WorldWideScience

Sample records for prunus persica batsch

  1. Molecular characterization of peach [Prunus persica (L.) Batsch] germplasm in the United States using microsatellite markers

    Science.gov (United States)

    Peach [Prunus persica (L.) Batsch] is an important medicinal fruit with immense health benefits and antioxidant activity. In this study, microsatellite markers were used as DNA fingerprinting tools for the identification and characterization of peach germplasm in the United States. Eleven microsatel...

  2. Prokinetic Activity of Prunus persica (L. Batsch Flowers Extract and Its Possible Mechanism of Action in Rats

    Directory of Open Access Journals (Sweden)

    Wei Han

    2015-01-01

    Full Text Available The peach tree, Prunus persica (L. Batsch, is widely cultivated in China, and its flowers have been used for centuries in traditional Chinese medicine to treat gut motility disorders. But few studies have explored the pharmacological effect of Prunus persica (L. Batsch flowers on gastrointestinal motility. In this study, the activities of different extracts from Prunus persica (L. Batsch flowers on the smooth muscle contractions were evaluated using isolated colon model, and the ethyl acetate extract (EAE showed the strongest effects in vitro. EAE (10−8–10−5 g/mL caused a concentration-dependent stimulatory effect in rat colonic tissue. Additionally, ketotifen (100 µM, cimetidine (10 µM, and pyrilamine (1 µM produced a significant inhibition of contractions caused by EAE. Furthermore, immunofluorescence and toluidine blue staining revealed increased numbers of mast cells in the EAE group, and EAE increased histamine release from the colonic tissues. These data indicate that EAE has significant prokinetic activity and acts by a mechanism that mainly involves mast cell degranulation. Our study provides a pharmacological basis for the use of an extract of Prunus persica (L. Batsch flowers in the treatment of gut motility disorders.

  3. Cultivar identification, pedigree verification, and diversity analysis among Peach (Prunus persica L. Batsch) Cultivars based on Simple Sequence Repeat markers

    Science.gov (United States)

    The genetic relationships and pedigree inferences among peach (Prunus persica (L.) Batsch) accessions and breeding lines used in genetic improvement were evaluated using 15 simple sequence repeat (SSR) markers. A total of 80 alleles were detected among the 37 peach accessions with an average of 5.53...

  4. Prokinetic activity of Prunus persica (L.) Batsch flowers extract and its possible mechanism of action in rats.

    Science.gov (United States)

    Han, Wei; Xu, Jing Dong; Wei, Feng Xian; Zheng, Yong Dong; Ma, Jian Zhong; Xu, Xiao Dong; Wei, Zhen Gang; Wang, Wen; Zhang, You Cheng

    2015-01-01

    The peach tree, Prunus persica (L.) Batsch, is widely cultivated in China, and its flowers have been used for centuries in traditional Chinese medicine to treat gut motility disorders. But few studies have explored the pharmacological effect of Prunus persica (L.) Batsch flowers on gastrointestinal motility. In this study, the activities of different extracts from Prunus persica (L.) Batsch flowers on the smooth muscle contractions were evaluated using isolated colon model, and the ethyl acetate extract (EAE) showed the strongest effects in vitro. EAE (10(-8)-10(-5) g/mL) caused a concentration-dependent stimulatory effect in rat colonic tissue. Additionally, ketotifen (100 µM), cimetidine (10 µM), and pyrilamine (1 µM) produced a significant inhibition of contractions caused by EAE. Furthermore, immunofluorescence and toluidine blue staining revealed increased numbers of mast cells in the EAE group, and EAE increased histamine release from the colonic tissues. These data indicate that EAE has significant prokinetic activity and acts by a mechanism that mainly involves mast cell degranulation. Our study provides a pharmacological basis for the use of an extract of Prunus persica (L.) Batsch flowers in the treatment of gut motility disorders.

  5. Transcriptome analysis of peach (Prunus persica L. Batsch) during the late stage of fruit ripening.

    Science.gov (United States)

    Pan, H F; Sheng, Y; Gao, Z H; Chen, H L; Qi, Y J; Yi, X K; Qin, G H; Zhang, J Y

    2016-12-23

    Fruit ripening is a complex developmental process, the details of which remain largely unknown in fleshy fruits. In this paper, the fruit flesh of two peach varieties, "Zhongyou9" (a nectarine; Prunus persica L. Batsch) and its mutant "Hongyu", was analyzed by RNA-seq technology during two stages of ripening at 20-day intervals. One hundred and eighty significant upregulated and two hundred and thirty-five downregulated genes were identified in the experiment. Many of these genes were related to plant hormones, chlorophyll breakdown, accumulation of aroma and flavor volatiles, and stress. To the best of our knowledge, this is the first transcriptome analysis of peach ripening, and our data will be useful for further studies of the molecular basis of fruit ripening.

  6. Endogenous hormones response to cytokinins with regard to organogenesis in explants of peach (Prunus persica L. Batsch) cultivars and rootstocks (P. persica × Prunus dulcis).

    Science.gov (United States)

    Pérez-Jiménez, Margarita; Cantero-Navarro, Elena; Pérez-Alfocea, Francisco; Cos-Terrer, José

    2014-11-01

    Organogenesis in peach (Prunus persica L. Batsch) and peach rootstocks (P. persica × Prunus dulcis) has been achieved and the action of the regeneration medium on 7 phytohormones, zeatin (Z), zeatin riboside (ZR), indole-3-acetic acid (IAA), abscisic acid (ABA), ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC), salicylic acid (SA), and jasmonic acid (JA), has been studied using High performance liquid chromatography - mass spectrometry (HPLC-MS/MS). Three scion peach cultivars, 'UFO-3', 'Flariba' and 'Alice Bigi', and the peach × almond rootstocks 'Garnem' and 'GF677' were cultured in two different media, Murashige and Skoog supplemented with plant growth regulators (PGRs) (regeneration medium) and without PGRs (control medium), in order to study the effects of the media and/or genotypes in the endogenous hormones content and their role in organogenesis. The highest regeneration rate was obtained with the peach × almond rootstocks and showed a lower content of Z, IAA, ABA, ACC and JA. Only Z, ZR and IAA were affected by the action of the culture media. This study shows which hormones are external PGRs-dependent and what is the weight of the genotype and hormones in peach organogenesis that provide an avenue to manipulate in vitro organogenesis in peach. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  7. Investigation of the aroma of commercial peach (Prunus persica L. Batsch) types by Proton Transfer Reaction-Mass Spectrometry (PTR-MS) and sensory analysis

    NARCIS (Netherlands)

    Cardoso Ferreira Pinhancos de Bianchi, Tiago; Weesepoel, Yannick; Koot, Alex; Iglesias, Ignasi; Eduardo, Iban; Gratacós-Cubarsí, Marta; Guerrero, Luis; Hortós, Maria; Ruth, van Saskia

    2017-01-01

    The aim of this study was to investigate the aroma and sensory profiles of various types of peaches (Prunus persica L. Batsch.). Forty-three commercial cultivars comprising peaches, flat peaches, nectarines, and canning peaches (pavías) were grown over two consecutive harvest years. Fruits were

  8. Variabilidad interspecifica de duraznos (Prunus persica L. Batsch.) y ciruelos (Prunus domestica) usando RAMs

    National Research Council Canada - National Science Library

    Ana Cruz Morillo Coronado; Yacenia Morillo Coronado; Leonardo Ariel González Mendoza; Iván Adiel Ávila Morales

    2015-01-01

      A sample of 41 Prunus materials from the deciduous collection of the Pedagogical and Technological University of Colombia was selected to evaluate its genetic diversity using eight primers for Random...

  9. Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants

    Directory of Open Access Journals (Sweden)

    Carla Rosana Eichelberger

    2011-09-01

    Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and

  10. Transcriptome analysis of seed dormancy after rinsing and chilling in ornamental peaches (Prunus persica (L.) Batsch).

    Science.gov (United States)

    Kanjana, Worarad; Suzuki, Tomohiro; Ishii, Kazuo; Kozaki, Toshinori; Iigo, Masayuki; Yamane, Kenji

    2016-08-08

    Ornamental peaches cv. 'Yaguchi' (Prunus persica (L.) Batsch) can be propagated via seeds. The establishment of efficient seed treatments for early germination and seedling growth is required to shorten nursery and breeding periods. It is important, therefore, to identify potential candidate genes responsible for the effects of rinsing and chilling on seed germination. We hypothesized that longer rinsing combined with chilling of seeds can alter the genes expression in related to dormancy and then raise the germination rate in the peach. To date, most molecular studies in peaches have involved structural genomics, and few transcriptome studies of seed germination have been conducted. In this study, we investigated the function of key seed dormancy-related genes using next-generation sequencing to profile the transcriptomes involved in seed dormancy in peaches. De novo assembly and analysis of the transcriptome identified differentially expressed and unique genes present in this fruit. De novo RNA-sequencing of peach was performed using the Illumina Miseq 2000 system. Paired-end sequence from mRNAs generated high quality sequence reads (9,049,964, 10,026,362 and 10,101,918 reads) from 'Yaguchi' peach seeds before rinsed (BR) and after rinsed for 2 or 7 days with a chilling period of 4 weeks (termed 2D4W and 7D4W), respectively. The germination rate of 7D4W was significantly higher than that of 2D4W. In total, we obtained 51,366 unique sequences. Differential expression analysis identified 7752, 8469 and 506 differentially expressed genes from BR vs 2D4W, BR vs 7D4W and 2D4W vs 7D4W libraries respectively, filtered based on p-value and an adjusted false discovery rate of less than 0.05. This study identified genes associated with the rinsing and chilling process that included those associated with phytohormones, the stress response and transcription factors. 7D4W treatment downregulated genes involved in ABA synthesis, catabolism and signaling pathways, which

