body radiotherapy (SBRT) in clinical cases using SyncTraX. Methods and Materials: Ten patients who underwent respiratory-gated SBRT with SyncTraX were enrolled in this study. The imaging procedure for real-time tumour monitoring using SyncTraX was simulated using Monte Carlo. We evaluated the dosimetric effect of a real-time tumour monitoring in a critical organ at risk (OAR) and the planning target volume (PTV) over the course of treatment. The relationship between skin dose and gating efficiency was also investigated. Results: For all patients, the mean D50 to the PTV, ipsilateral lung, liver, heart, spinal cord and skin was 118.3 (21.5–175.9), 31.9 (9.5–75.4), 15.4 (1.1–31.6), 10.1 (1.3–18.1), 25.0 (1.6–101.8), and 3.6 (0.9–7.1) mGy, respectively. The mean D2 was 352.0 (26.5–935.8), 146.4 (27.3–226.7), 90.7 (3.6–255.0), 42.2 (4.8–82.7), 88.0 (15.4–248.5), and 273.5 (98.3–611.6) mGy, respectively. The D2 of the skin dose was found to increase as the gating efficiency decreased. Conclusions: The additional dose to the PTV was at most 1.9% of the prescribed dose over the course of treatment for real-time tumour monitoring. For OARs, we could confirm the high dose region, which may not be susceptible to radiation toxicity. However, to reduce the skin dose from SyncTraX, it is necessary to increase the gating efficiency.

Nanoporous spongy graphene: Potential applications for hydrogen adsorption and selective gas separation

International Nuclear Information System (INIS)

Kostoglou, Nikolaos; Constantinides, Georgios; Charalambopoulou, Georgia; Steriotis, Theodore; Polychronopoulou, Kyriaki; Li, Yuanqing; Liao, Kin; Ryzhkov, Vladislav; Mitterer, Christian; Rebholz, Claus

2015-01-01

In the present work, a nanoporous (pore width ~ 0.7 nm) graphene-based sponge-like material with large surface area (~ 350 m"2/g) was synthesized by wet chemical reduction of graphene oxide in combination with freeze-drying. Surface morphology and elemental composition were studied by scanning and transmission electron microscopy combined with energy dispersive X-ray spectroscopy. Surface chemistry was qualitatively examined by Fourier-transform infrared spectroscopy, while the respective structure was investigated by X-ray diffraction analysis. Textural properties, including Brunauer–Emmet–Teller (BET) surface area, micropore volume and surface area as well as pore size distribution, were deduced from nitrogen gas adsorption/desorption data obtained at 77 K and up to 1 bar. Potential use of the spongy graphene for gas storage and separation applications was preliminarily assessed by low-pressure (0–1 bar) H_2, CO_2 and CH_4 sorption measurements at different temperatures (77, 273 and 298 K). The adsorption capacities for each gas were evaluated up to ~ 1 bar, the isosteric enthalpies of adsorption for CO_2 (28–33 kJ/mol) and CH_4 (30–38 kJ/mol) were calculated using the Clausius–Clapeyron equation, while the CO_2/CH_4 gas selectivity (up to 95:1) was estimated using the Ideal Adsorbed Solution Theory (IAST). - Highlights: • Nanoporous sponge produced by chemical reduction of graphene oxide and freeze-drying • Characterization performed using SEM, EDS, TEM, FT-IR, BET and XRD methods • Gas storage performance evaluated towards H_2, CO_2 and CH_4 adsorption up to 1 bar • CO_2 over CH_4 gas selectivity estimated between 45 and 95 at 273 K using the IAST model

Electronic structure of homoleptic transition metal hydrides: TiH4, VH4, CrH4, MnH4, FeH4, CoH4, and NiH4

International Nuclear Information System (INIS)

Hood, D.M.; Pitzer, R.M.; Schaefer III, H.F.

1979-01-01

Ab initio molecular electronic structure theory has been applied to the family of transition metal tetrahydrides TiH 4 through NiH 4 . For the TiH 4 molecule a wide range of contracted Gaussian basis sets has been tested at the self-consistent-field (SCF) level of theory. The largest basis, labeled M(14s 11p 6d/10s 8p 3d), H(5s 1p/3s 1p), was used for all members of the series and should yield wave functions approaching true Hartree-Fock quality. Predicted SCF dissociation energies (relative to M+4H) and M--H bond distances are TiH 4 132 kcal, 1.70 A; VH 4 86 kcal, 1.64 A; CrH 4 65 kcal, 1.59 A; MnH 4 -- 36 kcal, 1.58 A; FeH 4 0 kcal, 1.58 A; CoH 4 27 kcal, 1.61 A; and NiH 4 18 kcal, 1.75 A. It should be noted immediately that each of these SCF dissociation energies will be increased by electron correlation effects by perhaps as much as 90 kcal. For all of these molecules except TiH 4 excited states have also been studied. One of the most interesting trends seen for these excited states is the shortening of the M--H bond as electrons are transferred from the antibonding 4t 2 orbital to the nonbonding 1e orbitals

Antirelapse Efficacy of Various Primaquine Regimens for Plasmodium vivax

Directory of Open Access Journals (Sweden)

D. D. Rajgor

2014-01-01

respectively P=0.004. The relapse rate was 6.89%, 1.55%, 4%, and 3.85% as per the month of recurrence; 8.2%, 2%, 4.58%, and 3.68% P=0.007 as per PCR-RFLP; and 2.73%, 1.47%, 1.55%, and 1.53% as per PCR sequencing for groups A, B, C, and D, respectively. The concordance between methods was low, 45%. Conclusion. The higher recurrence rate in no PQ as compared to PQ groups documents PQ antirelapse activity. Regimens tested were safe. However, probable resistance to PQ warrants continuous monitoring and low concordance and limitations in the methods warrant caution in interpreting.

Stable isotope labeling-mass spectrometry analysis of methyl- and pyridyloxobutyl-guanine adducts of 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone in p53-derived DNA sequences.

Science.gov (United States)

Rajesh, Mathur; Wang, Gang; Jones, Roger; Tretyakova, Natalia

2005-02-15

The p53 tumor suppressor gene is a primary target in smoking-induced lung cancer. Interestingly, p53 mutations observed in lung tumors of smokers are concentrated at guanine bases within endogenously methylated (Me)CG dinucleotides, e.g., codons 157, 158, 245, 248, and 273 ((Me)C = 5-methylcytosine). One possible mechanism for the increased mutagenesis at these sites involves targeted binding of metabolically activated tobacco carcinogens to (Me)CG sequences. In the present work, a stable isotope labeling HPLC-ESI(+)-MS/MS approach was employed to analyze the formation of guanine lesions induced by the tobacco-specific lung carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) within DNA duplexes representing p53 mutational "hot spots" and surrounding sequences. Synthetic DNA duplexes containing p53 codons 153-159, 243-250, and 269-275 were prepared, where (Me)C was incorporated at all physiologically methylated CG sites. In each duplex, one of the guanine bases was replaced with [1,7,NH(2)-(15)N(3)-2-(13)C]-guanine, which served as an isotope "tag" to enable specific quantification of guanine lesions originating from that position. After incubation with NNK diazohydroxides, HPLC-ESI(+)-MS/MS analysis was used to determine the yields of NNK adducts at the isotopically labeled guanine and at unlabeled guanine bases elsewhere in the sequence. We found that N7-methyl-2'-deoxyguanosine and N7-[4-oxo-4-(3-pyridyl)but-1-yl]guanine lesions were overproduced at the 3'-guanine bases within polypurine runs, while the formation of O(6)-methyl-2'-deoxyguanosine and O(6)-[4-oxo-4-(3-pyridyl)but-1-yl]-2'-deoxyguanosine adducts was specifically preferred at the 3'-guanine base of 5'-GG and 5'-GGG sequences. In contrast, the presence of 5'-neighboring (Me)C inhibited O(6)-guanine adduct formation. These results indicate that the N7- and O(6)-guanine adducts of NNK are not overproduced at the endogenously methylated CG dinucleotides within the p53 tumor suppressor gene

The clinical usefulness of Tc-99m ECD brain SPECT in acute measles encephalitis

Energy Technology Data Exchange (ETDEWEB)

Lim, Seok Tae; Sohn, Myung Hee [School of Medicine, Chonbuk National Univ., Chonju (Korea, Republic of)

2003-08-01

Since the prognosis of measles encephalitis is poor, early diagnosis and proper management are very important to improve clinical outcomes. We compared Tc-99m ECD brain SPECT (SPECT) with MR imaging (MRI) for the detection of acute measles encephalitis. Eleven patients (M : F=4 : 7, age range 18 months-14 yrs) with acute measles encephalitis were enrolled in this studies. All of them underwent both MRI and SPECT. The results of SPECT were scored from 0 (normal) to 3 (most severe defect) according to perfusion state. We compared two image modalities for the detection of brain abnormality in acute measles encephalitis. Seven of 11 patients (63.6%) revealed high signal intensity in the white matter on T2WI of MRI, on the other hand all patients (100%) showed hypoperfusion on SPECT. Severe perfusion deficits above score 2 were located with decreasing frequencies in the frontal lobe (81.8%), temporal lobe (72.7%), occipital lobe (27.3%), basal ganglia (27.3%), and parietal lobe (9.1%). We conclude that SPECT is more useful than MRI for the detection of brain involvement in patients with acute measles encephalitis.

The clinical usefulness of Tc-99m ECD brain SPECT in acute measles encephalitis

International Nuclear Information System (INIS)

Lim, Seok Tae; Sohn, Myung Hee

2003-01-01

Since the prognosis of measles encephalitis is poor, early diagnosis and proper management are very important to improve clinical outcomes. We compared Tc-99m ECD brain SPECT (SPECT) with MR imaging (MRI) for the detection of acute measles encephalitis. Eleven patients (M : F=4 : 7, age range 18 months-14 yrs) with acute measles encephalitis were enrolled in this studies. All of them underwent both MRI and SPECT. The results of SPECT were scored from 0 (normal) to 3 (most severe defect) according to perfusion state. We compared two image modalities for the detection of brain abnormality in acute measles encephalitis. Seven of 11 patients (63.6%) revealed high signal intensity in the white matter on T2WI of MRI, on the other hand all patients (100%) showed hypoperfusion on SPECT. Severe perfusion deficits above score 2 were located with decreasing frequencies in the frontal lobe (81.8%), temporal lobe (72.7%), occipital lobe (27.3%), basal ganglia (27.3%), and parietal lobe (9.1%). We conclude that SPECT is more useful than MRI for the detection of brain involvement in patients with acute measles encephalitis

Catching Carbon Stars in the Baade's Windows

Science.gov (United States)

Azzopardi, M.; Lequeux, J.; Rebeirot, E.

1984-12-01

Near-infrared objective prism surveys at low dispersion (1 700 to 3400 Amm-1) using Schmidt telescopes have been extensively used to detect M-, S- and C-type stars in the galactic equatorial zone, and in other strategically selected regions of the Milky Way. The detection techniques have been perfected by Nassau and his associates (Nassau and Velghe, 1964, Astrophysical Journal 139, 190) during their survey, at Cleveland, of the northern part of the Milky Way. These techniques are based on the identification of a number of typical molecular bands (TiO, CN, LaO, Va) that fall in the 6800-8800 Aspectral range, and which are used to classify M-, S- and C-type stars (Mavridis, 1967, Coll. on Late Type Stars, p. 420). Using the same method, partial or entire nearinfrared surveys of the southern Milky Way have been carried out by Blanco and Münch (1955, Bol. Obs. Tonantzintla y Tacubaya 12, 273) at Tonantzintla, Smith and Smith (1956, Astronomical Journal 61, 273) at Bloemfontein, and later by Westerlund (1971, Astronomy and Astrophysics Suppl. 4, 51 ; 1978, ibid. 32, 401) with the Uppsala Schmidt telescope at Mount Stromlo Observatory.