  11. Pegamento e crescimento inicial de enxertos do pessegueiro 'Aurora-1' em clones de umezeiro (Prunus mume Sieb. et Zucc. e 'Okinawa' [Prunus persica (L. Batsch] propagados por estacas herbáceas Tissue union and initial growth of 'Aurora-1' peach buds on mume clones (Prunus mume Sieb. et Zucc. and 'Okinawa' [Prunus persica (L. Batsch] propagated by herbaceous cuttings

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2005-04-01

    Full Text Available O presente estudo teve por objetivo avaliar o pegamento e o crescimento inicial de enxertos do pessegueiro 'Aurora-1' em clones de umezeiro (Prunus mume Sieb. et Zucc. e 'Okinawa' [Prunus persica (L. Batsch] propagados por estacas herbáceas. Realizaram-se dois experimentos, adotando-se a enxertia de borbulhia por escudo (março e borbulhia por escudo modificada (julho. Com os resultados obtidos, pode-se concluir que é viável a realização da enxertia do 'Aurora-1' nos Clones 05; 10 e 15 de umezeiro e no 'Okinawa', tanto em março quanto em julho, com as metodologias utilizadas. O 'Okinawa' induz crescimento mais rápido ao enxerto, de forma que o ponto máximo do comprimento é atingido em tempo menor.This study aimed to evaluate the tissue union and initial growth of 'Aurora-1' peach buds on mume clones (Prunus mume Sieb. et Zucc. and 'Okinawa' [Prunus persica (L. Batsch] propagated by herbaceous cuttings. Two experiments were carried out, being adopted the chip budding (March and chip budding modified (July. The results showed that accomplishment of 'Aurora-1' peach bud on mume Clones 05, 10 and 15 and 'Okinawa' is viable, in both periods, with the methodologies used. The 'Okinawa' induces faster growth to the bud and the maximum length point is reached in a short time.

  12. The potential of Prunus davidiana for introgression into peach [Prunus persica (L.) Batsch] assessed by comparative mapping.

    Science.gov (United States)

    Foulongne, M; Pascal, T; Arús, P; Kervella, J

    2003-07-01

    The potential for introgression of Prunus davidiana, a wild species related to peach, was evaluated with respect to problems of non-Mendelian segregation or suppressed recombination which often hamper breeding processes based on interspecific crosses. Three connected (F1, F2 and BC2) populations, derived from a cross between P. davidiana clone P1908 and the peach cultivar Summergrand were used. The intraspecific map of P. davidiana already established using the F1 progeny was complemented, and two interspecific maps, for the F2 and BC2 progenies, were built with a set of markers selected from the Prunus reference map. With the molecular data collected for the F2 map construction, regions with distorted marker segregation were detected on the genome; one third of all loci deviated significantly from the expected Mendelian ratios. However, some of these distorted segregations were probably not due to the interspecific cross. On linkage group 6, a skewed area under gametic selection was most likely influenced by the self-incompatibility gene of P. davidiana. Using anchor loci, a good colinearity between the three maps built and the Prunus reference map was demonstrated. Comparative mapping also revealed that homologous recombination occurred normally between P. davidiana and the Prunus persica genome. This confirmed the closeness of the two species. Higher recombination rates were generally observed between P. davidiana and P. persica than between Prunus amygdalus and P. persica. The consequences for plant breeding strategy are discussed. The three maps of the F1, F2 and BC2 progenies provide useful tools for QTL detection and marker-assisted selection, as well as for assessing the efficiency of the peach breeding scheme applied to introgress P. davidiana genes into peach cultivated varieties.

  13. Variation Of Odour Profile Detected In The Floral Stages of Prunus Persica (L) Batsch Using An Electronic Nose

    Science.gov (United States)

    Valeria, Messina; Silvia, Radice; Rosa, Baby; de Reca Noemí, Walsöe

    2009-05-01

    Bees use signals from plants to identify worthwhile visits. They learn quickly to differentiate mainly their floral odor than their colour. In some species the flowers remain open, intact and turgid until they are pollinated (anthesis) after which they are no longer attractive to pollinators (post-anthesis). Pollinators use fragrance for distance orientation, approach, landing, feeding and associative learning. The aim of this work was to study the variation of odor profile between anthesis and post-anthesis produced in flowers of different cultivars of Prunus Persica (L.) batsch, using an electronic nose since odor is a communication between flowering plants and bees. Visual results on field showed that peach flowers are generally more visited in the anthesis stage. Among all the analysed cultivars, Forastero cultivar was the only one visited in this floral stage. Statistical analysis of the electronic nose data showed that doped semiconductuvtive SnO2 sensors could differentiate between stages (anthesis and post-anthesis) only in case of Forastero cultivar.

  14. Comparison between in toto peach (Prunus persica L. Batsch) supplementation and its polyphenolic extract on rat liver xenobiotic metabolizing enzymes.

    Science.gov (United States)

    Canistro, Donatella; Vivarelli, Fabio; Cirillo, Silvia; Costa, Guglielmo; Andreotti, Carlo; Paolini, Moreno

    2016-11-01

    Over the past years, there has been a growing interest in the natural constituents of foods as a potential means of cancer control. To date, epidemiology studies seem to indicate an inverse association between regular consumption of fruit and vegetables and cancer risk. Here, the potential chemopreventive activity of the polyphenolic extract (PPE) of peach (Prunus persica L. Batsch) and of the freeze-dried fruit in toto (LFT), focusing on the modulation of xenobiotic metabolizing enzymes (XMEs) in vivo, was investigated. Rats were daily supplemented with LFT at 250 and 500 mg/kg b.w. or with the corresponding amount of PPE (2.5 and 5 mL/kg b.w., respectively) for either 7 or 14 days. While PPE treatment resulted in a widespread phase-I inactivation, a complex modulation pattern with drastic decreases (7α-testosterone hydroxylase, pentoxyresorufin O-dealkylase (PROD)), coupled with marked up-regulations of ethoxyresorufin O-deethylase (EROD) and methoxyresorufin O-demethylase (MROD) after LFT administration, was seen. A notable down-regulation (over 50%) following LFT or PPE treatment for the phase-II enzymes was also recorded. The observed remarkable changes in XMEs, if reproduced in humans, might have public health implications. These data suggest caution in promoting peach fruit (mono-diet) consumption or its polyphenolic extract in the field of chemoprevention. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Copigmentation triggers the development of skin burning disorder on peach and nectarine fruit [Prunus persica (L.) Batsch].

    Science.gov (United States)

    Cantín, Celia M; Tian, Li; Qin, Xiaoqiong; Crisosto, Carlos H

    2011-03-23

    Skin burning is a new type of skin damage related to exposure to high pH values during the brushing-waxing postharvest operations that has been observed recently on some newly released peach and nectarine [Prunus persica (L.) Batsch] cultivars. In this work, we described this skin disorder for the first time and studied its triggers and biological basis. Different skin burning susceptibility was observed after screening 21 peach and nectarine cultivars. The stability of the skin phenolic extracts to pH in the range 7-10 was studied by UV-visible spectroscopy. This study demonstrated that fruit skin phenolics are not stable at high pH and that the transformations occurring at high pH are reversible and time-dependent. The changes on the UV-visible absorption spectra at different pH values pointed out the copigmentation of anthocyanins as the mechanism beyond the skin burning disorder. Finally, some recommendations to minimize this postharvest damage are also discussed.

  16. UTILIZACION DE ISOENZIMAS DE EXTRACTOS DE HOJAS EN LA CARACTERIZACION DE CULTIVARES DE DURAZNERO (Prunus persica (L Batsch THE USE OF ISOZYME LEAF EXTRACTS IN THE CHARACTERIZATION OF PEACH CULTIVARS (Prunus persica L Batsch

    Directory of Open Access Journals (Sweden)

    HECTOR ABEL ALTUBE

    2001-08-01

    Full Text Available La caracterización de cultivares de duraznero (Prunus persica (L Batsch se hace por medio de la descripción de caracteres agronómicos y morfológicos codificados por organizaciones internacionales, los cuales están fuertemente influenciados por el ambiente. Se han buscado métodos alternativos de caracterización y las isoenzimas han sido utilizadas por su independencia de las condiciones del ambiente, además de identificar individuos en etapas tempranas de su desarrollo. El objetivo del presente estudio es caracterizar cultivares de duraznero mediante el análisis isoenzimático de catecol oxidasas, fosfatasas ácidas, esterazas y peroxidazos en extractos de hojas. Los cultivares de duraznero analizados presentaron bajo polimorfismo isoenzimático, las esterazas caracterizaron diez cultivares, las catecol oxidasas un cultivar agrupándose el resto en cinco modelos, las fosfatasas ácidas caracterizaron dos cultivares agrupándose los otros en siete modelos y las peroxidazos formaron tres grupos. Ello puede explicarse ya que el duraznero es una especie autofértil y presenta una base genética muy reducida. Los evidentes límites discriminatorios de este tipo de análisis hacen que su aporte sea sólo complementario a los métodos de los caracteres agronómicos y morfológicos.Characterization of peach cultivars (Prunus persica (L Batsh was made by description of agronomical and morphological characters codified from international organizations, which are strongly affected by environmental conditions. Alternative methods of characterization have been searched, and isoenzymes have been used as independent of environmental conditions in addition to identify some individuals in early stages of development. The goal of this study is the peach cultivars characterization by isoenzymatic analysis of catecol oxidases, acid phosphatases, esterases and peroxidases within the leaf extracts. The peach cultivars analyzed have showed low isoenzymatic

  17. Phenolic composition and antioxidant properties of different peach [Prunus persica (L.) Batsch] cultivars in China.

    Science.gov (United States)

    Zhao, Xiaoyong; Zhang, Wenna; Yin, Xueren; Su, Mingshen; Sun, Chongde; Li, Xian; Chen, Kunsong

    2015-03-12

    China is an important centre of diversity for Prunus persica. In the present study, 17 Chinese peach cultivars were evaluated for phenolic content and antioxidant activity. Neochlorogenic acid (NCHA), chlorogenic acid (CHA), procyanidin B1 (B1), catechin (CAT), cyanidin-3-O-glucoside (C3G), quercetin-3-O-galactoside (Q3GAL), quercetin-3-O-glucoside (Q3GLU), quercetin-3-O-rutinoside (Q3R), and kaempferol-3-O-rutinoside (K3R) were identified and quantified. CHA and CAT were the predominant components in both the peel and pulp of this fruit. In general, peel extracts showed higher antioxidant activities than the pulp counterparts, consistent with the observed higher phenolic content. The melting peach cultivar "Xinyu" showed the highest antioxidant potency composite (APC) index. The principal component analysis (PCA) of peel phenolics showed a clear distinction between the melting peach and nectarine. Overall, peach cultivars rich in hydroxycinnamates and flavan-3-ols showed relatively higher antioxidant activities and might be excellent sources of phytochemicals and natural antioxidants.

  18. Evaluación productiva, económica y social del agua de riego de durazno (Prunus persica L. Batsch) en Zacatecas (México)

    OpenAIRE

    José Luis Ríos-Flores; Miriam Torres-Moreno; José Ruiz-Torres; Marco Antonio Torres-Moreno; Jesús Enrique Cantú-Brito

    2015-01-01

    La escasez de agua limita la agricultura, por lo que su uso debe ser más eficiente en la producción de alimentos. El objetivo de este trabajo fue determinar la productividad económica, física y social del agua del cultivo de durazno (Prunus persica L. Batsch), en la región del Distrito de Desarrollo Rural 183 —correspondiente a Fresnillo, Zacatecas— para el ciclo 2012; se desarrollaron modelos matemáticos para estimar la productividad y eficiencia del agua. En Zacatecas se cosecharon 817 ha d...

  19. Proanthocyanidin monomers and cyanidin 3-O-glucoside accumulation in blood-flesh peach (Prunus persica (L. Batsch fruit

    Directory of Open Access Journals (Sweden)

    Yan Juan

    2017-01-01

    Full Text Available To better understand the characteristics and mechanisms of proanthocyanidin monomers and anthocyanin synthesis in blood-flesh peach (Prunus persica (L. Batsch, the accumulation of catechin, epicatechin and cyanidin 3-O-glucoside was determined, and the expression patterns of structural genes associated with biosynthesis of those compounds were investigated in the blood-flesh peach fruit of cultivar “Dahongpao” during fruit development. Our results show that catechin concentration remained low and comparatively stable throughout fruit development. The concentration of epicatechin remained low at the early stages of fruit development and rapidly accumulated during ripening. Cyanidin 3-O-glucoside was not detected in theearly stages. Epicatechin started to rapidly accumulate during the ripening period, reaching a maximum at the mature stage. The expressions of the early and common genes, phenylalanine ammonia-lyase and chalcone isomerase, were less associated with proanthocyanidin monomers and cyanidin 3-O-glucoside accumulation. The expression of other flavonoid ‘early’ biosynthetic genes, including chalcone synthase (CHS, flavanone 3-hydroxylase, dihydroflavonol 4-reductase (DFR and leucoanthocyanidin dioxygenase (LDOX, were partly associated with proanthocyanidin monomers and cyanidin 3-O-glucoside levels, with expression quantities peaking synchronously at the mature stage. Leucoanthocyanidin reductase and anthocyanidin reductase, which were the key genes for proanthocyanidin monomer synthesis, correlated during fruit development with catechin and epicatechin accumulation respectively; UDP-glucose: flavonoid 3-O-glucosyltransferase (UGFT, the key gene for anthocyanin synthesis, was correlated with cyanidin 3-O-glucoside levels. The synchronous accumulation of epicatechin and cyanidin 3-O-glucoside in blood-flesh peach could not be explained by the current theory of competitive distribution mechanism of common substrate.

  20. Increased levels of IAA are required for system 2 ethylene synthesis causing fruit softening in peach (Prunus persica L. Batsch).

    Science.gov (United States)

    Tatsuki, Miho; Nakajima, Naoko; Fujii, Hiroshi; Shimada, Takehiko; Nakano, Michiharu; Hayashi, Ken-ichiro; Hayama, Hiroko; Yoshioka, Hirohito; Nakamura, Yuri

    2013-02-01

    The fruit of melting-flesh peach (Prunus persica L. Batsch) cultivars produce high levels of ethylene caused by high expression of PpACS1 (an isogene of 1-aminocyclopropane-1-carboxylic acid synthase), resulting in rapid fruit softening at the late-ripening stage. In contrast, the fruit of stony hard peach cultivars do not soften and produce little ethylene due to low expression of PpACS1. To elucidate the mechanism for suppressing PpACS1 expression in stony hard peaches, a microarray analysis was performed. Several genes that displayed similar expression patterns as PpACS1 were identified and shown to be indole-3-acetic acid (IAA)-inducible genes (Aux/IAA, SAUR). That is, expression of IAA-inducible genes increased at the late-ripening stage in melting flesh peaches; however, these transcripts were low in mature fruit of stony hard peaches. The IAA concentration increased suddenly just before harvest time in melting flesh peaches exactly coinciding with system 2 ethylene production. In contrast, the IAA concentration did not increase in stony hard peaches. Application of 1-naphthalene acetic acid, a synthetic auxin, to stony hard peaches induced a high level of PpACS1 expression, a large amount of ethylene production and softening. Application of an anti-auxin, α-(phenylethyl-2-one)-IAA, to melting flesh peaches reduced levels of PpACS1 expression and ethylene production. These observations indicate that suppression of PpACS1 expression at the late-ripening stage of stony hard peach may result from a low level of IAA and that a high concentration of IAA is required to generate a large amount of system 2 ethylene in peaches.

  1. Reação de clones de umezeiro (Prunus mume Sieb. et Zucc. e cultivares de pessegueiro [Prunus persica (L. Batsch] ao nematóide anelado Mesocriconema xenoplax (Nemata: Criconematidae Reaction of mume clones (Prunus mume Sieb. et Zucc. and peach tree cultivars [Prunus persica (L. Batsch] to ring nematode Mesocriconema xenoplax (Nemata: Criconematidae

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2005-04-01

    Full Text Available Com o objetivo de avaliar a reação de clones de umezeiro (Prunus mume Sieb. et Zucc. e cultivares de pessegueiro [Prunus persica (L. Batsch] ao nematóide anelado Mesocriconema xenoplax (Raski Loof & de Grise, realizou-se o presente estudo em casa de vegetação do Departamento de Fitossanidade da FCAV/UNESP, Câmpus de Jaboticabal-SP. As plantas foram mantidas em vasos de cerâmica com 6 litros de capacidade, contendo uma mistura de solo e areia (1:1, v/v, previamente autoclavada a 121°C e 1kgf.cm-2 por 2 horas. Cada planta foi inoculada com 10mL de uma suspensão de 200 M. xenoplax por mL. Com os resultados obtidos, após 105 dias da inoculação, pode-se concluir que os Clones 05; 10 e 15 de umezeiro e as cultivares Okinawa e Aurora-1 de pessegueiro são suscetíveis a M. xenoplax. A cultivar Aurora-1 apresentou maior Fator de Reprodução (93,06.With the objective of evaluating the reaction of mume clones (Prunus mume Sieb. et Zucc. and peach tree cultivars [Prunus persica (L. Batsch] to ring nematode Mesocriconema xenoplax (Raski Loof & de Grise, was conducted the present study at a greenhouse, belonging to the Phytosanity Department of Faculdade de Ciências Agrárias e Veterinárias (FCAV/UNESP, Jaboticabal Campus, São Paulo State, Brazil. The plants were maintained in ceramic boxes with 6 liters of capacity, contends a soil-sand mixture (1:1, v/v, previously autoclaved at 121°C and 1kgf.cm-2 for 2 hours. Each plant was inoculated with a 10mL suspension of 200 M. xenoplax/mL. With the results, after 105 days of inoculation, was verified that mume Clones 05, 10 and 15 and 'Okinawa' and 'Aurora-1' peach tree cultivars are susceptible to M. xenoplax. The cultivar 'Aurora-1' presented larger reproduction factor (93,06.

  2. Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants Flutuação populacional de ácaros na cultura do pessegueiro (Prunus persica (L. Batsch e em plantas associadas

    Directory of Open Access Journals (Sweden)

    Carla Rosana Eichelberger

    2011-09-01

    Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and

  3. LA RELACIÓN HOJA: FRUTO AFECTA LA PRODUCCIÓN, EL CRECIMIENTO Y LA CALIDAD DEL FRUTO EN DURAZNERO (Prunus persica L. Batsch, cv. ‘Rubidoux’) LEAF TO FRUIT RATIO AFFECTS YIELD, FRUIT GROWTH AND FRUIT QUALITY OF PEACH (Prunus persica L. Batsch, cv. ‘Rubidoux’)

    OpenAIRE

    Fánor Casierra-Posada; José Israel Rodríguez Puerto; Julián Cárdenas Hernández

    2007-01-01

    El raleo de frutos es un práctica agrícola común en los árboles de melocotón con miras a una cosecha moderada a abundante. Sin embargo, a pesar de las muchas ventajas del raleo, demostradas a lo largo de años de experiencia en la zona templada, esta práctica es a menudo una de las operaciones conducidas de manera ineficiente en el cultivo del duraznero. Árboles de duraznero (Prunus persica L. Batsch cv. ‘Rubidoux’) se ralearon manualmente con el objeto de mejorar la calidad comercial del frut...

  4. New insights into the properties of pubescent surfaces: the peach fruit (prunus persica batsch) as a model

    OpenAIRE

    Fernández, Victoria; Khayet, Mohamed; Montero Prado, Pablo; Heredia Guerrero, Alejandrio; Liakopulos, Georgios; Karabourniotis, George; del Río, Víctor; Domínguez, Eva; Tacchini, Ignacio; Nerín, Csritian¡a; Heredia, Antonio

    2011-01-01

    The surface of peach (Prunus persica ‘Calrico’) is covered by a dense indumentum, which may serve various protective purposes. With the aim of relating structure to function, the chemical composition, morphology, and hydrophobicity of the peach skin was assessed as a model for a pubescent plant surface. Distinct physicochemical features were observed for trichomes versus isolated cuticles. Peach cuticles were composed of 53% cutan, 27% waxes, 23% cutin, and 1% hydroxycinnamic acid derivatives...