Photochemistry of U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/

Energy Technology Data Exchange (ETDEWEB)

Paine, R T; Schonberg, P R; Light, R W [New Mexico Univ., Albuquerque (USA). Dept. of Chemistry; Danen, W C; Freund, S M

1979-01-01

U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/ are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH/sub 4/)/sub 3/, B/sub 2/H/sub 6/, H/sub 2/, U(BD/sub 4/)/sub 3/, B/sub 2/D/sub 6/ and D/sub 2/. Further, U(BD/sub 4/)/sub 4/ undergoes a related decomposition reaction under the influence of CO/sub 2/ laser irradiation at 924.97 cm/sup -1/.

4,4’-Bis(4-octylphenoxy)-2,2’-bipyridine

OpenAIRE

Zhen-Ting Du; Jun-Ru Wang; Ru Liu; Yan Xu

2009-01-01

4,4’-Bis(4-octylphenoxy)-2,2’-bipyridine which can be used in complexes of ruthenium was synthesized. This ligand bears a long chain for the purpose of increasing the solubility of the final complex. The synthesis was achieved through a nucleophilic aromatic substitution reaction of 4,4’-bromo-2,2’-bipyridine and 4-octylphenol.

4,4’-Bis(4-octylphenoxy-2,2’-bipyridine

Directory of Open Access Journals (Sweden)

Zhen-Ting Du

2009-12-01

Full Text Available 4,4’-Bis(4-octylphenoxy-2,2’-bipyridine which can be used in complexes of ruthenium was synthesized. This ligand bears a long chain for the purpose of increasing the solubility of the final complex. The synthesis was achieved through a nucleophilic aromatic substitution reaction of 4,4’-bromo-2,2’-bipyridine and 4-octylphenol.

Two dimensional untwisted (4,4), twisted (4,4-bar) and chiral supersymmetric non linear σ-models

International Nuclear Information System (INIS)

Lhallabi, T.; Saidi, E.H.

1987-09-01

D=2 N=(4,4) harmonic superspace analysis is developed. The underlying untwisted (4,4) non linear σ-models are studied. A method of deriving chiral (4,0) and (0,4) models is presented. The Lagrange superparameter leading to the constraint specifying the hyperkahler manifold structure is predicted and its relation to the matter superfield is stated in a covariant way. A known construction is recovered. We show also that (4,4) model is not a direct sum of the chiral ones. Finally a twisted (4,4-bar) model is obtained. (author). 28 refs

Chemical Composition and Antimicrobial Activity of Echinophora spinosa L. (Apiaceae Essential Oil

Directory of Open Access Journals (Sweden)

Jasmina M. Glamočlija

2011-01-01

Full Text Available The present study was undertaken to investigate the chemical composition and effectiveness of the essential oil isolated from Echinophora spinosa on different bacterial and fungal species. Chemical analysis (GC/MS showed that δ³-carene (60,86 %, α-phellandrene (7,12%, p-cymene (6,22 %, myrcene (4,82 % and β-phellandrene (2,73 % were dominant components in this oil. Essential oil tested showed good antimicrobial activity. Antimicrobial potential of this oil was higher than potential of commercial antimicrobial drugs tested, streptomycin, bifonozole and ketoconazole.

Design and marketing features influencing choice of e-cigarettes and tobacco in the EU

OpenAIRE

Laverty, Anthony A.; Vardavas, Constantine I.; Filippidis, Filippos T.

2016-01-01

Data were analysed from the 2014 Special Eurobarometer for Tobacco survey. We estimated self-rated importance of various factors in the choice of both tobacco and electronic cigarettes (e-cigarettes) among tobacco smokers who had ever used an e-cigarette. Among ever users of tobacco and e-cigarettes (N = 2430), taste (39.4%), price (39.2%) and amount of nicotine (27.3%) were the most commonly cited reasons for choosing their brand of e-cigarettes. Those aged 15?24 were more likely to cite ext...

Effect of electrochemical treatments on the surface chemistry of activated carbon

OpenAIRE

Berenguer Betrián, Raúl; Marco Lozar, Juan Pablo; Quijada Tomás, César; Cazorla Amorós, Diego; Morallón Núñez, Emilia

2008-01-01

The effect of the electrochemical treatment (galvanostatic electrolysis in a filter-press electrochemical cell) on the surface chemistry and porous structure of a granular activated carbon (GAC) has been analyzed by means of temperature-programmed desorption and N2 (at 77 K) and CO2 (at 273 K) adsorption isotherms. The anodic and cathodic treatments, the applied current (between 0.2 and 2.0 A) and the type of electrolyte (NaOH, H2SO4 and NaCl)have been studied as electrochemical variables. Bo...

Energy Insecurity: The False Promise of Liquid Biofuels

Science.gov (United States)

2013-01-01

and Gas $2,820 6,229 $0.45 Hydro $216 437 $0.49 Nuclear $2,499 1,451 $1.72 Geothermal $273 36 $7.63 Biomass/fuel $7,761 747 $10.39 Wind $4,986...States for processing.75 A 2010 World Bank analysis revealed that other wealthy countries, includ- ing Saudi Arabia, South Korea, and China , are...and peat lands to make room for oil palms has made Indonesia the world’s third highest producer of CO2, after the United States and China .88 The

Women in Combat Arms: A Study of the Global War on Terror

Science.gov (United States)

2013-05-23

increased general joint laxity throughout the elbow, knee, and ankle joints than their male counterparts. This joint laxity and hyperextension...capture and torture to the nation’s daughters places a psychological anchor for men in combat filling a protectorate role.64 A presidential commission...tal cases) Back 17.3% 3,300 17.1% Knee 277 14.8% 2,953 15.3% 8.6% 91.4% 100.0% Ankle /Foot 273 14.6% 2,184 11.3% 11.1% 88.9% 100.0% Wrist/Hand 193 10.3

Neutral coordination polymers based on a metal-mono(dithiolene) complex: synthesis, crystal structure and supramolecular chemistry of [Zn(dmit)(4,4'-bpy)]n, [Zn(dmit)(4,4'-bpe)]n and [Zn(dmit)(bix)]n (4,4'-bpy = 4,4'-bipyridine, 4,4'-bpe = trans-1,2-bis(4-pyridyl)ethene, bix = 1,4-bis(imidazole-1-ylmethyl)-benzene.

Science.gov (United States)

Madhu, Vedichi; Das, Samar K

2011-12-28

This article describes a unique synthetic route that enables a neutral mono(dithiolene)metal unit, {Zn(dmit)}, to link with three different organic molecules, resulting in the isolation of a new class of neutral coordination polymers. The species {Zn(dmit)} coordinates with 4,4'-bipyridine (4,4'-bpy), trans-1,2-bis(4-pyridyl)ethene (4,4'-bpe) and 1,4-bis(imidazole-1-ylmethyl)-benzene (bix) as linkers giving rise to the formation of coordination polymers [Zn(dmit)(4,4'-bpy)](n) (1), [Zn(dmit)(4,4'-bpe)](n) (2) and [Zn(dmit)(bix)](n) (3) respectively. Compounds 1-3 were characterized by elemental analyses, IR, diffuse reflectance and single crystal X-ray diffraction studies. Compounds 1 and 3 crystallize in the monoclinic space group P2(1)/n, whereby compound 2 crystallizes in triclinic space group P1[combining macron]. In the present study, we chose three linkers 4,4'-bpy, 4,4'-bpe and bix (see , respectively, for their structural drawings), that differ in terms of their molecular dimensions. The crystal structures of compounds 1-3 are described here in terms of their supramolecular diversities that include π-π interactions, not only among aromatic stacking (compounds 1 and 3), but also between an aromatic ring and an ethylenic double bond (compound 2). The electronic absorption spectroscopy of compounds 1-3 support these intermolecular π-π interactions. This journal is © The Royal Society of Chemistry 2011

Department of Defense Suicide Event Report (DoDSER) Calendar Year 2014 Annual Report

Science.gov (United States)

2015-07-16

diagnoses identified in suicide DoDSER reports included mood (n= 17, 28.3%), adjustment (n = 14, 23.3%) and anxiety (n = 13, 21.7%) disorders . For suicide ...n = 35, 27.3%) and substance abuse (n = 35, 27.3%) disorders . For suicide attempt DoDSER reports, the most common diagnoses identified were mood (n...diagnoses identified in suicide DoDSER reports included mood (n= 10, 17.2%), adjustment (n = 8, 13.8%) and substance abuse (n = 8, 13.8%) disorders . For

The crystal structure of tryptophan hydroxylase with bound amino acid substrate

DEFF Research Database (Denmark)

Windahl, Michael Skovbo; Petersen, Charlotte Rode; Christensen, Hans Erik Mølager

2008-01-01

Tryptophan hydroxylase (TPH) is a mononuclear non-heme iron enzyme, which catalyzes the reaction between tryptophan, O2, and tetrahydrobiopterin (BH4) to produce 5-hydroxytryptophan and 4a-hydroxytetrahydrobiopterin. This is the first and rate-limiting step in the biosynthesis of the neurotransmi......Tryptophan hydroxylase (TPH) is a mononuclear non-heme iron enzyme, which catalyzes the reaction between tryptophan, O2, and tetrahydrobiopterin (BH4) to produce 5-hydroxytryptophan and 4a-hydroxytetrahydrobiopterin. This is the first and rate-limiting step in the biosynthesis...... acid hydroxylase with bound natural amino acid substrate. The iron coordination can be described as distorted trigonal bipyramidal coordination with His273, His278, and Glu318 (partially bidentate) and one imidazole as ligands. The tryptophan stacks against Pro269 with a distance of 3.9 Å between...

Possibilities of Fe-RICH phases elimination with using heat treatment in secondary Al-Si-Cu cast alloy

Directory of Open Access Journals (Sweden)

L. Hurtalová

2015-01-01

Full Text Available The mechanical properties of Al-Si-Cu cast alloy are strongly dependent upon the morphologies, type and distribution of the second phases. The skeleton like – Al15(FeMn 3Si2 and needles - Al5FeSi phases were observed in experimental material AlSi9Cu3. The Fe-rich phases morphology was affected with applying two types of heat treatment, T4 and T6, which caused positive changes of mechanical properties especially ultimate tensile strength, gives that for as cast state was Rm = 211 MPa, than at optimum T4 (515 °C/ 4 hours was Rm = 273 MPa and at optimum T6 (515 °C/ 4 hours with artificial aging 170 °C/ 16 hours was Rm = 311 MPa.

Optimal degree of mouth opening for laryngeal mask airway function during oral surgery.

Science.gov (United States)

Sanuki, Takuro; Sugioka, Shingo; Hirokane, Motoko; Son, Hiroki; Uda, Rumiko; Akatsuka, Masafumi; Kotani, Junichiro

2011-04-01

This study was performed to determine the optimal degree of mouth opening in anesthetized patients requiring laryngeal mask airway (LMA) during oral surgery. A single, experienced LMA user inserted the LMA in 15 patients who were scheduled for elective oral surgery. Oropharyngeal leak pressure, intracuff pressure, and fiberoptic assessment of the LMA position were sequentially documented in 5 mouth conditions-opening of 1.4 (neutral position), 2, 3, 4, and 5 cm-and any resulting ventilatory difficulties were recorded. Oropharyngeal leak pressure with the mouth open 4 cm (21.8 ± 3.2 cm H(2)O, P = .025) and 5 cm (27.3 ± 7.2 cm H(2)O, P Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.

Estudio de la susceptibilidad de un acero inoxidable austenítico estabilizado con niobio al dañado por tensocorrosión en medio H₂S (SSC y corrosión intergranular (IGC en otros medios agresivos

Directory of Open Access Journals (Sweden)

Gutiérrez de Saiz-Solabarría, S.