  5. Heterogeneity in the entire genome for three genotypes of peach [Prunus persica (L.) Batsch] as distinguished from sequence analysis of genomic variants.

    Science.gov (United States)

    Fresnedo-Ramírez, Jonathan; Martínez-García, Pedro J; Parfitt, Dan E; Crisosto, Carlos H; Gradziel, Thomas M

    2013-11-01

    Peach [Prunus persica (L.) Batsch] is an economically important fruit crop that has become a genetic-genomic model for all Prunus species in the family Rosaceae. A doubled haploid reference genome sequence length of 227.3 Mb, a narrow genetic base contrasted by a wide phenotypic variability, the generation of cultivars through hybridization with subsequent clonal propagation, and the current accessibility of many founder genotypes, as well as the pedigree of modern commercial cultivars make peach a model for the study of inter-cultivar genomic heterogeneity and its shaping by artificial selection. The quantitative genomic differences among the three genotypes studied as genomic variants, included small variants (SNPs and InDels) and structural variants (SV) (duplications, inversions and translocations). The heirloom cultivar 'Georgia Belle' and an almond by peach introgression breeding line 'F8,1-42' are more heterogeneous than is the modern cultivar 'Dr. Davis' when compared to the peach reference genome ('Lovell'). A pair-wise comparison of consensus genome sequences with 'Lovell' showed that 'F8,1-42' and 'Georgia Belle' were more divergent than were 'Dr. Davis' and 'Lovell'. A novel application of emerging bioinformatics tools to the analysis of ongoing genome sequencing project outputs has led to the identification of a range of genomic variants. Results can be used to delineate the genomic and phenotypic differences among peach genotypes. For crops such as fruit trees, the availability of old cultivars, breeding selections and their pedigrees, make them suitable models for the study of genome shaping by artificial selection. The findings from the study of such genomic variants can then elucidate the control of pomological traits and the characterization of metabolic pathways, thus facilitating the development of protocols for the improvement of Prunus crops.

  6. Effects of different products of peach (Prunus persica L. Batsch) from a variety developed in southern Brazil on oxidative stress and inflammatory parameters in vitro and ex vivo

    Science.gov (United States)

    Gasparotto, Juciano; Somensi, Nauana; Bortolin, Rafael Calixto; Moresco, Karla Suzana; Girardi, Carolina Saibro; Klafke, Karina; Rabelo, Thallita Kelly; Morrone, Maurilio Da Silva; Vizzotto, Márcia; Raseira, Maria do Carmo Bassols; Moreira, José Claudio Fonseca; Gelain, Daniel Pens

    2014-01-01

    Antioxidant, anti-glycation and anti-inflammatory activities of fresh and conserved peach fruits (Prunus persica L. Batsch) were compared. Fresh peach pulps, peels, preserve peach pulps and the preserve syrup were prepared at equal concentrations. Rat liver, kidney and brain cortex tissue slices were pre-incubated with peach samples, subjected to oxidative stress with FeSO4 and hydrogen peroxide. Fresh peach pulps and peel conferred higher protection against cytotoxicity and oxidative stress than preserve peach pulps in most tissues. Release of tumor necrosis factor-α and interleukin-1β was also significantly decreased by Fresh peach pulps and peel, followed by preserve peach pulps. Total phenolic determination and HPLC analysis of carotenoids showed that the content of secondary metabolites in Fresh peach pulps and peel is significantly higher than in preserve peach pulps, while the syrup had only small or trace amounts of these compounds. Fresh peach pulps and Peel demonstrated high antioxidant and anti-inflammatory effects preventing against induced damage. PMID:25320458

  7. Reductions in flesh discolouration and internal morphological changes in Nanhui peaches (Prunus persica (L.) Batsch, cv. Nanhui) by electrolysed water and 1-methylcyclopropene treatment during refrigerated storage.

    Science.gov (United States)

    Zhou, Ran; Zhang, Guixiang; Hu, Yunsheng; Wu, Hui; Xie, Jing; Luo, Yudan

    2012-12-01

    The effects of electrolysed water (EW) and EW in combination with 1-methylcyclopropene (EW/MCP) on flesh discolouration of Nanhui peaches (Prunus persica (L.) Batsch, cv. Nanhui) were examined during storage at 2°C. Changes in flesh colour, ethylene production, membrane permeability, malondialdehyde (MDA), total phenolic contents and the activities of polyphenol oxidase (PPO) and peroxidase (POD) were assayed periodically after harvest and during 44days of storage. The internal morphological characteristics of Nanhui peaches were monitored using magnetic resonance imaging (MRI) at the beginning and end of storage. These data revealed that the EW/MCP treatment is more effective than the EW treatment for decreasing ethylene production and maintaining fruit cell membrane integrity, delaying increases in MDA and total phenolic contents, and lessening changes in PPO and POD activities and the internal morphology of peaches. Each of these effects contributes to suppressing flesh discolouration and maintaining the quality of Nanhui peaches during storage. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.

  8. Rootstock and fruit canopy position affect peach [Prunus persica (L.) Batsch] (cv. Rich May) plant productivity and fruit sensorial and nutritional quality.

    Science.gov (United States)

    Gullo, Gregorio; Motisi, Antonio; Zappia, Rocco; Dattola, Agostino; Diamanti, Jacopo; Mezzetti, Bruno

    2014-06-15

    The right combination of rootstock and training system is important for increased yield and fruit sensorial and nutritional homogeneity and quality with peach [Prunus persica (L.) Batsch]. We investigated the effects of rootstock and training system on these parameters, testing the effect of vigorous GF677 and weaker Penta rootstock on 'Rich May' peach cultivar. Fruit position effects regarding photosynthetically active radiation availability, along the canopy profile using the Y training system, were investigated. The positive relationships between total polyphenols content and antioxidant capacity according to canopy vigour and architecture were determined for the two scion/stock combinations. Changes in fruit epicarp colour and content of bioactive compounds were also determined. Lower-vigour trees from Penta rootstock grafting yielded larger fruit with improved skin overcolour, and greater total polyphenols content and antioxidant capacity. GF677 rootstock produced more vigorous trees with fruit with lower sensorial and nutritional parameters. Canopy position strongly affects fruit sensorial and nutritional qualities. These data define potential for improvements to peach production efficiency and fruit quality, particularly for southern Europe peach cultivation conditions. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. Investigation of the aroma of commercial peach (Prunus persica L. Batsch) types by Proton Transfer Reaction-Mass Spectrometry (PTR-MS) and sensory analysis.

    Science.gov (United States)

    Bianchi, Tiago; Weesepoel, Yannick; Koot, Alex; Iglesias, Ignasi; Eduardo, Iban; Gratacós-Cubarsí, Marta; Guerrero, Luis; Hortós, Maria; van Ruth, Saskia

    2017-09-01

    The aim of this study was to investigate the aroma and sensory profiles of various types of peaches (Prunus persica L. Batsch.). Forty-three commercial cultivars comprising peaches, flat peaches, nectarines, and canning peaches (pavías) were grown over two consecutive harvest years. Fruits were assessed for chemical aroma and sensory profiles. Chemical aroma profile was obtained by proton transfer reaction-mass spectrometry (PTR-MS) and spectral masses were tentatively identified with PTR-Time of Flight-MS (PTR-Tof-MS). Sensory analysis was performed at commercial maturity considering seven aroma/flavor attributes. The four types of peaches showed both distinct chemical aroma and sensory profiles. Flat peaches and canning peaches showed most distinct patterns according to discriminant analysis. The sensory data were related to the volatile compounds by partial least square regression. γ-Hexalactone, γ-octalactone, hotrienol, acetic acid and ethyl acetate correlated positively, and benzeneacetaldehyde, trimethylbenzene and acetaldehyde negatively to the intensities of aroma and ripe fruit sensory scores. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Dormancy-associated MADS genes from the EVG locus of peach [Prunus persica (L.) Batsch] have distinct seasonal and photoperiodic expression patterns.

    Science.gov (United States)

    Li, Zhigang; Reighard, Gregory Lynn; Abbott, Albert Glenn; Bielenberg, Douglas Gary

    2009-01-01

    Mapping and sequencing of the non-dormant evg mutant in peach [Prunus persica (L.) Batsch] identified six tandem-arrayed DAM (dormancy-associated MADS-box) genes as candidates for regulating growth cessation and terminal bud formation. To narrow the list of candidate genes, an attempt was made to associate bud phenology with the seasonal and environmental patterns of expression of the candidates in wild-type trees. The expression of the six peach DAM genes at the EVG locus of peach was characterized throughout an annual growing cycle in the field, and under controlled conditions in response to a long day-short day photoperiod transition. DAM1, 2, 4, 5, and 6 were responsive to a reduction in photoperiod in controlled conditions and the direction of response correlated with the seasonal timing of expression in field-grown trees. DAM3 did not respond to photoperiod and may be regulated by chilling temperatures. The DAM genes in peach appear to have at least four distinct patterns of expression. DAM1, 2, and 4 are temporally associated with seasonal elongation cessation and bud formation and are the most likely candidates for control of the evg phenotype.

  11. Protective Effect of White-fleshed Peach (Prunus persica (L.) Batsch) on Chronic Nicotine-induced Toxicity.

    Science.gov (United States)

    Kim, Hyun-Jeong; Park, Kwang-Kyun; Chung, Won-Yoon; Lee, Sun Kyoung; Kim, Ki-Rim

    2017-03-01

    Nicotine is a major toxic component of tobacco smoke and has been recognized as a risk factor to induce oxidative tissue damage, which is a precursor to cardiovascular diseases, lung-related diseases, and cancers. Peaches (Prunus persica) have been used for the treatment of degenerative disorders, such as hypermenorrhea, dysmenorrhea, and infertility in Asian countries. In this study, we investigated the effects of white-fleshed peach on the excretion of nicotine metabolites and 1-hydroxypyrene in smokers and chronic nicotine-induced tissue damages in mice. The concentrations of cotinine and 1-hydroxypyrene were measured in urine of smokers before or after intake of white-fleshed peaches. In addition, ICR mice were injected with nicotine (5 mg/kg body weight) and then orally administered with white-fleshed peach extracts (WFPE) (250 or 500 mg/kg body weight) for 36 days. The oxidative stress parameters and the activities of antioxidant enzymes were measured in liver and kidney tissues. Also, histological changes and nitrotyrosine expression were assessed. Intake of white-fleshed peaches increased the urinary concentration of nicotine metabolites and 1-hydroxypyrene in 91.67% and 83.33% of smokers, respectively. WFPE decreased the malondialdehyde levels and recovered the activities of antioxidant enzymes in nicotine-injected mice. In addition, WFPE inhibited nitrotyrosine expression and inflammatory responses in the liver, kidney, and lung tissues of nicotine-treated mice. White-fleshed peaches may increase the metabolism of toxic components in tobacco smoke in smokers and protect normal tissues against nicotine toxicity in mice. Therefore, supplementation of white-fleshed peaches might be beneficial to smokers.

  12. Perspectives of breeding fungal diseases resistant cultivars of nectarine (Prunus persica (L. Batsch. subsp. nectarina (Ait. Shof.

    Directory of Open Access Journals (Sweden)

    Є. П. Шоферістов

    2014-03-01

    Full Text Available There are allocated some forms of distant hybrids with weak degree of fungal diseases lesion (Taphrina deformans (Berk. Tul., Sphaerotheca pannosa (Lev. var. persicae Woron., Clasterosporium carpophilum Aderh., Monilia cinerea Bonord. и Monilia fructigena Fr. that are of practical interest for breeding such cultivars of peach and nectarine that will resist these pathogens.

  13. Evaluación productiva, económica y social del agua de riego de durazno (Prunus persica L. Batsch en Zacatecas (México

    Directory of Open Access Journals (Sweden)

    José Luis Ríos-Flores

    2015-01-01

    Full Text Available La escasez de agua limita la agricultura, por lo que su uso debe ser más eficiente en la producción de alimentos. El objetivo de este trabajo fue determinar la productividad económica, física y social del agua del cultivo de durazno (Prunus persica L. Batsch, en la región del Distrito de Desarrollo Rural 183 —correspondiente a Fresnillo, Zacatecas— para el ciclo 2012; se desarrollaron modelos matemáticos para estimar la productividad y eficiencia del agua. En Zacatecas se cosecharon 817 ha de durazno; mismas que produjeron 3,954.1 t; con un valor de $32.79 millones de pesos, utilizando un total de 8.17 Mm3 en todo el estado; mientras que en el DDR183-Fresnillo (compuesto por los municipios Fresnillo y Valparaíso se emplearon 3.39 Mm3. La determinación de la huella hídrica azul mostró que, por cada kg de durazno se emplearon 2,066 L en Zacatecas, 2,000 L en Fresnillo, y 1,851 L en Valparaíso. En cuanto al ingreso por metro cúbico, se determinó que en Zacatecas se obtuvo un ingreso de $4.01 m-3, $4.38 m-3 en Fresnillo y $4.83 m-3 en Valparaíso. Mientras, la productividad laboral en Zacatecas fue 97.53 h t-1, en Fresnillo 94.40 h t-1, y en Valparaíso 87.35 h t-1. El trabajador adscrito a la producción de durazno en Zacatecas generó $97.53 h-1, en Fresnillo $94.40 h-1, y $87.35 h-1 en Valparaíso. La producción de durazno en Valparaíso resultó altamente eficiente y productiva, lo que se tradujo en una menor huella hídrica; ello promueve la sustentabilidad del recurso agua en esa región.

  14. Flutuação populacional e previsão de gerações de Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae em pessegueiro, Prunus persica (Linnaeus Batsch = Populational fluctuation and generation prediction of Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae in peach, Prunus persica (Linnaeus Batsch

    Directory of Open Access Journals (Sweden)

    Francisco Jorge Cividanes

    2006-07-01

    Full Text Available A mariposa-oriental, Grapholita molesta (Busck, 1916, encontra-se distribuída em quase todas as partes do mundo, constituindo importante praga do pessegueiro, Prunus persica (Linnaeus Batsch. Este estudo foi desenvolvido em pomar comercial de pessegueiro localizado em Taiúva, São Paulo, durante os anos 1997 a 2003, visando obter a flutuação populacional de adultos de G. molesta relacionando-a com fatores meteorológicos. O estudo também visou determinar uma data biofix adequada para prever a ocorrência de gerações da praga por meio de um modelo de graus-dia. A amostragem da mariposa-oriental e de insetos predadores foi efetuada com armadilha plástica com suco de pêssego e armadilha adesiva amarela, respectivamente. A influência de fatores físicos e biológicos foi avaliada por análise de correlação linear simples. Os maiores picos populacionais de G. molesta ocorreram nos meses de maio, julho e outubro. As correlações obtidas sugerem que a baixa umidade ambiental pode ter sido fator de mortalidade para G. molesta. O elevado número de pulverizações de inseticida pode ter causado impacto negativo sobre inimigos naturais contribuindo para a elevada densidade do inseto-praga no período de 1998 a 1999. A data de constatação dapresença de gemas vegetativas e de flor diferenciadas no pessegueiro mostrou-se adequada para se iniciar a contagem de graus-dia para prever gerações de G. molesta. Esses resultados devem ajudar aimplementação de programas para prever picos populacionais de adultos de G. molesta visando à aplicação de inseticidas. Recomenda-se a validação do modelo de graus-dia em outras localidades para comprovar os resultados obtidos.The oriental fruit moth, Grapholita molesta (Busck, 1916, is spread around the world and is considered an important pest on peach, Prunus persica (Linnaeus Batsch. This work was carried out at a commercial peach orchard located in Taiúva, State of São Paulo, Brazil, from 1997 to

  15. Atividade da peroxidase durante o período hibernal de plantas de pessegueiro (Prunus persica (L. Batsch. cv. jubileu com e sem sintomas da morte precoce Peroxidase activity during the rest period of peach trees (Prunus persica (L. Batsch cv. jubileu in plants with and without symptoms ofpeach-tree-short-life (PTSL

    Directory of Open Access Journals (Sweden)

    Anderson Carlos Marafon

    2009-12-01

    Full Text Available A morte precoce do pessegueiro (Prunus persica (L. Batsch é uma síndrome caracterizada por um colapso da planta durante a floração ou no início da brotação, após drástica redução da temperatura. O objetivo do presente trabalho foi determinar a atividade da peroxidase (UE min-1 g-1 MF durante o período hibernal, em gemas e ramos de plantas de pessegueiro cv. Jubileu, com e sem sintomas de morte precoce. Foram conduzidos dois experimentos separadamente, um para cada tipo de tecido, em dois pomares próximos, ambos com quatro anos de implantação, situados na região colonial de Pelotas - RS, nas localidades de Santa Helena e Cascata. As amostras foram constituídas por dois tipos de tecidos (gemas e ramos e foram coletadas em quatro datas (11-06, 11-07, 29-07 e 05-08 durante o inverno de 2003. As determinações da atividade da peroxidase nos tecidos foram realizadas no Laboratório de Fisiologia Vegetal da Embrapa Clima Temperado. As plantas com sintomas de morte precoce apresentaram, durante a dormência, maior atividade da peroxidase nos dois tipos de tecidos, quando comparadas com as plantas sem sintomas da síndrome. Provavelmente, o desencadeamento da síndrome provoca alterações na dormência das plantas afetadas, que resultam na antecipação da retomada do crescimento das gemas e na exposição dos tecidos recém-formados aos danos causados pelas baixas temperaturas. Os níveis populacionais donematoide-anelado (Mesocriconema xenoplax e dos nematoides do gênero Helicotylenchus sp. foram superiores nas amostras de solo coletadas na rizosfera das plantas com sintomas de morte precoce do que os verificados nas amostras coletadas das plantas sem sintomas da síndrome, resultando também na maior atividade da peroxidase em ambos os tecidos (gemas e ramos, durante o período hibernal das plantas afetadas.Peach Tree Short Life (PTSL is a syndrome characterized by a collapse of the peach trees (Prunus persica (L. Batsch during the

  16. LA RELACIÓN HOJA: FRUTO AFECTA LA PRODUCCIÓN, EL CRECIMIENTO Y LA CALIDAD DEL FRUTO EN DURAZNERO (Prunus persica L. Batsch, cv. ‘Rubidoux’ LEAF TO FRUIT RATIO AFFECTS YIELD, FRUIT GROWTH AND FRUIT QUALITY OF PEACH (Prunus persica L. Batsch, cv. ‘Rubidoux’

    Directory of Open Access Journals (Sweden)

    Fánor Casierra-Posada

    2007-06-01

    Full Text Available El raleo de frutos es un práctica agrícola común en los árboles de melocotón con miras a una cosecha moderada a abundante. Sin embargo, a pesar de las muchas ventajas del raleo, demostradas a lo largo de años de experiencia en la zona templada, esta práctica es a menudo una de las operaciones conducidas de manera ineficiente en el cultivo del duraznero. Árboles de duraznero (Prunus persica L. Batsch cv. ‘Rubidoux’ se ralearon manualmente con el objeto de mejorar la calidad comercial del fruto. Se evaluaron los cambios en el crecimiento del fruto, los sólidos solubles totales, la relación pulpa: semilla, la producción, la calidad del fruto y el diámetro de la fruta, durante una temporada de crecimiento de los frutos según el efecto de la relación hoja: fruto (10; 20; 30; 40 y 50 hojas por fruto, en Guasca - Cundinamarca - Colombia. El raleo se realizó 85 días después de plena floración. Los árboles del tratamiento control no se ralearon. Se observaron diferencias en las curvas de crecimiento del fruto, en el promedio de fruto cosechado, en el peso fresco de los frutos y en su calidad comercial. El contenido de sólidos solubles totales en los frutos y la relación pulpa:semilla aumentaron con el raleo. Al momento de la cosecha, la producción se redujo en los árboles raleados, pero se mejoró la cantidad del fruto comercial. Los tratamientos con 40 y 50 hojas por fruto tuvieron la mayor proporción de frutos de mejor calidad en comparación con los árboles control.Fruit thinning is a standard practice on peach trees carrying a moderate to heavy crop. However, in spite of the many benefits from thinning demostrated through long years of experience in the temperate zone, fruit thinning is too often one of the most unefficiently conducted operations in peach growing. With a view to improve marketable yield and fruit quality, trees of peach (Prunus persica L. Batsch cv. ‘Rubidoux’ were subjected to hand thinning. Changes

  17. Effect prediction of identified SNPs linked to fruit quality and chilling injury in peach [Prunus persica (L.) Batsch].