1998-05-01

Full Text Available Behavior to hydrogen damage caused by stress corrosion in a H₂S medium (SSC and to intergranular corrosion (IGC in different mediums, such as oxalic acid (C2H₂O₄-2H₂0, iron sulphate-50 % sulfuric acid [Fe₂(SO₄₃-50 % H₂SO₄], nitric acid (HNO₃, copper sulphate-16 % sulfuric acid (CuSO₄-5H₂O-16 % H₂SO₄ and cooper sulphate-50 % sulfuric acid (CuSO₄-5H₂O-50 % H₂SO₄, is studied in an AISI 347 austenitic stainless steel stabilized with 0.61 mass % Nb and hot rolled to a seamless pipe with 273.1 mm in diameter and 18.2 mm in thickness.

Se estudia el comportamiento de un acero inoxidable austenítico del tipo AISI 347 estabilizado con un 0,61 % en masa de Nb, laminado en caliente para producir una tubería sin soldadura de 273,1 mm de diámetro y 18,2 mm de espesor, frente al dañado por hidrógeno generado por tensocorrosión en medio H₂S (SSC y frente a la corrosión intergranular (IGC en diferentes medios agresivos tales como ácido oxálico (C₂H₂O₄∙2H₂O, sulfato de hierro-50% ácido sulfúrico [Fe₂ (SO₄₃-50 % H₂SO₄], ácido nítrico (HNO₃, sulfato de cobre-16% ácido sulfúrico (CuSO₄-5H₂O-16 % H₂SO₄ y sulfato de cobre-50 % ácido sulfúrico (CuSO₄-5H₂O-50 % H₂SO₄, respectivamente.

Cost estimation for slope stability improvement in Muara Enim

Science.gov (United States)

Juliantina, Ika; Sutejo, Yulindasari; Adhitya, Bimo Brata; Sari, Nurul Permata; Kurniawan, Reffanda

2017-11-01

Case study area of SP. Sugihwaras-Baturaja is typologically specified in the C-zone type because the area is included in the foot of the mountain with a slope of 0 % to 20 %. Generally, the factors that cause landslide in Muara Enim Regency due to the influence of soil/rock, water factor, geological factors, and human activities. Slope improvement on KM.273 + 642-KM.273 + 774 along 132 m using soil nailing with 19 mm diameter tendon iron and an angle of 20o and a 75 mm shotcrete thickness, a K-250 concrete grouting material. Cost modeling (y) soil nailing based on 4 variables are X1 = length, X2 = horizontal distance, X3 = safety factor (SF), and X4 = time. Nine variations were used as multiple linear regression equations and analyzed with SPSS.16.0 program. Based on the SPSS output, then attempt the classical assumption and feasibility test model which produced the model that is Cost = (1,512,062 + 194,354 length-1,649,135 distance + 187,831 SF + 54,864 time) million Rupiah. The budget plan includes preparatory work, drainage system, soil nailing, and shotcrete. An efficient cost estimate of 8 m length nail, 1.5 m installation distance, safety factor (SF) = 1.742 and a 30 day processing time resulted in a fee of Rp. 2,566,313,000.00 (Two billion five hundred sixty six million three hundred thirteen thousand rupiah).

Effect of Consuming Oat Bran Mixed in Water before a Meal on Glycemic Responses in Healthy Humans—A Pilot Study

Directory of Open Access Journals (Sweden)

Robert E. Steinert

2016-08-01

Full Text Available Background: Viscous dietary fibers including oat β-glucan are one of the most effective classes of functional food ingredients for reducing postprandial blood glucose. The mechanism of action is thought to be via an increase in viscosity of the stomach contents that delays gastric emptying and reduces mixing of food with digestive enzymes, which, in turn, retards glucose absorption. Previous studies suggest that taking viscous fibers separate from a meal may not be effective in reducing postprandial glycemia. Methods: We aimed to re-assess the effect of consuming a preload of a commercially available oat-bran (4.5, 13.6 or 27.3 g containing 22% of high molecular weight oat β-glucan (O22 (OatWell®22 mixed in water before a test-meal of white bread on glycemic responses in 10 healthy humans. Results: We found a significant effect of dose on blood glucose area under the curve (AUC (p = 0.006 with AUC after 27.3 g of O22 being significantly lower than white bread only. Linear regression analysis showed that each gram of oat β-glucan reduced glucose AUC by 4.35% ± 1.20% (r = 0.507, p = 0.0008, n = 40 and peak rise by 6.57% ± 1.49% (r = 0.582, p < 0.0001. Conclusion: These data suggest the use of oat bran as nutritional preload strategy in the management of postprandial glycemia.

Thermodynamics of {l_brace}zNaCl+(1-z)Na{sub 2}SO{sub 4}{r_brace}(aq) from T=278.15 K to T=318.15 K, and representation with an extended ion-interaction (Pitzer) model

Energy Technology Data Exchange (ETDEWEB)

Rard, Joseph A. E-mail: rard1@llnl.gov; Clegg, Simon L.; Platford, Robert

2003-06-01

In 1968, R.F. Platford reported the results from extensive isopiestic vapor-pressure measurements for the {l_brace}zNaCl+(1-z)Na{sub 2}SO{sub 4}{r_brace}(aq) system at T=298.15 K, using NaCl(aq) as the isopiestic reference standard [R.F. Platford, J. Chem. Eng. Data 13 (1968) 46-48]. However, only derived quantities were reported, and the experimental isopiestic equilibrium molalities were not given. The complete set of original isopiestic molalities from that study is tabulated in the present report. In addition, published thermodynamic information for this system is reviewed and the isopiestic equilibrium molalities, electromotive force measurements for five different types of electrochemical cells, and enthalpies of mixing from these other studies are critically assessed and recalculated consistently. These combined results are used to evaluate at T=298.15 K the two mixing parameters of Pitzer's ion-interaction model, {sup S}{theta}(Cl,SO{sub 4})=(1.236{+-}0.032{sub 5}){center_dot}10{sup -2} kg{center_dot}mol{sup -1} and {psi}(Na,Cl,SO{sub 4})=(1.808{+-}0.086){center_dot}10{sup -3} kg{sup 2}{center_dot}mol{sup -2}, and their temperature derivatives {l_brace}{partial_derivative}{sup S}{theta}(Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=(2.474{+-}0.460){center_dot}10{sup -5} kg{center_dot}mol{sup -1}{center_dot}K{sup -1} and {l_brace}{partial_derivative}{psi}(Na,Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=-(6.228{+-}0.186){center_dot}10{sup -5} kg{sup 2}{center_dot}mol{sup -2}{center_dot}K{sup -1}. Also reported are parameters for an extended ion-interaction model for Na{sub 2}SO{sub 4}(aq), valid from T=(273.15 to 323.15) K, that were required for this mixed electrolyte solution analysis.

CO₂ Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues.

Science.gov (United States)

Bermúdez, José M; Dominguez, Pablo Haro; Arenillas, Ana; Cot, Jaume; Weber, Jens; Luque, Rafael

2013-10-18

Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO₂ adsorption properties, with interestingly high gas selectivities for CO₂ (α > 200 at a gas composition of 15% CO₂/85% N₂, 273K, 1 bar) and capacities (>2 mmol·g -1 at 273 K). Both CO₂ isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO₂ which may be correlated with both: N content in the leather residues and ultrasmall pore sizes.

The International Costs and Utilities Related to Osteoporotic Fractures Study (ICUROS)--quality of life during the first 4 months after fracture.

Science.gov (United States)

Borgström, F; Lekander, I; Ivergård, M; Ström, O; Svedbom, A; Alekna, V; Bianchi, M L; Clark, P; Curiel, M D; Dimai, H P; Jürisson, M; Kallikorm, R; Lesnyak, O; McCloskey, E; Nassonov, E; Sanders, K M; Silverman, S; Tamulaitiene, M; Thomas, T; Tosteson, A N A; Jönsson, B; Kanis, J A

2013-03-01

The quality of life during the first 4 months after fracture was estimated in 2,808 fractured patients from 11 countries. Analysis showed that there were significant differences in the quality of life (QoL) loss between countries. Other factors such as QoL prior fracture and hospitalisation also had a significant impact on the QoL loss. The International Costs and Utilities Related to Osteoporotic Fractures Study (ICUROS) was initiated in 2007 with the objective of estimating costs and quality of life related to fractures in several countries worldwide. The ICUROS is ongoing and enrols patients in 11 countries (Australia, Austria, Estonia, France, Italy, Lithuania, Mexico, Russia, Spain, UK and the USA). The objective of this paper is to outline the study design of ICUROS and present results regarding the QoL (measured using the EQ-5D) during the first 4 months after fracture based on the patients that have been thus far enrolled ICUROS. ICUROS uses a prospective study design where data (costs and quality of life) are collected in four phases over 18 months after fracture. All countries use the same core case report forms. Quality of life was collected using the EQ-5D instrument and a time trade-off questionnaire. The total sample for the analysis was 2,808 patients (1,273 hip, 987 distal forearm and 548 vertebral fracture). For all fracture types and countries, the QoL was reduced significantly after fracture compared to pre-fracture QoL. A regression analysis showed that there were significant differences in the QoL loss between countries. Also, a higher level of QoL prior to the fracture significantly increased the QoL loss and patients who were hospitalised for their fracture also had a significantly higher loss compared to those who were not. The findings in this study indicate that there appear to be important variations in the QoL decrements related to fracture between countries.

Laparoscopic resection of large gastric gastrointestinal stromal tumours

Directory of Open Access Journals (Sweden)

Sebastian Smolarek

2015-12-01

Full Text Available Introduction : Gastrointestinal stromal tumours (GISTs are a rare class of neoplasms that are seen most commonly in the stomach. Due to their malignant potential, surgical resection is the recommended method for management of these tumours. Many reports have described the ability to excise small and medium sized GISTs laparoscopically, but laparoscopic resection of GISTs greater than 5 cm is still a matter of debate. Aim: To investigate the feasibility and effectiveness of laparoscopic surgical techniques for management of large gastric GISTs greater than 4 cm and to detail characteristics of this type of tumour. Material and methods: The study cohort consisted of 11 patients with suspected gastric GISTs who were treated from 2011 to April 2014 in a single institution. All patients underwent laparoscopic resection of a gastric GIST. Results : Eleven patients underwent laparoscopic resection of a suspected gastric GIST between April 2011 and April 2014. The cohort consisted of 6 males and 5 females. Mean age was 67 years (range: 43–92 years. Sixty-four percent of these patients presented with symptomatic tumours. Four (36.4% patients underwent laparoscopic transgastric resection (LTR, 3 (27.3% laparoscopic sleeve gastrectomy (LSG, 3 (27.3% laparoscopic wedge resection (LWR and 1 (9% laparoscopic distal gastrectomy (LDG. The mean operative time was 215 min. The mean tumour size was 6 cm (range: 4–9 cm. The mean tumour size for LTR was 5.5 cm (range: 4–6.3 cm, for LWR 5.3 cm (range: 4.5–7 cm, for LSG 6.5 cm (range: 4–9 cm and for LDG 9 cm. We experienced only minor postoperative complications. Conclusions : Laparoscopic procedures can be successfully performed during management of large gastric GISTs, bigger than 4 cm, and should be considered for all non-metastatic cases. The appropriate approach can be determined by assessing the anatomical location of each tumour.

Relapse insomnia increases greater risk of anxiety and depression: evidence from a population-based 4-year cohort study.