    Science.gov (United States)

    Martínez-García, Pedro J; Fresnedo-Ramírez, Jonathan; Parfitt, Dan E; Gradziel, Thomas M; Crisosto, Carlos H

    2013-01-01

    Single nucleotide polymorphisms (SNPs) are a fundamental source of genomic variation. Large SNP panels have been developed for Prunus species. Fruit quality traits are essential peach breeding program objectives since they determine consumer acceptance, fruit consumption, industry trends and cultivar adoption. For many cultivars, these traits are negatively impacted by cold storage, used to extend fruit market life. The major symptoms of chilling injury are lack of flavor, off flavor, mealiness, flesh browning, and flesh bleeding. A set of 1,109 SNPs was mapped previously and 67 were linked with these complex traits. The prediction of the effects associated with these SNPs on downstream products from the 'peach v1.0' genome sequence was carried out. A total of 2,163 effects were detected, 282 effects (non-synonymous, synonymous or stop codon gained) were located in exonic regions (13.04 %) and 294 placed in intronic regions (13.59 %). An extended list of genes and proteins that could be related to these traits was developed. Two SNP markers that explain a high percentage of the observed phenotypic variance, UCD_SNP_1084 and UCD_SNP_46, are associated with zinc finger (C3HC4-type RING finger) family protein and AOX1A (alternative oxidase 1a) protein groups, respectively. In addition, phenotypic variation suggests that the observed polymorphism for SNP UCD_SNP_1084 [A/G] mutation could be a candidate quantitative trait nucleotide affecting quantitative trait loci for mealiness. The interaction and expression of affected proteins could explain the variation observed in each individual and facilitate understanding of gene regulatory networks for fruit quality traits in peach.

  18. The contribution of stored malate and citrate to the substrate requirements of metabolism of ripening peach (Prunus persica L. Batsch) flesh is negligible. Implications for the occurrence of phosphoenolpyruvate carboxykinase and gluconeogenesis.

    Science.gov (United States)

    Famiani, Franco; Farinelli, Daniela; Moscatello, Stefano; Battistelli, Alberto; Leegood, Richard C; Walker, Robert P

    2016-04-01

    The first aim of this study was to determine the contribution of stored malate and citrate to the substrate requirements of metabolism in the ripening flesh of the peach (Prunus persica L. Batsch) cultivar Adriatica. In the flesh, stored malate accumulated before ripening could contribute little or nothing to the net substrate requirements of metabolism. This was because there was synthesis and not dissimilation of malate throughout ripening. Stored citrate could potentially contribute a very small amount (about 5.8%) of the substrate required by metabolism when the whole ripening period was considered, and a maximum of about 7.5% over the latter part of ripening. The second aim of this study was to investigate why phosphoenolpyruvate carboxykinase (PEPCK) an enzyme utilised in gluconeogenesis from malate and citrate is present in peach flesh. The occurrence and localisation of enzymes utilised in the metabolism of malate, citrate and amino acids were determined in peach flesh throughout its development. Phosphoenolpyruvate carboxylase (essential for the synthesis of malate and citrate) was present in the same cells and at the same time as PEPCK and NADP-malic enzyme (both utilised in the dissimilation of malate and citrate). A hypothesis is presented to explain the presence of these enzymes and to account for the likely occurrence of gluconeogenesis. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  19. The peach (Prunus persica L. Batsch) genome harbours 10 KNOX genes, which are differentially expressed in stem development, and the class 1 KNOPE1 regulates elongation and lignification during primary growth.

    Science.gov (United States)

    Testone, Giulio; Condello, Emiliano; Verde, Ignazio; Nicolodi, Chiara; Caboni, Emilia; Dettori, Maria Teresa; Vendramin, Elisa; Bruno, Leonardo; Bitonti, Maria Beatrice; Mele, Giovanni; Giannino, Donato

    2012-09-01

    The KNOTTED-like (KNOX) genes encode homeodomain transcription factors and regulate several processes of plant organ development. The peach (Prunus persica L. Batsch) genome was found to contain 10 KNOX members (KNOPE genes); six of them were experimentally located on the Prunus reference map and the class 1 KNOPE1 was found to link to a quantitative trait locus (QTL) for the internode length in the peach×Ferganensis population. All the KNOPE genes were differentially transcribed in the internodes of growing shoots; the KNOPE1 mRNA abundance decreased progressively from primary (elongation) to secondary growth (radial expansion). During primary growth, the KNOPE1 mRNA was localized in the cortex and in the procambium/metaphloem zones, whereas it was undetected in incipient phloem and xylem fibres. KNOPE1 overexpression in the Arabidopsis bp4 loss-of-function background (35S:KNOPE1/bp genotype) restored the rachis length, suggesting, together with the QTL association, a role for KNOPE1 in peach shoot elongation. Several lignin biosynthesis genes were up-regulated in the bp4 internodes but repressed in the 35S:KNOPE1/bp lines similarly to the wild type. Moreover, the lignin deposition pattern of the 35S:KNOPE1/bp and the wild-type internodes were the same. The KNOPE1 protein was found to recognize in vitro one of the typical KNOX DNA-binding sites that recurred in peach and Arabidopsis lignin genes. KNOPE1 expression was inversely correlated with that of lignin genes and lignin deposition along the peach shoot stems and was down-regulated in lignifying vascular tissues. These data strongly support that KNOPE1 prevents cell lignification by repressing lignin genes during peach stem primary growth.

  20. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch) grown in the field and sugar beet (Beta vulgaris L.) grown in hydroponics.

    Science.gov (United States)

    El-Jendoubi, Hamdi; Vázquez, Saúl; Calatayud, Angeles; Vavpetič, Primož; Vogel-Mikuš, Katarina; Pelicon, Primož; Abadía, Javier; Abadía, Anunciación; Morales, Fermín

    2014-01-01

    Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch) trees grown in the field and sugar beet (Beta vulgaris L. cv. "Orbis") grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated) and basal (untreated) leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume) and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  1. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch grown in the field and sugar beet (Beta vulgaris L. grown in hydroponics

    Directory of Open Access Journals (Sweden)

    Hamdi eEl-Jendoubi

    2014-01-01

    Full Text Available Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch trees grown in the field and sugar beet (Beta vulgaris L. cv. ‘Orbis’ grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated and basal (untreated leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  2. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch) grown in the field and sugar beet (Beta vulgaris L.) grown in hydroponics

    Science.gov (United States)

    El-Jendoubi, Hamdi; Vázquez, Saúl; Calatayud, Ángeles; Vavpetič, Primož; Vogel-Mikuš, Katarina; Pelicon, Primož; Abadía, Javier; Abadía, Anunciación; Morales, Fermín

    2014-01-01

    Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch) trees grown in the field and sugar beet (Beta vulgaris L. cv. “Orbis”) grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated) and basal (untreated) leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume) and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs. PMID:24478782

  3. Peach (Prunus persica L.).

    Science.gov (United States)

    Sabbadini, Silvia; Pandolfini, Tiziana; Girolomini, Luca; Molesini, Barbara; Navacchi, Oriano

    2015-01-01

    Until now, the application of genetic transformation techniques in peach has been limited by the difficulties in developing efficient regeneration and transformation protocols. Here we describe an efficient regeneration protocol for the commercial micropropagation of GF677 rootstock (Prunus persica × Prunus amygdalus). The method is based on the production, via organogenesis, of meristematic bulk tissues characterized by a high competence for shoot regeneration. This protocol has also been used to obtain GF677 plants genetically engineered with an empty hairpin cassette (hereafter indicated as hp-pBin19), through Agrobacterium tumefaciens-mediated transformation. After 7-8 months of selection on media containing kanamycin, we obtained two genetically modified GF677 lines. PCR and Southern blot analyses were performed to confirm the genetic status.

  4. Development of sequence-tagged site markers linked to the pillar growth type in peach (Prunus persica)

    Science.gov (United States)

    In peach [Prunus persica (L.) Batsch], trees showing columnar [also termed pillar or broomy] growth habit are of interest for high density production systems. While the selection of the columnar homozygote (pillar) phenotype (brbr) can be carried out prior to field planting, the intermediate hetero...

  5. Treated Dixiland Prunus persica Fruits: Common and Distinct Response to Heat and Cold

    OpenAIRE

    Lauxmann, Martin Alexander; Brun, Bianca; Borsani, Julia; Bustamante, Claudia Anabel; Budde, Claudio; Lara, Maria Valeria; Drincovich, Maria Fabiana

    2017-01-01

    Cold storage is extensively used to slow the rapid deterioration of peach (Prunus persica L. Batsch) fruit after harvest. However, peach fruit subjected to long periods of cold storage develop chilling injury (CI) symptoms. Post-harvest heat treatment (HT) of peach fruit prior to cold storage is effective in reducing some CI symptoms, maintaining fruit quality, preventing softening and controlling post-harvest diseases. To identify the molecular changes induced by HT, which may be associated ...