Science.gov (United States)

Chen, Ping-Jen; Huang, Charles Lung-Cheng; Weng, Shih-Feng; Wu, Ming-Ping; Ho, Chung-Han; Wang, Jhi-Joung; Tsai, Wan-Chi; Hsu, Ya-Wen

2017-10-01

We investigated the longitudinal impacts of insomnia on the subsequent developments of anxiety and depression during a four-year follow-up. We further categorized individuals with insomnia into different insomnia subgroups to examine whether the risk of anxiety and depression varies by subtype. Participants were identified from National Health Insurance enrollees in Taiwan during 2002-2009. The study included 19,273 subjects with insomnia and 38,546 matched subjects without insomnia. All subjects did not have previous diagnosis of insomnia, sleep apnea, anxiety, or depression. Compared with non-insomniacs, insomniacs had a higher risk of developing anxiety only [adjusted hazard ratio (HR) = 8.83, 95% CI = 7.59-10.27], depression only (adjusted HR = 8.48, 95% CI = 6.92-10.39), and both anxiety and depression (adjusted HR = 17.98, 95% CI = 12.65-25.56). When breaking down the insomnia subgroups, individuals with a relapse of insomnia (adjusted HR = 10.42-26.80) had the highest risk of anxiety only, depression only, and both anxiety and depression, followed by persistent insomnia (adjusted HR = 9.82-18.98), then remitted insomnia (adjusted HR = 4.50-8.27). All three insomnia subgroups had a greater four-year cumulative incidence rate than the non-insomnia group for anxiety only, depression only, and both anxiety and depression (p anxiety or/and depression. Awareness of insomnia and treatment of insomnia should be recommended at clinics, and patterns of insomnia should be monitored to help treatment and control of subsequent psychiatric disorders. Future research with comprehensive data collection is needed to identify factors that contribute to different insomnia subtypes. Copyright © 2017 Elsevier B.V. All rights reserved.

Magnetoelectrochemistry of 4,4'-bis(dimethylamino)biphenyl and 4,4'-dinitrobiphenyl azacrown macrocyclic lactams

Energy Technology Data Exchange (ETDEWEB)

Domenech, Antonio [Departament de Quimica Analitica, Universitat de Valencia, Dr. Moliner 50, 46100 Burjassot, Valencia (Spain); Costero, Ana Maria; Banuls, Maria Jose; Aurell, Maria Jose [Departament de Quimica Organica, Universitat de Valencia, Dr. Moliner 50, 46100 Burjassot, Valencia (Spain)

2005-07-25

The voltammetric behaviour at carbon fibre microelectrodes under the application of static magnetic fields of two series of macrolactams containing in their structure 4,4'-bis(dimethylamino)biphenyl or 4,4'-dinitrobiphenyl groups in MeCN solution is described. The response of 4,4'-dinitrobiphenyl receptors is dominated by two successive one-electron reduction processes at -0.9 and -1.6 V versus AgCl/Ag. 4,4'-bis(dimethylamino)biphenyl-containing receptors display two one-electron oxidations above +0.8 and +1.0 V. In both cases, a dihedral/planar interconversion precedes the second electron transfer step. Upon application of moderate (0.05-0.2 T) static magnetic fields to the electrochemical cell, the rate of such dihedral/planar interconversion is lowered for both the reduction of 4,4'-dinitrobiphenyl receptors and the oxidation of 4,4'-bis(dimethylamino)biphenyl lactams. The electrochemical response of N-methylated receptors, for which different cisoid-cisoid, cisoid-transoid, and transoid-transoid forms exist, exhibits a significant peak splitting that can be associated to the presence of such conformational isomers. Application of magnetic fields produces a relative enhancement of some peaks that can be interpreted in terms of differential magnetoconvection involving such conformational isomers. (author)

On phase transitions in NH_{4HSeO4} and ND{4}DSeO{4}

Science.gov (United States)

Dvořák, V.; Quilichini, M.; Le Calvé, N.; Pasquier, B.; Heger, G.; Schweiss, P.

1991-10-01

We propose a hypothetical prototype phase (space group Imm) from which all observed phases in NH{4}HSeO{4} and ND{4}DSeO{4} can be deduced by introducing order parameters of definite symmetries. Following this hypothesis the symmetry of the superionic phase should be P2/n in disagreement with recent experimental results. Free energies of Landau type are derived by means of which particular phase transitions could be described. The large dielectric anomaly near 252 K in NH{4}HSeO{4} is discussed in some detail. The first order phase transition in ND{4}DSeO{4} from the room temperature phase P2{1}2121 into commensurate lock-in phase (with the wave-vector k {z}(0,0, frac{π}{c})) has been investigated by neutron elastic scattering and the symmetry of the latter has been found to be P112{1} in agreement with our theoretical prediction. Nous proposons une phase prototype hypothétique (de groupe d'espace Immm) à partir de laquelle on peut déduire toutes les phases observées dans NH{4}HSeO{4} et ND{4}DSeO{4} par l'introduction de paramètres d'ordre ayant une symétrie définie. D'après cette hypothèse le groupe d'espace de la phase superionique doit être P2/n ce qui est en désaccord avec des résultats expérimentaux récents. Pour chaque transition de phase on écrit l'énergie libre de type Landau à partir de laquelle elle peut être décrite. La grande anomalie diélectrique au voisinage de 252 K dans le composé NH{4}HSeO{4} est discutée de façon détaillée. Dans le composé ND{4}DSeO{4}, nous avons étudié par diffusion élastique de neutrons la transition de phase du premier ordre qui transforme le cristal de la structure P2{1}2121 dans la phase commensurable d'accrochage (de vecteur d'onde k {z}(0,0, frac{π}{c})). Nous avons montré que la symétrie de cette phase est P112{1}, ce qui en accord avec nos prévisions théoriques.

Thermal expansion studies on Th(MoO4)2, Na2Th(MoO4)3 and Na4Th(MoO4)4

International Nuclear Information System (INIS)

Keskar, Meera; Krishnan, K.; Dahale, N.D.

2008-01-01

Thermal expansion behavior of Th(MoO 4 ) 2 , Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 was studied under vacuum in the temperature range of 298-1123 K by high temperature X-ray diffractometer. Th(MoO 4 ) 2 was synthesized by reacting ThO 2 with 2 mol of MoO 3 , at 1073 K in air and Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were prepared by reacting Th(MoO 4 ) 2 with 1 and 2 mol of Na 2 MoO 4 , respectively at 873 K in air. The XRD data of Th(MoO 4 ) 2 was indexed on orthorhombic system where as XRD data of Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were indexed on tetragonal system. The lattice parameters and cell volume of all the three compounds, fit into polynomial expression with respect to temperature, showed positive thermal expansion (PTE) up to 1123 K. The average value of thermal expansion coefficients for Th(MoO 4 ) 2 , Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were determined from the high temperature data

12 CFR 4.4 - Washington office.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Washington office. 4.4 Section 4.4 Banks and... EXAMINERS Organization and Functions § 4.4 Washington office. The Washington office of the OCC is the main office and headquarters of the OCC. The Washington office directs OCC policy, oversees OCC operations...

Effect of a 188 Re-SSS lipiodol/131I-lipiodol mixture, 188 Re-SSS lipiodol alone or 131I-lipiodol alone on the survival of rats with hepatocellular carcinoma.

Science.gov (United States)

Garin, Elienne; Rakotonirina, Hervé; Lejeune, Florence; Denizot, Benoit; Roux, Jerome; Noiret, Nicolas; Mesbah, Habiba; Herry, Jean-Yues; Bourguet, Patrick; Lejeune, Jean-Jacques

2006-04-01

It has been shown that the use of a cocktail of isotopes of different ranges of action leads to an increase in the effectiveness of metabolic radiotherapy. The purpose of the present study was to compare with a control group the effectiveness of three different treatments in rats bearing hepatocellular carcinoma (HCC), using (1) a mixture of lipiodol labelled with both I and Re, (2) lipiodol labelled with I alone and (3) lipiodol labelled with Re alone. Four groups were made up, each containing 14 rats with the N1-S1 tumour cell line. Group 1 received a mixture composed of 22 MBq of Re-SSS lipiodol and 7 MBq I-lipiodol. Group 2 received 14 MBq I-lipiodol. Group 3 received 44 MBq of Re-SSS lipiodol and group 4 acted as the control. The survival of the various groups was compared by a non-parametric test of log-rank, after a follow-up of 60, 180 and 273 days. Compared with the controls, the rats treated with a mixture of Re-SSS lipiodol and I-lipiodol show an increase in survival, but only from day 60 onwards (P=0.05 at day 60 and 0.13 at days 180 and 273). For the rats treated with I-lipiodol, there was a highly significant increase in survival compared with the controls at day 60, day 180 and day 273 (P=0.03, 0.04 and 0.04, respectively). There is no significant increase in survival for the rats treated with Re-SSS lipiodol, irrespective of the follow-up duration (P=0.53 at day 60, 0.48 at day 180, and 0.59 at day 273). In this study, I-lipiodol is the most effective treatment in HCC-bearing rats, because this is the only method that leads to a prolonged improvement of survival. These results cannot necessarily be extrapolated to humans because of the relatively small size and unifocal nature of the lesions in this study. It appears necessary to carry out a study in humans with larger tumours in order to compare these three treatments, particularly with a view to replacing I-labelled lipiodol by Re-labelled lipiodol. However, this study clearly demonstrated that

7 CFR 273.2 - Office operations and application processing.

Science.gov (United States)

2010-01-01

... reservations, households with adult members who are not proficient in English, and households with earned... knowledge that the member in question is a U.S. citizen or non-citizen national. The signed statement must... because a household fits a profile of an error-prone household does not constitute lack of verification...

7 CFR 273.12 - Requirements for change reporting households.

Science.gov (United States)

2010-01-01

... issue a supplementary ATP for the amount of the increase by June 10. (iii) The State agency may elect to...; (iii) Changes in residence and the resulting change in shelter costs; (iv) The acquisition of a... recertification. (iii) Failure to file a complete form by the specified filing date. If a household fails to file...

14 CFR 21.273 - Airworthiness certificates other than experimental.

Science.gov (United States)

2010-01-01

... TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS Delegation Option Authorization... airworthiness certificate for aircraft manufactured under a delegation option authorization if he finds, on the... authorize any employee to sign airworthiness certificates if that employee— (1) Performs, or is in direct...

All projects related to | Page 273 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2012-01-10

The Fifth International Conference on Information and Communication Technologies and Development (ICTD2012) will take place 12-15 March 2012 at the Georgia Institute of Technology (Georgia Tech) in Atlanta, USA. Start Date: January 10, 2012. End Date: January 10, 2013. Topic: RESEARCH RESULTS ...

BKR 27(3) pp. 123-128 (Lakshmikanth et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-09-30

Sep 30, 2015 ... An International Journal of the Nigerian Society for Experimental Biology ... Department of Studies in Biochemistry, University of Mysore, Manasagangothri, Mysore – 570 006,. India ... many simple and rapid colorimetric methods of protein .... Samples of 1 and 2 µg of BSA and apparently purified BLP.

The 4s24p3-4s4p4 transition in AsI-like AgXV

International Nuclear Information System (INIS)

Dong Chenzhong; Zhao Jinbao

1992-01-01

Some terms of the 4s 4p 4 configuration in RuXII, RhXIII and PdXIV ions can be improved and all the energy values of the configuration in AgXV can be predicted theoretically by means of a configuration-interaction ab initio analysis for the level structure of the 4s 4p 4 configuration along the AsI sequence of KrIV-AgXV ions. Calculations of the wavelengths and oscillator strenghts are presented for the 4s 2 4p 3 -4s 4p 4 transition in AgXV. (orig.)

The ternary system K2SO4MgSO4CaSO4

Science.gov (United States)

Rowe, J.J.; Morey, G.W.; Silber, C.C.

1967-01-01

Melting and subsolidus relations in the system K2SO4MgSO4CaSO4 were studied using heating-cooling curves, differential thermal analysis, optics, X-ray diffraction at room and high temperatures and by quenching techniques. Previous investigators were unable to study the binary MgSO4CaSO4 system and the adjacent area in the ternary system because of the decomposition of MgSO4 and CaSO4 at high temperatures. This problem was partly overcome by a novel sealed-tube quenching method, by hydrothermal synthesis, and by long-time heating in the solidus. As a result of this study, we found: (1) a new compound, CaSO4??3MgSO4 (m.p. 1201??C) with a field extending into the ternary system; (2) a high temperature form of MgSO4 with a sluggishly reversible inversion. An X-ray diffraction pattern for this polymorphic form is given; (3) the inversion of ??-CaSO4 (anhydrite) to ??-CaSO4 at 1195??C, in agreement with grahmann; (1) (4) the melting point of MgSO4 is 1136??C and that of CaSO4 is 1462??C (using sealed tube methods to prevent decomposition of the sulphates); (5) calcium langbeinite (K2SO4??2CaSO4) is the only compound in the K2SO4CaSO4 binary system. This resolved discrepancies in the results of previous investigators; (6) a continuous solid solution series between congruently melting K2SOP4??2MgSO4 (langbeinite) and incongruently melting K2SO4??2CaSO4 (calcium langbeinite); (7) the liquidus in the ternary system consists of primary phase fields of K2SO4, MgSO4, CaSO4, langbeinite-calcium langbeinite solid solution, and CaSO4??3MgSO4. The CaSO4 field extends over a large portion of the system. Previously reported fields for the compounds (K2SO4??MgSO4??nCaSO4), K2SO4??3CaSO4 and K2SO4??CaSO4 were not found; (8) a minimum in the ternary system at: 740??C, 25% MgSO4, 6% CaSO4, 69% K2SO4; and ternary eutectics at 882??C, 49% MgSO4, 19% CaSO4, 32% K2SO4; and 880??, 67??5% MgSO4, 5% CaSO4, 27??5% K2SO4. ?? 1967.

Placenta praevia: review of clinical presentation and management in a Nigerian teaching hospital.

Science.gov (United States)

Ikechebelu, J I; Onwusulu, D N

2007-01-01

The study aims at reviewing the clinical presentation and management of placenta praevia in a tertiary health facility. This is a retrospective study of 59 cases of placenta praevia managed at the Nnamdi Azikiwe University Teaching Hospital, Nnewi from January 1997 to December 2001. The case records of 44 of the patients were obtained from the hospital medical records department and analysed. During the five year period, there were 3565 deliveries and 59 cases of placenta praevia giving an incidence of 1.65%. Thirty four (77.3%) occurred in women aged 35 years and below. The commonest was type 111 (12 cases; 27.3%) followed by type IV (10 cases; 22.7%). Previous uterine scar was associated with 22 (50.0%) cases. Age had no statistically significant effect on the prevalence. The commonest GA range at presentation (13; 29.6%) and at delivery (18; 40.9%) was 37-40 weeks. The commonest mode of presentation was antepartum haemorrhage (34; 77.3%) followed by abnormal lie and malpresentation (4 each; 9.1%). The average admission delivery interval was one week in 33 (75.0%) cases and only two (4.5%) received blood transfusion. Forty (90.9%) women had caesarean delivery while 12 (27.3%) babies were of low birth weight. There were only 2 (4.5%) fetal deaths and one (2.3%) caesarean hysterectomy. The commonest predisposing factor to placenta praevia in this study is previous uterine scar. Judicious use of caesarean section especially in the primigravida will help reduce the incidence of placenta praevia. Also a screening ultrasonography at 34-36 weeks gestation (especially in women with previously scarred uterus) is recommended.

Synthesis of leukotrienes labelled with deuterium: [11,12,14,15-2H4]-LTA4, -LTC4, -LTD4 and -LTE4

International Nuclear Information System (INIS)

Lellouche, J.P.; Aubert, F.; Noel, J.P.; Boullais, C.; Beaucourt, J.P.

1989-01-01

Semi-hydrogenation by D 2 gas on Lindlar catalyst of an acetylenic precursor led to [11,12,14,15- 2 H 4 ]-LTA 4 methyl ester. Nucleophilic opening of the epoxide ring by amino thioacids accorded, after saponification, the corresponding deuterated peptidoleukotrienes LTC 4 , LTD 4 and LTE 4 . (author)

Variants at multiple loci implicated in both innate and adaptive immune responses are associated with Sjögren’s syndrome

OpenAIRE

Lessard, Christopher J.; Li, He; Adrianto, Indra; Ice, John A.; Rasmussen, Astrid; Grundahl, Kiely M.; Kelly, Jennifer A.; Dozmorov, Mikhail G.; Miceli-Richard, Corinne; Bowman, Simon; Lester, Sue; Eriksson, Per; Eloranta, Maija-Leena; Brun, Johan G.; Gøransson, Lasse G.

2013-01-01

Sjögren’s syndrome is a common autoimmune disease (~0.7% of European Americans) typically presenting as keratoconjunctivitis sicca and xerostomia. In addition to strong association within the HLA region at 6p21 (Pmeta =7.65×10−114), we establish associations with IRF5-TNPO3 (Pmeta =2.73×10−19), STAT4 (Pmeta =6.80×10−15), IL12A (Pmeta =1.17×10−10), FAM167A-BLK (Pmeta =4.97×10−10), DDX6-CXCR5 (Pmeta =1.10×10−8), and TNIP1 (Pmeta =3.30×10−8). Suggestive associations with Pmeta ...

CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

Directory of Open Access Journals (Sweden)

Ana Arenillas

2013-10-01

Full Text Available Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar and capacities (>2 mmol·g−1 at 273 K. Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes.

CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

Science.gov (United States)

Bermúdez, José M.; Dominguez, Pablo Haro; Arenillas, Ana; Cot, Jaume; Weber, Jens; Luque, Rafael

2013-01-01

Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar) and capacities (>2 mmol·g−1 at 273 K). Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes. PMID:28788352

Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place, FY83, Part 2 (Gillespie Delorenzo Asla & Assocs-Planning Analysis Corp).

Science.gov (United States)

1983-01-01

BURLINGTON MASS 85 85 85 85 N L AVIATION LTD UN KINGDOM 2,558 273 2,285 2,556 273 2,285 M L ENERGIA INC PRINCETON NEW JERSEY 28 28 28 28 M M L...155 155 PIPE INC PORTSMOUTH VIRGINIA 588 588 743 743 PIPE INSTALLATION CORP ATCO ILw jE6EY 42 42 42 42 PIPELINE RENOVATION SERVICE INC FORT BRAGG NCAR...107 107 PIPELINE RENOVATION SERVICE INC LANGLEY AFB VIRGINIA 205 161 44 PIPELINE RENOVATION SERVICE INC NORFOLK VIRGINIA 248 248 560 268 248 44

The new barium zinc mercurides Ba3ZnHg10 and BaZn0.6Hg3.4 – Synthesis, crystal and electronic structure

International Nuclear Information System (INIS)

Schwarz, Michael; Wendorff, Marco; Röhr, Caroline

2012-01-01

The title compounds Ba 3 ZnHg 10 and BaZn 0.6 Hg 3.4 were synthesized from stoichiometric ratios of the elements in Ta crucibles. Their crystal structures, which both represent new structure types, have been determined using single crystal X-ray data. The structure of Ba 3 ZnHg 10 (orthorhombic, oP28, space group Pmmn, a=701.2(3), b=1706.9(8), c=627.3(3)pm, Z=2, R1=0.0657) contains folded 4 4 Hg nets, where the meshes form the bases of flat rectangular pyramids resembling the structure of BaAl 4 . The flat pyramids are connected via Hg–Zn/Hg bonds, leaving large channels at the folds, in which Ba(1) and Hg(2) atoms alternate. Whereas the remaining Hg/Zn atoms form a covalent 3D network of three- to five-bonded atoms with short M–M distances (273–301 pm; CN 9–11), the Hg(2) atoms in the channels adopt a comparatively large coordination number of 12 and increased distances (317–348 pm) to their Zn/Hg neighbours. In the structure of BaZn 0.6 Hg 3.4 (cubic, cI320, space group I4 ¯ 3d, a=2025.50(7) pm, Z=64, R1=0.0440), with a chemical composition not much different from that of Ba 3 ZnHg 10 , the Zn/Hg atoms of the mixed positions M(1/2) are arranged in an slightly distorted primitive cubic lattice with a 4×4×4 subcell relation to the unit cell. The 24 of the originating 64 cubes contain planar cis tetramers Hg(5,6) 4 with Hg in a nearly trigonal planar or tetrahedral coordination. In another 24 of the small cubes, two opposing faces are decorated by Hg(3,4) 2 dumbbells, two by Ba(2) atoms respectively. The third type of small cubes are centered by Ba(1) atoms only. The complex 3D polyanionic Hg/Zn network thus formed is compared with the Hg partial structure in Rb 3 Hg 20 applying a group-subgroup relation. Despite their different overall structures, the connectivity of the negatively charged Hg atoms, the rather metallic Zn bonding characteristic (as obtained from FP-LAPW band structure calculations) and the coordination number of 16 for all Ba cations

Glutathionylation of Yersinia pestis LcrV and Its Effects on Plague Pathogenesis.

Science.gov (United States)

Mitchell, Anthony; Tam, Christina; Elli, Derek; Charlton, Thomas; Osei-Owusu, Patrick; Fazlollahi, Farbod; Faull, Kym F; Schneewind, Olaf

2017-05-16

Glutathionylation, the formation of reversible mixed disulfides between glutathione and protein cysteine residues, is a posttranslational modification previously observed for intracellular proteins of bacteria. Here we show that Yersinia pestis LcrV, a secreted protein capping the type III secretion machine, is glutathionylated at Cys 273 and that this modification promotes association with host ribosomal protein S3 (RPS3), moderates Y. pestis type III effector transport and killing of macrophages, and enhances bubonic plague pathogenesis in mice and rats. Secreted LcrV was purified and analyzed by mass spectrometry to reveal glutathionylation, a modification that is abolished by the codon substitution Cys 273 Ala in lcrV Moreover, the lcrV C273A mutation enhanced the survival of animals in models of bubonic plague. Investigating the molecular mechanism responsible for these virulence attributes, we identified macrophage RPS3 as a ligand of LcrV, an association that is perturbed by the Cys 273 Ala substitution. Furthermore, macrophages infected by the lcrV C273A variant displayed accelerated apoptotic death and diminished proinflammatory cytokine release. Deletion of gshB , which encodes glutathione synthetase of Y. pestis , resulted in undetectable levels of intracellular glutathione, and we used a Y. pestis Δ gshB mutant to characterize the biochemical pathway of LcrV glutathionylation, establishing that LcrV is modified after its transport to the type III needle via disulfide bond formation with extracellular oxidized glutathione. IMPORTANCE Yersinia pestis , the causative agent of plague, has killed large segments of the human population; however, the molecular bases for the extraordinary virulence attributes of this pathogen are not well understood. We show here that LcrV, the cap protein of bacterial type III secretion needles, is modified by host glutathione and that this modification contributes to the high virulence of Y. pestis in mouse and rat

Phytoplankton and bacterial community structures and their interaction during red-tide phenomena

Science.gov (United States)

Ismail, Mona Mohamed; Ibrahim, Hassan Abd Allah

2017-09-01

Phytoplankton and bacteria diversity were studied before, during and after red tide phenomena during spring season 2015 in the Eastern Harbour (E.H.) of Alexandria, Egypt. Fifty five species of phytoplankton were identified and represented different distinct classes "Bacillariophyceae; Dinophyceae, Chlorophyceae, Cyanophyceae and Eugelenophyceae". Also, Diatom formed the most dominant group. The average number of the phytoplankton density varied from 4.8 × 104 to 1.1 × 106 cell l-1 during the study period and Skeletonema costatum was the agent causing the red tide. The existence percentages of bacteria ranged from 2.6 to 17.9% on all media tested. The bacterial isolates on the nutrient agar medium represented the highest existence with a total percentage of 43.6%, followed by MSA medium (25.7%), while the lowest percentage was for the AA medium at 7.8%. However, twelve isolates were selected as representative for bacterial community during study interval. Based on the morphological, biochemical, physiological and enzymatic characteristics, the bacterial strains were described. Depending on the 16S rDNA gene sequence, three common antagonists were aligned as: Vibrio toranzoniae strain Vb 10.8, Ruegeria pelagia strain NBRC 102038 and Psychrobacter adeliensis strain DSM 15333. The interaction between these bacteria and S. costatum was studied. The growth of S. costatum was significantly lower whenever each bacterium was present as compared to axenic culture. More specifically, 30% (v/v) of the all tested bacteria showed the strongest algicidal activities, as all S. costatum cells were killed after two days. 10% of R. pelagia and P. adeliensis also showed significant algicidal activities within six days.