  6. Variation in resistance mechanisms to the green peach aphid among different Prunus persica commercial cultivars.

    Science.gov (United States)

    Verdugo, J A; Méndez, T; Ortiz-Martínez, S A; Cumsille, R; Ramírez, C C

    2012-10-01

    ABSTRACT Peaches and nectarines are frequently attacked by the green peach aphid Myzus persicae (Sulzer), with significant negative impacts on fruit production. The genetic variability of resistance to this aphid among commercial cultivars of Prunus persica (L.) Batsch and Prunus persica variety nectarina was evaluated in this study. In total, 16 cultivars of P. persica were selected to evaluate the occurrence and population growth rate of M. persicae in commercial orchards, as well as in no-choice and probing behavior laboratory assays. The results showed variability between cultivars in resistance and susceptibility to M. persicae, with three cultivars exhibiting different signatures of resistance. The peach cultivar 'Elegant Lady' exhibited a low occurrence of aphids in the orchard, a low rate of growth, moderate leaf-rejection in a no-choice test and a higher number and longer period of salivation into sieve elements, suggesting resistance at the phloematic level. The nectarine cultivar 'August Red' also exhibited low aphid occurrence in the orchard, a low rate of growth, and resistance at the prephloem and phloem levels. Finally, the nectarine 'July Red-NS92' exhibited a low occurrence of aphids in the orchard, a higher number of rejections in no-choice assays and no ingestion of phloem during the probing behavior experiments, suggesting prephloematic resistance. The rest of the cultivars studied exhibited clear susceptibility. Hence, different resistance mechanisms are apparent among the studied cultivars. The information gathered in this study regarding the resistance to M. persicae may assist breeding programs aimed at increasing aphid resistance to peaches and nectarines.

  7. Improvement of Root System Architecture in Peach (Prunus persica) Seedlings by Arbuscular Mycorrhizal Fungi, Related to Allocation of Glucose/Sucrose to Root

    OpenAIRE

    Wu, Qiang-Sheng; Guo-Huai LI; Zou, Ying-Ning

    2011-01-01

    Root system architecture (RSA) is used to describe the spatial configuration of a root system in the soil, which substantially determines the capacity of a plant to take up nutrients and water. The present study was to assess if arbuscular mycorrhizal fungi (AMF), Glomus mosseae, G. versiforme, and Paraglomus occultum would alter RSA of peach (Prunus persica L. Batsch) seedlings, and the alteration due to mycorrhization was related to allocation of glucose/sucrose to root (Aglucose/sucrose). ...

  8. Fluidized bed combustion residue as an alternative liming material and Ca source. [Prunus persica

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, J.H.; Horton, B.D.; White, A.W. Jr.; Bennett, O.L.

    1985-01-01

    Fluidized bed combustion residue (FBCR), a by-product of fossil fuel fired boilers, was evaluated as a liming material and a source of calcium for peaches (Prunus persica (L.) Batsch). Incubation studies involving a medium textured soil indicated that FBCR (calcite (FBCRC) or dolomitic (FBCRD) sources) was as effective a liming amendment as the respective agricultural limestone. Maximum soil pH occurred after 26 days incubation with FBCRC, but soil pH increased continuously throughout 137 days incubation with dolomitic limestone. Ammonium acetate extractable Ca was not affected by calcitic source, but Mg concentration increased with rates with the two dolomitic sources, and was highest in the FBCRD source after 137 days incubation. In greenhouse studies with Elberta peach seedlings, FBCRC was more effective in neutralizing soil acidity and increasing extractable soil Ca than calcitic limestone.

  9. Field assessment of vulnerability to fungi diseases of varieties and forms of nectarine (Prunus persica (L. Batsch. subsp. nectarina (Ait. Shof. displaying male sterility characteristic from Niktskyi Botanic Garden collection

    Directory of Open Access Journals (Sweden)

    Ю. О. Іващенко

    2012-07-01

    Full Text Available The varieties and forms of nectarine resistant to fungi diseases (Clasterosporium carpophilum (Lev. Aderh., Taphrina deformans Tul., Sphaerotheca pannosa (Wallr. Fr. Lev. var. persicae Woronich having the practical interest for modern technology growing and for breeding on these characteristics have been selected.

  10. DETERMINATION OF A MATHEMATICAL MODEL TO ESTIMATE THE AREA AND DRY WEIGHT OF THE LEAF LIMBO OF Prunus persica CV. Jarillo DETERMINACIÓN DE UN MODELO MATEMÁTICO PARA LA ESTIMACIÓN DEL ÁREA FOLIAR Y PESO SECO DEL LIMBO DE Prunus persica CV. Jarillo

    OpenAIRE

    Enrique Quevedo García; Martha Esperanza Arévalo González; Giovanni Orlando Cancino Escalante

    2012-01-01

    Abstract. A study was conducted to determine the variables that estimated the leaf limbo area and the leaf limbo dry weight of peach Prunus persica (L.) Batsch cv. Jarillo. Fifty leaves, aged 2.5 months, were selected and measured: leaf limbo length and width, petiole length, leaf length, petiole diameter, leaf limbo fresh weight, petiole fresh weight, leaf fresh weight, leaf limbo dry weight, petiole dry weight, leaf dry weight, length/width limbo, petiole length/limbo length and leaf limbo ...

  11. Determination of a mathematical model to estimate the area and dry weight of the leaf limbo of prunus persica cv. jarillo / determinación de un modelo matemático para la estimación del área foliar y peso seco del limbo de prunus persica cv. jarillo

    OpenAIRE

    Quevedo García, Enrique; Arévalo González, Martha Esperanza; Cancino Escalante, Giovanni Orlando

    2013-01-01

    study was conducted to determine the variables that estimated the leaf limbo area and the leaf limbo dry weight of peach Prunus persica (L.) Batsch cv. Jarillo. Fifty leaves, aged 2.5 months, were selected and measured: leaf limbo length and width, petiole length, leaf length, petiole diameter, leaf limbo fresh weight, petiole fresh weight, leaf fresh weight, leaf limbo dry weight, petiole dry weight, leaf dry weight, length/ width limbo, petiole length/limbo length and leaf limbo area. Th...

  12. Caracterización con RAMs de la colección de durazno (Prunus persica L. Batsch) existente en la Universidad Pedagógica y Tecnológica de Colombia

    OpenAIRE

    Ana Cruz Morillo Coronado; Yacenia Morillo Coronado; Elberth Hernando Pinzón Sandoval

    2014-01-01

    Utilizando ocho cebadores Microsatélites Amplificados al Azar (RAMs) fue evaluada la diversidad genética de 31 materiales de Prunus de la colección de caducifolios existente en la Universidad Pedagógica y Tecnológica de Colombia. Se generaron un total de 121 amplicones con pesos moleculares entre 260 y 1000 Kb. Con un coeficiente de similitud de 0.75, se formaron tres grupos, de acuerdo principalmente con las características del fruto, encontrando en el grupo 2 las variedades de importancia e...

  13. Caracterización con rams de la colección de durazno (prunus persica (l.) batsch existente en la universidad pedagógica y tecnológica de colombia

    OpenAIRE

    Morillo Coronado, Ana Cruz; Morillo Coronado, Yacenia; Pinzón Sandoval, Elberth Hernando

    2014-01-01

    Utilizando ocho cebadores Microsatélites Amplificados al Azar (RAMs) fue evaluada la diversidad genética de 31 materiales de Prunus de la colección de caducifolios existente en la Universidad Pedagógica y Tecnológica de Colombia. Se generaron un total de 121 amplicones con pesos moleculares entre 260 y 1000 Kb. Con un coeficiente de similaridad de a 0.75 se formaron tres grupos, de acuerdo principalmente con las características del fruto, encontrando en el grupo 2 las variedades de importan...

  14. Caracterización con RAMs de la colección de durazno (Prunus persica L. Batsch existente en la Universidad Pedagógica y Tecnológica de Colombia

    Directory of Open Access Journals (Sweden)

    Ana Cruz Morillo Coronado

    2014-12-01

    Full Text Available Utilizando ocho cebadores Microsatélites Amplificados al Azar (RAMs fue evaluada la diversidad genética de 31 materiales de Prunus de la colección de caducifolios existente en la Universidad Pedagógica y Tecnológica de Colombia. Se generaron un total de 121 amplicones con pesos moleculares entre 260 y 1000 Kb. Con un coeficiente de similitud de 0.75, se formaron tres grupos, de acuerdo principalmente con las características del fruto, encontrando en el grupo 2 las variedades de importancia económica. El número de loci polimórficos varió entre 5 y 16 para los cebadores GT y CCA, respectivamente. El valor promedio de heterocigosidad fue de 0.22, más bajo que los encontrados en otros estudios de diversidad genética en el género Prunus; por tanto, se deben buscar estrategias para incrementar la variabilidad genética de la colección como la introducción de nuevos materiales o híbridos interespecíficos. La técnica RAMs es útil para evaluar la diversidad genética en especies caducifolias.

  15. The peach (Prunus persica [L.] Batsch) homeobox gene KNOPE3, which encodes a class 2 knotted-like transcription factor, is regulated during leaf development and triggered by sugars.

    Science.gov (United States)

    Testone, Giulio; Condello, Emiliano; Verde, Ignazio; Caboni, Emilia; Iannelli, Maria Adelaide; Bruno, Leonardo; Mariotti, Domenico; Bitonti, Maria Beatrice; Giannino, Donato

    2009-07-01

    Class 1 KNOTTED1-like transcription factors (KNOX) are known to regulate plant development, whereas information on class 2 KNOX has been limited. The peach KNOPE3 gene was cloned, belonged to a family of few class 2 members and was located at 66 cM in the Prunus spp. G1 linkage-group. The mRNA localization was diversified in leaf, stem, flower and drupe, but recurred in all organ sieves, suggesting a role in sap nutrient transport. During leaf development, the mRNA earliest localized to primordia sieves and subsequently to mesophyll cells of growing leaves. Consistently, its abundance augmented with leaf expansion. The transcription was monitored in leaves responding to darkening, supply and transport block of sugars. It peaked at 4 h after darkness and dropped under prolonged obscurity, showing a similar kinetic to that of sucrose content variation. Feeding leaflets via the transpiration stream caused KNOPE3 up-regulation at 3 h after fructose, glucose and sucrose absorption and at 12 h after sorbitol. In girdling experiments, leaf KNOPE3 was triggered from 6 h onwards along with sucrose and sorbitol raise. Both the phloem-associated expression and sugar-specific gene modulation suggest that KNOPE3 may play a role in sugar translocation during the development of agro-relevant organs such as drupe.