Isotopic effect in phase transitions of (NH4)2HPO4 and (ND4)2DPO4

International Nuclear Information System (INIS)

Diosa, J.E.; Coral, E.E.; Vargas, R.A.

1996-01-01

Specific heat and dielectric constant measurements at low frequency, have shown two transitions in the ionic systems (NH4)2HPO4 and (ND4)2DPO4 bellow 300 K. For (NH4)2HPO4, the transition are observed at 174 K and 246 K, while (ND4)2DPO4, they are observed at 147 K and 229 K. We have also found a shift of the transition temperatures to smaller values when the hydrogen is replaced by deuterium. The specific heat anomalies associated with these transitions are reversible in successive thermal cycles (heating and cooling) and we did not detect latent heat through them. Furthermore, we have detected anomalies in the dielectric constant in the same transition points. We have attributed these transition phases to reorientations of the tetrahedra of NH4 and ND4, so that the activation energy Ea for these process that we associated with the thermal energy KBTt required for the transition, is inversely related to the mass of the hydrogen isotope

Synthesis of cyclophosphamide-4,4,5,5-d4

International Nuclear Information System (INIS)

Walsh, S.P.; Chang, Y.H.; Ludeman, S.M.

1995-01-01

3-Hydroxypropionitrile was subjected to a base-catalyzed exchange reaction in D 2 O which provided 2,2-dideuterio-3-deuteroxypropionitrile (DOCH 2 CD 2 CN) in 70% yield. Reduction of the nitrile with LiAID 4 gave 3-amino-2,2,3,3-tetradeuteriopropan-1-ol (HOCH 2 CD 2 CD 2 NH 2 ) in a crude yield of 71%. Reaction of this intermediate with N,N-bis(2-chloroethyl)phosphoramidic dichloride [Cl 2 P(O)N(CH 2 CH 2 Cl) 2 ] followed by the combination of those chromatography fractions which contained only pure material gave cyclophosphamide-4,4,5,5-d 4 as a white oil in 13% yield. A portion of this oil was converted to the monohydrate by the addition of water (1.1 equivalents) and crystallization from ether/petroleum ether (62% yield). For the hydrate, MS analyses gave an average mole percent enrichment (with average deviation over 5 determinations) of 89.1 ± 0.5% d 4 . (author)

[H3N(CH2)4NH3]2[Al4(C2O4)(H2PO4)2(PO4)4].4[H2O]: A new layered aluminum phosphate-oxalate

International Nuclear Information System (INIS)

Peng Li; Li Jiyang; Yu Jihong; Li Guanghua; Fang Qianrong; Xu Ruren

2005-01-01

A new layered inorganic-organic hybrid aluminum phosphate-oxalate [H 3 N(CH 2 ) 4 NH 3 ] 2 [Al 4 (C 2 O 4 )(H 2 PO 4 ) 2 (PO 4 ) 4 ].4[H 2 O](AlPO-CJ25) has been synthesized hydrothermally, by using 1,4-diaminobutane (DAB) as structure-directing agent. The structure has been solved by single-crystal X-ray diffraction analysis and further characterized by IR, 31 P MAS NMR, TG-DTA as well as compositional analyses. Crystal data: the triclinic space group P-1, a=8.0484(7) A, b=8.8608(8) A, c=13.2224(11) A, α=80.830(6) deg. , β=74.965(5) deg. , γ=78.782(6) deg. , Z=2, R 1[ I >2 σ ( I )] =0.0511 and wR 2(alldata) =0.1423. The alternation of AlO 4 tetrahedra and PO 4 tetrahedra gives rise to the four-membered corner-sharing chains, which are interconnected through AlO 6 octahedra to form the layered structure with 4,6-net sheet. Interestingly, oxalate ions are bis-bidentately bonded by participating in the coordination of AlO 6 , and bridging the adjacent AlO 6 octahedra. The layers are held with each other through strong H-bondings between the terminal oxygens. The organic ammonium cations and water molecules are located in the large cavities between the interlayer regions. -- Graphical abstract: The alternation of AlO 4 tetrahedra and PO 4 tetrahedra gives rise to the four-membered corner-sharing chains, which are interconnected through AlO 6 octahedra to form the layered structure with 4,6-net sheet. Oxalate ions are bis-bidentately boned by participating in the coordination of AlO 6 , and bridging the adjacent AlO 6 octahedra

X-ray magnetic circular dichroism study of epitaxial magnetite ultrathin film on MgO(100)

Energy Technology Data Exchange (ETDEWEB)

Liu, W. Q.; Xu, Y. B., E-mail: yongbing.xu@york.ac.uk, E-mail: rzhang@nju.edu.cn [York-Nanjing International Center for Spintronics (YNICS), School of Electronics Science and Engineering, Nanjing University, Nanjing 210093 (China); Spintronics and Nanodevice Laboratory, Department of Electronics, University of York, York YO10 5DD (United Kingdom); Song, M. Y.; Lin, J. G. [Center for Condensed Matter Sciences, National Taiwan University, Taipei 106, Taiwan (China); Maltby, N. J.; Li, S. P. [Spintronics and Nanodevice Laboratory, Department of Electronics, University of York, York YO10 5DD (United Kingdom); Samant, M. G.; Parkin, S. S. P. [IBM Research Division, Almaden Research Center, San Jose, California 95120 (United States); Bencok, P.; Steadman, Paul; Dobrynin, Alexey [Diamond Light Source, Didcot OX11 0DE (United Kingdom); Zhang, R., E-mail: yongbing.xu@york.ac.uk, E-mail: rzhang@nju.edu.cn [York-Nanjing International Center for Spintronics (YNICS), School of Electronics Science and Engineering, Nanjing University, Nanjing 210093 (China)

2015-05-07

The spin and orbital magnetic moments of the Fe{sub 3}O{sub 4} epitaxial ultrathin film synthesized by plasma assisted simultaneous oxidization on MgO(100) have been studied with X-ray magnetic circular dichroism. The ultrathin film retains a rather large total magnetic moment, i.e., (2.73 ± 0.15) μ{sub B}/f.u., which is ∼70% of that for the bulk-like Fe{sub 3}O{sub 4}. A significant unquenched orbital moment up to 0.54 ± 0.05 μ{sub B}/f.u. was observed, which could come from the symmetry breaking at the Fe{sub 3}O{sub 4}/MgO interface. Such sizable orbital moment will add capacities to the Fe{sub 3}O{sub 4}-based spintronics devices in the magnetization reversal by the electric field.

Sigma models in (4,4) harmonic superspace

International Nuclear Information System (INIS)

Ivanov, E.; Joint Inst. for Nuclear Research, Dubna; Sutulin, A.

1994-04-01

We define basics of (4,4) 2D harmonic superspace with two independent sets of SU(2) harmonic variables and apply it to construct new superfield actions of (4,4) supersymmetric two-dimensional sigma models with torsion and mutually commuting left and right complex structures, as well as of their massive deformations. We show that the generic off-shell sigma model action is the general action of constrained analytic superfields q (1,1) representing twisted N=4 multiplets in (4,4) harmonic superspace. The massive term of q (1,1) is shown to be unique; it generates a scalar potential the form of which is determined by the metric on the target bosonic manifold. We discuss in detail (4,4) supersymmetric group manifold SU(2)xU(1) WZNW sigma model and its Liouville deformation. A deep analogy of the relevant superconformally invariant analytic superfield action to that of the improved tensor N=2 4D multiplet is found. We define (4,4) duality transformation and find new off-shell dual representations of the previously constructed actions via unconstrained analytic (4,4) superfields. The main peculiarities of the (4,4) duality transformation are: (i) It preserves manifest (4,4) supersymmetry; (ii) dual actions reveal a gauge invariance needed for the onshell equivalence to the original description; (iii) in the actions dual to the massive ones 2D supersymmetry is modified off shell by SU(2) tensor central charges. The dual representation suggests some hints of how to describe (4,4) models with non-commuting complex structures in the harmonic superspace. (orig.)

Crystal structures of 4-methoxy-N-(4-methylphenylbenzenesulfonamide and N-(4-fluorophenyl-4-methoxybenzenesulfonamide

Directory of Open Access Journals (Sweden)

Vinola Z. Rodrigues

2015-11-01

Full Text Available Crystal structures of two N-(arylarylsulfonamides, namely, 4-methoxy-N-(4-methylphenylbenzenesulfonamide, C14H15NO3S, (I, and N-(4-fluorophenyl-4-methoxybenzenesulfonamide, C13H12FNO3S, (II, were determined and analyzed. In (I, the benzenesulfonamide ring is disordered over two orientations, in a 0.516 (7:0.484 (7 ratio, which are inclined to each other at 28.0 (1°. In (I, the major component of the sulfonyl benzene ring and the aniline ring form a dihedral angle of 63.36 (19°, while in (II, the planes of the two benzene rings form a dihedral angle of 44.26 (13°. In the crystal structure of (I, N—H...O hydrogen bonds form infinite C(4 chains extended in [010], and intermolecular C—H...πaryl interactions link these chains into layers parallel to the ab plane. The crystal structure of (II features N—H...O hydrogen bonds forming infinite one dimensional C(4 chains along [001]. Further, a pair of C—H...O intermolecular interactions consolidate the crystal packing of (II into a three-dimensional supramolecular architecture.

The ecological importance of severe wildfires: some like it hot.

Science.gov (United States)

Hutto, Richard L

2008-12-01

Many scientists and forest land managers concur that past fire suppression, grazing, and timber harvesting practices have created unnatural and unhealthy conditions in the dry, ponderosa pine forests of the western United States. Specifically, such forests are said to carry higher fuel loads and experience fires that are more severe than those that occurred historically. It remains unclear, however, how far these generalizations can be extrapolated in time and space, and how well they apply to the more mesic ponderosa pine systems and to other forest systems within the western United States. I use data on the pattern of distribution of one bird species (Black-backed Woodpecker, Picoides arcticus) as derived from 16465 sample locations to show that, in western Montana, this bird species is extremely specialized on severely burned forests. Such specialization has profound implications because it suggests that the severe fires we see burning in many forests in the Intermountain West are not entirely "unnatural" or "unhealthy." Instead, severely burned forest conditions have probably occurred naturally across a broad range of forest types for millennia. These findings highlight the fact that severe fire provides an important ecological backdrop for fire specialists like the Black-backed Woodpecker, and that the presence and importance of severe fire may be much broader than commonly appreciated.

DINUCLEAR NICKEL(II PIVALATE WITH µ-AQUA AND DI-µ-PIVALATO BRIDGES SHOWING A FERROMAGNETIC INTERACTION

Directory of Open Access Journals (Sweden)

Masahiro Mikuriya

2014-12-01

Full Text Available Dinuclear nickel(II complex, [Ni2{O2CC(CH33}4(OH2{HO2CC(CH33}4] (1, was synthesized and characterized by elemental analysis, IR and UV-Vis-NIR spectroscopy, and temperature dependence of magnetic susceptibilities (4.5—300 K. Single-crystal X-ray crystallography revealed a dinuclear core with µ-aqua and di-µ-pivalato bridges having monodentate pivalato and monodentate pivalic acid molecules. Magnetic data analysis showed a ferromagnetic interactions between the two nickel atoms with g = 2.251, J = 2.78 cm−1, D = 3.75 cm–1, and tip = 184 x 10–6 cm3 mol–1; g = 2.253, J = 2.73 cm−1, D = –3.26 cm–1, and tip = 176 x 10–6 cm3 mol–1.

[Effects of Citric Acid on Activation and Methylation of Mercury in the Soils of Water-Level-Fluctuating Zone of the Three Gorges.Reservoir].

Science.gov (United States)

Qin, Cai-qing; Liang, Li; You, Rui; Deng, Han; Wang, Ding-yong

2015-12-01

To investigate effects of the main component of vegetation root exudates-citric acid on activation and methylation of mercury in the soil of water-level-fluctuating zone (WLFZ) of the Three Gorges Reservoir area, simulation experiments were conducted by extracting and cultivating soil with different concentrations of citric acid. The results showed that after adding citric acid, the total mercury content in leaching solution before reaching peak were higher than that of the control, and increased with the increase of citric acid concentrations. The maximum amount of mercury complexes increased initially and then reached plateaus with the percentage against the total mercury in soil of 1.03%, 1.67%, 1.99%, 2.47%, 2.68%, 2.73% and 2.73% for different citric acid concentrations (0, 1, 2, 4, 5, 6 and 8 mmol · L⁻¹). In addition, concentrations of methylmercury ( MeHg) in soil remained stable in the first 3 hours, and then increased accompanying with the increasing rate rising with the concentration of citric acid ( besides the control group) . This result indicated that citric acid probably could promote the transformation process from inorganic mercury to MeHg in soil. which increased with the concentration of citric acid.

Smoking prevalence increases following Canterbury earthquakes.

Science.gov (United States)

Erskine, Nick; Daley, Vivien; Stevenson, Sue; Rhodes, Bronwen; Beckert, Lutz

2013-01-01

A magnitude 7.1 earthquake hit Canterbury in September 2010. This earthquake and associated aftershocks took the lives of 185 people and drastically changed residents' living, working, and social conditions. To explore the impact of the earthquakes on smoking status and levels of tobacco consumption in the residents of Christchurch. Semistructured interviews were carried out in two city malls and the central bus exchange 15 months after the first earthquake. A total of 1001 people were interviewed. In August 2010, prior to any earthquake, 409 (41%) participants had never smoked, 273 (27%) were currently smoking, and 316 (32%) were ex-smokers. Since the September 2010 earthquake, 76 (24%) of the 316 ex-smokers had smoked at least one cigarette and 29 (38.2%) had smoked more than 100 cigarettes. Of the 273 participants who were current smokers in August 2010, 93 (34.1%) had increased consumption following the earthquake, 94 (34.4%) had not changed, and 86 (31.5%) had decreased their consumption. 53 (57%) of the 93 people whose consumption increased reported that the earthquake and subsequent lifestyle changes as a reason to increase smoking. 24% of ex-smokers resumed smoking following the earthquake, resulting in increased smoking prevalence. Tobacco consumption levels increased in around one-third of current smokers.

Potential of neurotoxicity after a single oral dose of 4-bromo-, 4-chloro-, 4-fluoro- or 4-iodoaniline in rats.

Science.gov (United States)

Okazaki, Yoshimasa; Yamashita, Kotaro; Ishii, Hiroyuki; Sudo, Masato; Tsuchitani, Minoru

2003-01-01

The potential for neurotoxicity after a single oral dose of four halogenated aniline derivatives--4-bromoaniline (4-BA), 4-chloroaniline (4-CA), 4- fluoroaniline (4-FA) and 4-iodoaniline (4-IA)--was given to rats was investigated at or near the lethal dosage level. Hindlimb paralysis was found in the 4-BA, 4-CA and 4-FA groups on clinical observation, with the maximum incidence of 100% in the 4-BA and 4-FA groups and 66.7% in the 4-CA group. Detailed clinical observations with functional tests identified the following effects: reduced response of hindlimb extensor thrust, gait abnormality in the open field and decreased grip strength in the fore- or hindlimbs in the 4-BA, 4-CA and 4-FA groups; decreased number of supported rearing episodes in the open field in the 4-BA and 4-CA groups; abnormal landing in the aerial righting reflex in the 4-BA and 4-FA groups; and prolonged surface righting reflex in the 4-BA group. Spongy change in the white matter of the spinal cord and brainstem and nerve fibre degeneration in the peripheral nerves were found in all haloaniline-treated groups. The central and peripheral nervous systems were most severely affected in the 4-BA group and the lesions in the 4-IA group were limited in grade. This study demonstrates that a bolus dose of 4-haloanilines to rats induces a neurotoxicity similar in character to that evoked by the parent aniline. The decreasing order of neurotoxic potential appears to be 4-BA > 4-FA > or = 4-CA > 4-IA when comparing at or near the lethal dosage level. Copyright 2003 John Wiley & Sons, Ltd.

Poly[bis[μ-4-(4-carboxyphenoxybenzoato](μ-4,4′-oxydibenzoatobis[μ-3-(pyridin-4-yl-5-(pyridin-3-yl-1H-1,2,4-triazole]dicadmium(II

Directory of Open Access Journals (Sweden)

Xiao-Jin Qi

2016-07-01

Full Text Available Three kinds of bridging ligands, 4,4′-oxydibenzoate, 4-(4-carboxyphenoxybenzoate and 3-(pyridin-4-yl-5-(pyridin-3-yl-1H-1,2,4-triazole, link the CdII cations to form the title polymeric complex, [Cd2(C14H8O5(C14H9O52(C12H9N52]n, in which each CdII cation is in a distorted N2O5 pentagonal–bipyramidal coordination geometry. The 4,4′-oxydibenzoate dianion exhibits point group symmetry 2, with the central O atom located on a twofold rotation axis. Classical N—H...O, O—H...N hydrogen bonds and weak C—H...O hydrogen bonds link the complex molecules into a three-dimensional supramolecular architecture. A solvent-accessible void of 53 (2 Å3 is observed, but no solvent molecule could reasonably located there.

U4+ spectroscopic properties in Dsub(2d) with ThCl4, UCl4 and ThSiO4

International Nuclear Information System (INIS)

Khan Malek, C.

1985-01-01

This thesis is concerned with the study of the electronic structure of the tetravalent actinide ions in solid state. The technique used was high resolution optical spectroscopy. We deal with the U 4+ ion (sf 2 ) in the monocrystals ThCl 4 , UCl 4 , and ThSiO 4 where the U 4+ ion is substituded for the Th 4+ ion by doping. Visible and infrared optical spectra were recorded between 300 and 4.2K. With these three compounds, it is possible to compare the influence of different environments of Dsub(2d) symmetry: real symmetry for U 4+ in UCl 4 and ThSiO 4 ; approximate symmetry in ThCl 4 , whose structure is incommensurate and modulated at low temperature. The fitting of the data was carried out by diagonalizing the hamiltonian which describes the interactions of the U 4+ ion in a crystal field with its environment. This fitting procedure led to a coherent set of spectroscopic parameters. The fluorescence of U 4+ was observed in ThCl 4 and ThSiO 4 and the effect of the incommensurate structure of ThCl 4 on the optical spectra was studied. The symmetry of the U 4+ sites was identified by site selective excitation experiments and a relationship between the incommensurate structure and the lifetime of U 4+ energy levels was found. In conclusion, the U 4+ energy levels in a relatively low crystal field were determined for compounds that have a similar coordination polyhedron about the actinide ion. The values for these energy levels were then compared to those of lanthanide and 3d elements [fr

4-[4-(4-Fluorophenyl-2-methyl-5-oxo-2,5-dihydroisoxazol-3-yl]-1-methylpyridinium iodide–4-[3-(4-fluorophenyl-2-methyl-5-oxo-2,5-dihydroisoxazol-4-yl]-1-methylpyridinium iodide (0.6/0.4

Directory of Open Access Journals (Sweden)

Simona Margutti

2008-01-01

Full Text Available The crystal structure of the title compound, C16H16FN2O2+·I−, was determined as part of a study of the biological activity of isoxazolone derivatives as p38 mitogen-activated protein kinase (MAPK inhibitors. The X-ray crystal structure of 4-[4-(4-fluorophenyl-2-methyl-5-oxo-2,5-dihydroisoxazol-3-yl]-1-methylpyridinium iodide showed the presence of the regioisomer 4-[3-(4-fluorophenyl-2-methyl-5-oxo-2,5-dihydroisoxazol-4-yl]-1-methylpyridinium iodide. The synthesis of the former compound was achieved by reacting 4-(4-fluorophenyl-3-(4-pyridylisoxazol-5(2H-one after treatment with Et3N in dimethylformamide, with iodomethane. The unexpected formation of the regioisomer could be explained by a rearrangement occurring via aziridine of the isoxazolone compound. The regioisomers have site occupancies of 0.632 (4/0.368 (4. The two six members rings make a dihedral angle of 66.8 (2°.

Ankyrin repeat and SOCS box containing protein 4 (Asb-4 colocalizes with insulin receptor substrate 4 (IRS4 in the hypothalamic neurons and mediates IRS4 degradation

Directory of Open Access Journals (Sweden)

Xia Zefeng

2011-09-01

Full Text Available Abstract Background The arcuate nucleus of the hypothalamus regulates food intake. Ankyrin repeat and SOCS box containing protein 4 (Asb-4 is expressed in neuropeptide Y and proopiomelanocortin (POMC neurons in the arcuate nucleus, target neurons in the regulation of food intake and metabolism by insulin and leptin. However, the target protein(s of Asb-4 in these neurons remains unknown. Insulin receptor substrate 4 (IRS4 is an adaptor molecule involved in the signal transduction by both insulin and leptin. In the present study we examined the colocalization and interaction of Asb-4 with IRS4 and the involvement of Asb-4 in insulin signaling. Results In situ hybridization showed that the expression pattern of Asb-4 was consistent with that of IRS4 in the rat brain. Double in situ hybridization showed that IRS4 colocalized with Asb-4, and both Asb-4 and IRS4 mRNA were expressed in proopiomelanocortin (POMC and neuropeptide Y (NPY neurons within the arcuate nucleus of the hypothalamus. In HEK293 cells co-transfected with Myc-tagged Asb-4 and Flag-tagged IRS4, Asb-4 co-immunoprecipitated with IRS4; In these cells endogenous IRS4 also co-immunoprecipitated with transfected Myc-Asb-4; Furthermore, Asb-4 co-immunoprecipitated with IRS4 in rat hypothalamic extracts. In HEK293 cells over expression of Asb-4 decreased IRS4 protein levels and deletion of the SOCS box abolished this effect. Asb-4 increased the ubiquitination of IRS4; Deletion of SOCS box abolished this effect. Expression of Asb-4 decreased both basal and insulin-stimulated phosphorylation of AKT at Thr308. Conclusions These data demonstrated that Asb-4 co-localizes and interacts with IRS4 in hypothalamic neurons. The interaction of Asb-4 with IRS4 in cell lines mediates the degradation of IRS4 and decreases insulin signaling.

Study of ZrO2-H2SO4-(NH4)2SO4(NH4Cl)-H2O systems

International Nuclear Information System (INIS)

Motov, D.L.; Sozinova, Yu.P.; Rys'kina, M.P.

1988-01-01

Regions of formation, composition and solubility of ammonium sulfatozirconates (ASZ) in ZrO 2 -H 2 SO 4 -(NH 4 ) 2 SO 4 (NH 4 Cl)-H 2 O systems at 25 and 75 deg C are studied by the isothermal method. Five ASZ: (NH 4 ) 2 Zr(OH) 2 (SO 4 ) 2 , NH 4 ZrOH(SO 4 ) 2 xH 2 O, NH 4 ZrO 0.5 (OH) 2 SO 4 x1.5H 2 O, (NH 4 ) 2 Zr(SO 4 ) 3 x2H 2 O, (NH 4 ) 4 Zr(SO 4 ) 4 x4H 2 O are detected, their properties are investigated. Main sulfates are new compounds never described ealier

Peritonitis bacteriana espontánea: estudio en pacientes cirróticos descompensados con ascitis Spontaneous bacterial peritonitis in decompensated cirrhotic patients with ascites

Directory of Open Access Journals (Sweden)

Fernando Montoya Maya

1995-02-01

Full Text Available Se realizó un estudio descriptivo prospectivo entre febrero de 1993 y marzo de 1994. Se estudiaron 25 pacientes cirróticos (3 de ellos en dos ocasiones con ascitis clínica o ecográfica que ingresaron al servicio de Medicina Interna del Hospital Universitario San Vicente de Paúl, Medellín, Colombia, por descompensación de su cuadro clínico. A todos se les practicó paracentesis diagnóstica con estudio de citoquímico, citología y cultivo para bacterias aerobias y anaerobias. La edad promedio de los pacientes fue de 43.9 años (13 a 77 afíos, 13 fueron mujeres (52% y 12 hombres (48%. En 11 episodios (39.3% se encontró ascitis infectada, así: ascitis bacteriana 6 casos (54.6% (monomicrobiana en tres y polimicrobiana en otros tres; peritonitis bacteriana espontánea 3 casos (27.2% (polimicrobiana en dos y monomicrobiana en uno y ascitis neutrofílica dos casos (18.2%. El 72.7% de los casos con ascitis infectada tuvieron fiebre contra un 23.5% de aquéllos sin infección (p < 0.014. Asimismo, el dolor abdominal fue un síntoma bastante frecuente (45.5% de infección. La ascitis infectada se presentó únicamente en individuos categoría C de la clasificación de Child-Pugh, con niveles séricos de albúmina, generalmente menores de 2 g/dl (p < 0.01. Los niveles de albúmina en líquido ascítico menores de 1 g/dl no se asociaron a la infección del mismo. Los gérmenes prevalentes fueron Escherichia coli y estreptococos del grupo viridans, cada uno aislado en 5 ocasiones. Los aislamientos fueron polimicrobianos en 5 de nueve casos (55.5%. La mortalidad por ascitis infectada fue de 27.3% (3/11 casos comparable con la debida a causas diferentes (29.4% en individuos con ascitis sin infección (5/17. Se concluye que la infección del líquido ascítico es una complicación frecuente en los pacientes cirróticos descompensados. La fiebre y el dolor abdominal son los signos clínicos cardinales de la infección. El aislamiento frecuente de E

Occupational violence against dental professionals in southern Nigeria.

Science.gov (United States)

Azodo, C C; Ezeja, E B; Ehikhamenor, E E

2011-09-01

To determine the prevalence of workplace violence in Oral healthcare centres against Nigerian dental professionals. A questionnaire-based cross-sectional survey of 175 randomly selected dental professionals working in Oral healthcare centres of University Teaching Hospitals in Southern Nigeria was conducted. The survey response rate was 78.9%. The respondents were dentists (58.0%), dental nurses (18.1%), dental technologists (12.3%), dental therapists (8.0%) and dental record officers (3.6%). The prevalence of violence in Nigerian Oral healthcare centres was 31.9%. There was no statistically significant difference in the prevalence of violence against dentist and dental auxiliaries. Violence was often associated with long waiting time (27.3%), cancellation of appointment (13.6%), outcome of patient's treatment (11.4%), alcohol intoxication (9.1%), psychiatric patient (6.8%,) patient's bill (4.5%) and others (27.3%). Non-physical violence in form of loud shouting (50.0%) threat (22.7%), sexual harassment (6.8%) and swearing (2.3%) constituted the majority while physical violence in form of bullying and hitting constituted the remaining 18.2%. The main perpetrators of the violence were patients (54.5%) and patient's relatives/friends (18.2%). The expressed impact of violence among the respondents include fear (18.2%), impaired job performance (15.9%), psychological problems (13.6%) and off duty (9.1%). No impact was declared by 43.2% of respondents. The prevalence of workplace violence in Oral healthcare centres against dental professionals in Southern Nigeria was significant and had a substantial effect on dental professionals' well-being thus necessitating urgent attention.

Kinetics of thermal decomposition of ammonium perchlorate with nanocrystals of binary transition metal ferrites

Energy Technology Data Exchange (ETDEWEB)

Singh, Gurdip; Kapoor, Inder Pal Singh; Dubey, Shalini [Department of Chemistry, D. D. U. Gorakhpur University, Gorakhpur (India); Siril, Prem Felix [Laboratoire de Chimie Physique (LCP), Universite de Paris Sud, Orsay (France)

2009-02-15

Binary transition metal ferrite (BTMF) nanocrystals of formula MFe{sub 2}O{sub 4}(M=Cu,Co,Ni) were prepared by the coprecipitation method and characterized by X-ray diffraction (XRD). XRD patterns gave average particle size by using Scherrer's equation for CuFe{sub 2}O{sub 4}(CuF), CoFe{sub 2}O{sub 4}(CoF), and NiFe{sub 2}O{sub 4} (NiF) as 39.9, 27.3, and 43.8 nm, respectively. The catalytic activity measurements on the thermal decomposition of ammonium perchlorate (AP) were carried out by using thermogravimetry (TG), differential thermal analysis (DTA), and ignition delay studies. Isothermal TG data up to a mass loss of 45% have been used to evaluate kinetic parameters by using model fitting as well as isoconversional method. The order of catalytic activity was found to be: CoFe{sub 2}O{sub 4}>NiFe{sub 2}O{sub 4}. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

Effect of copper, tin, phosphorous and arsenic on the surface cracking of a 18-8 stainless steel during hot compression tests

International Nuclear Information System (INIS)

Botella, J.; Fernandez, M.T.; Fernandez de Castillo, I.

1998-01-01

The effect of certain different concentrations of Cu, Sn, P and As on the surface cracking of 18-8 austenitic stainless steel hot compressed specimens has been studied, at 1,123 and 1,273 K, in an oxidizing atmosphere (air). A procedure for determining surface cracking has been established, and the cracking factor obtained in this ways is correlated with the chemical composition of the materials at both temperatures. The cracking factors obtained at 1,273 K have been compared with the reduction of area drops obtained by hot tension tests at the same temperature. (Author) 5 refs

Molecular epidemiology of Escherichia coli producing extended-spectrum {beta}-lactamases in Lugo (Spain): dissemination of clone O25b:H4-ST131 producing CTX-M-15.

Science.gov (United States)

Blanco, Miguel; Alonso, Maria Pilar; Nicolas-Chanoine, Marie-Hélène; Dahbi, Ghizlane; Mora, Azucena; Blanco, Jesús E; López, Cecilia; Cortés, Pilar; Llagostera, Montserrat; Leflon-Guibout, Véronique; Puentes, Beatriz; Mamani, Rosalía; Herrera, Alexandra; Coira, María Amparo; García-Garrote, Fernando; Pita, Julia María; Blanco, Jorge

2009-06-01

Having shown that the Xeral-Calde Hospital in Lugo (Spain) has been concerned by Escherichia coli clone O25:H4-ST131 producing CTX-M-15 (Nicolas-Chanoine et al. J Antimicrob Chemother 2008; 61: 273-81), the present study was carried out to evaluate the prevalence of this clone among the extended-spectrum beta-lactamase (ESBL)-producing E. coli isolates and also to molecularly characterize the E. coli isolates producing ESBL other than CTX-M-15. In the first part of this study, 105 ESBL-producing E. coli isolates (February 2006 to March 2007) were characterized with regard to ESBL enzymes, serotypes, virulence genes, phylogenetic groups, multilocus sequence typing (MLST) and PFGE. In the second part of this study, 249 ESBL-producing E. coli isolates (April 2007 to May 2008) were investigated only for the detection of clone O25b:H4-ST131 producing CTX-M-15 using a triplex PCR developed in this study and based on the detection of the new operon afa FM955459 and the targets rfbO25b and 3' end of the bla(CTX-M-15) gene. Of the 105 ESBL-producing E. coli isolates, 60 (57.1%) were positive for CTX-M-14, 23 (21.9%) for CTX-M-15, 10 (9.5%) for SHV-12 and 7 (6.7%) for CTX-M-32. Serotypes, virulence genes, phylogenetic groups and molecular typing by PFGE demonstrated high homogeneity within those producing CTX-M-15 and high diversity within E. coli producing CTX-M-14 and other ESBLs. By PFGE, CTX-M-15-producing E. coli isolates O25b:H4 belonging to the phylogenetic group B2 and MLST profile ST131 were grouped in the same cluster. The epidemic strain of clone O25b:H4-ST131 represented 23.1%, 22.5% and 20.0% of all ESBL-producing E. coli isolated in 2006, 2007 and 2008, respectively. CTX-M-type ESBLs, primarily CTX-M-14 and CTX-M-15, have emerged as the predominant types of ESBL produced by E. coli isolates in Lugo. In view of the reported findings, long-term care facilities for elderly people may represent a significant reservoir for E. coli clone O25b:H4-ST131 producing CTX

4s24p3--4s4p4 and 4s24p3--4s2fp25s transitions in Y VII, Zr VIII, Nb IX, and MoX

International Nuclear Information System (INIS)

Reader, J.; Acquista, N.

1981-01-01

Spectra of ionized Y, Zr, Nb, and Mo have been observed in sliding-spark and triggered-spark discharges on 10.7-m normal- and grazing-incidence spectrographs at the National Bureau of Standards in Washington, D. C. From these observations the 4s 2 4p 3 --4s4p 4 transitions in Y VII, Zr VIII, Nb IX, and Mo X have been identified. The 4s 2 4p 3 --4s 2 4p 2 5s transitions in Y VII-Mo X, previously identified by Rahimullah et al. [Phys. Scr. 14, 221--223 (1976); 18, 96--106 (1978)], have been confirmed. In Y VII the 4s 2 4p 3 --4s 2 4p 2 6s and 4s4p 4 --4p 5 transition also have been found. The parameters obtained from least-squares fits to the energy levels are compared with Hartree--Fock calculations. Preliminary values of the ionization energies have been determined as 110.02 +- 0.15 eV for Y VII, 133.7 +- 0.5 eV for Zr VIII, 159.2 +- 0.7 eV for Nb IX, and 186.4 +- 1.2 eV for Mo X

Quality Certification 4 (QC4) for RE4 Performance Plots

CERN Document Server

CMS Collaboration

2013-01-01

The installation of two new wheels in the end-caps of the RPC system (RE4) is expected during LHC Long Shutdown (LS1). The RE4 upgrade project consists of 72 Super Modules (SM), each one made with 2 RPC chambers, for a total of 144 double-gap RPC chambers. To ensure the quality of the chambers several steps have been established for the Quality Certification (QC) of the RPC chamber production: QC1 (for components), QC2 (for gaps), QC3 (for chambers), QC4 (for chambers and super modules) and QC5 (Commissioning at P5). The results from the QC4 tests, performed for the new RPC, are presented in this note.

Analysis of (NH4)2SO4/(NH4)H2PO4 mixtures by thermogravimetry and X-ray diffraction

International Nuclear Information System (INIS)

Perez, Jose; Perez, Eduardo; Vas, Beatriz del; Garcia, Luis; Serrano, Jose Luis

2006-01-01

(NH 4 ) 2 SO 4 and (NH 4 )H 2 PO 4 are the principal components in the powder material used in fire extinguishers. In this paper the mutual influence in their thermal decomposition is investigated by thermogravimetry. Two methods for the quantification of both salts in mixtures (NH 4 ) 2 SO 4 /(NH 4 )H 2 PO 4 are proposed. The first employs thermogravimetry and is based on the measurement of the mass fraction in the 500-550 deg. C interval, once (NH 4 ) 2 SO 4 has totally decomposed to yield gaseous products. The second uses some selected peaks in the X-ray diffractogram