  16. Association between Chloroplast and Mitochondrial DNA sequences in Chinese Prunus genotypes (Prunus persica, Prunus domestica, and Prunus avium).

    Science.gov (United States)

    Pervaiz, Tariq; Sun, Xin; Zhang, Yanyi; Tao, Ran; Zhang, Junhuan; Fang, Jinggui

    2015-01-16

    The nuclear DNA is conventionally used to assess the diversity and relatedness among different species, but variations at the DNA genome level has also been used to study the relationship among different organisms. In most species, mitochondrial and chloroplast genomes are inherited maternally; therefore it is anticipated that organelle DNA remains completely associated. Many research studies were conducted simultaneously on organelle genome. The objectives of this study was to analyze the genetic relationship between chloroplast and mitochondrial DNA in three Chinese Prunus genotypes viz., Prunus persica, Prunus domestica, and Prunus avium. We investigated the genetic diversity of Prunus genotypes using simple sequence repeat (SSR) markers relevant to the chloroplast and mitochondria. Most of the genotypes were genetically similar as revealed by phylogenetic analysis. The Y2 Wu Xing (Cherry) and L2 Hong Xin Li (Plum) genotypes have a high similarity index (0.89), followed by Zi Ye Li (0.85), whereas; L1 Tai Yang Li (plum) has the lowest genetic similarity (0.35). In case of cpSSR, Hong Tao (Peach) and L1 Tai Yang Li (Plum) genotypes demonstrated similarity index of 0.85 and Huang Tao has the lowest similarity index of 0.50. The mtSSR nucleotide sequence analysis revealed that each genotype has similar amplicon length (509 bp) except M5Y1 i.e., 505 bp with CCB256 primer; while in case of NAD6 primer, all genotypes showed different sizes. The MEHO (Peach), MEY1 (Cherry), MEL2 (Plum) and MEL1 (Plum) have 586 bps; while MEY2 (Cherry), MEZI (Plum) and MEHU (Peach) have 585, 584 and 566 bp, respectively. The CCB256 primer showed highly conserved sequences and minute single polymorphic nucleotides with no deletion or mutation. The cpSSR (ARCP511) microsatellites showed the harmonious amplicon length. The CZI (Plum), CHO (Peach) and CL1 (Plum) showed 182 bp; whileCHU (Peach), CY2 (Cherry), CL2 (Plum) and CY1 (Cherry) showed 181 bp amplicon lengths. These results

  17. Peach (Prunus persica) extract inhibits angiotensin II-induced signal transduction in vascular smooth muscle cells.

    Science.gov (United States)

    Kono, Ryohei; Okuno, Yoshiharu; Nakamura, Misa; Inada, Ken-ichi; Tokuda, Akihiko; Yamashita, Miki; Hidaka, Ryu; Utsunomiya, Hirotoshi

    2013-08-15

    Angiotensin II (Ang II) is a vasoactive hormone that has been implicated in cardiovascular diseases. Here, the effect of peach, Prunus persica L. Batsch, pulp extract on Ang II-induced intracellular Ca(2+) mobilization, reactive oxygen species (ROS) production and signal transduction events in cultured vascular smooth muscle cells (VSMCs) was investigated. Pretreatment of peach ethyl acetate extract inhibited Ang II-induced intracellular Ca(2+) elevation in VSMCs. Furthermore, Ang II-induced ROS generation, essential for signal transduction events, was diminished by the peach ethyl acetate extract. The peach ethyl acetate extract also attenuated the Ang II-induced phosphorylation of epidermal growth factor receptor and myosin phosphatase target subunit 1, both of which are associated with atherosclerosis and hypertension. These results suggest that peach ethyl acetate extract may have clinical potential for preventing cardiovascular diseases by interfering with Ang II-induced intracellular Ca(2+) elevation, the generation of ROS, and then blocking signal transduction events. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Identification of genes associated with bud dormancy release in Prunus persica by suppression subtractive hybridization.

    Science.gov (United States)

    Leida, Carmen; Terol, Javier; Martí, Gracia; Agustí, Manuel; Llácer, Gerardo; Badenes, María Luisa; Ríos, Gabino

    2010-05-01

    To better understand the molecular and physiological mechanisms underlying maintenance and release of seasonal bud dormancy in perennial trees, we identified differentially expressed genes during dormancy progression in reproductive buds from peach (Prunus persica [L.] Batsch) by suppression subtractive hybridization (SSH) and microarray hybridization. Four SSH libraries were constructed, which were respectively enriched in cDNA highly expressed in dormant buds (named DR), in dormancy-released buds (RD) and in the cultivars with different chilling requirement, 'Zincal 5' (ZS) and 'Springlady' (SZ), sampled after dormancy release. About 2500 clones picked from the four libraries were loaded on a glass microarray. Hybridization of microarrays with the final products of SSH procedure was performed in order to validate the selected clones that were effectively enriched in their respective sample. Nearly 400 positive clones were sequenced, which corresponded to 101 different unigenes with diverse functional annotation. We obtained DAM4, 5 and 6 genes coding for MADS-box transcription factors previously related to growth cessation and terminal bud formation in the evergrowing mutant of peach. Several other cDNAs are similar to dormancy factors described in other species, and others have been related to bud dormancy for the first time in this study. Quantitative reverse transcription polymerase chain reaction analysis confirmed differential expression of cDNAs coding for a Zn-finger transcription factor, a GRAS-like regulator, a DNA-binding protein and proteins similar to forisome subunits involved in the reversible occlusion of sieve elements in Fabaceae, among others.

  19. Molecular cloning and expression analysis of an arginine decarboxylase gene from peach (Prunus persica).

    Science.gov (United States)

    Liu, Ji Hong; Ban, Yusuke; Wen, Xiao-Peng; Nakajima, Ikuko; Moriguchi, Takaya

    2009-01-15

    Arginine decarboxylase (ADC), one of the enzymes responsible for putrescine (Put) biosynthesis, has been shown to be implicated in stress response. In the current paper attempts were made to clone and characterize a gene encoding ADC from peach (Prunus persica (L.) Batsch, 'Akatsuki'). Rapid amplification of cDNA ends (RACE) gave rise to a full-length ADC cDNA (PpADC) with a complete open reading frame of 2178 bp, encoding a 725 amino acid polypeptide. Homology search and sequence multi-alignment demonstrated that the deduced PpADC protein sequence shared a high identity with ADCs from other plants, including several highly conservative motifs and amino acids. Southern blotting indicated that PpADC existed in peach genome as a single gene. Expression levels of PpADC in different tissues of peach (P. persica 'Akatsuki') were spatially and developmentally regulated. Treatment of peach shoots from 'Mochizuki' with exogenous 5 mM Put, an indirect product of ADC, remarkably induced accumulation of PpADC mRNA. Transcripts of PpADC in peach leaves from 'Mochizuki' were quickly induced, either transiently or continuously, in response to dehydration, high salinity (200 mM NaCl), low temperature (4 degrees C) and heavy metal (150 microM CdCl(2)), but repressed by high temperature 37 degrees C) during a 2-day treatment, which changed in an opposite direction when the stresses were otherwise removed with the exception of CdCl(2) treatment. In addition, steady-state of PpADC mRNA could be also transiently up-regulated by abscisic acid (ABA) in 'Mochizuki' leaves. All of these, taken together, suggest that PpADC is a stress-responsive gene and can be considered as a potential target that is genetically manipulated so as to create novel germplasms with enhanced stress tolerance in the future.

  20. Assessment of Prunus persica fruit softening using a proteomics approach.

    Science.gov (United States)

    P, Ricardo Nilo; Campos-Vargas, Reinaldo; Orellana, Ariel

    2012-02-16

    Fruit ripening in Prunus persica involves a number of physiological changes, being one of the most significant the mesocarp softening in melting varieties. In order to get a better understanding of the molecular processes involved in this phenomenon, the protein accumulation patterns in firm and soft fruit of three peach and two nectarine melting flesh varieties were assessed using 2D gel analysis. A General Linear Model (GLM) two-way analysis of variance determined that 164 of the 621 protein spots analyzed displayed a differential accumulation associated with the softening process. Among them, only 14 proteins changed their accumulation in all the varieties assessed, including proteins mostly involved in carbohydrates and cell wall metabolism as well as fruit senescence. The analysis among varieties showed that 195 and 189 spots changed within the firm and soft fruit conditions, respectively. Despite the changes in relative abundance in the spot proteins, the proteome is conserved among varieties and during the transition from firm to soft fruit. Only two spots proteins exhibited a qualitative change in all the conditions assessed. These results are in agreement with the notion that Prunus persica commercial varieties have a narrow genetic background. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Comparative assessment of physicochemical properties of unripe peach (Prunus persica) and Japanese apricot (Prunus mume).

    Science.gov (United States)

    Kim, Hye-Ryun; Kim, Il-Doo; Dhungana, Sanjeev Kumar; Kim, Mi-Ok; Shin, Dong-Hyun

    2014-02-01

    To investigate the physicochemical properties of unripe peach-Prunus persica cv. Mibaekdo (Mibaekdo) and Prunus persica cv. Nagasawa Hakuho (Nagasawa Hakuho) as an alternative to food supplement while Japanese apricot (Prunus mume cv. Backaha) (Backaha) was used as a control sample. The unripe fruits were analyzed for soluble solid ( ˚Brix), titratable acidity, pH, total polyphenol content, 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging activity, amygdalin content, free amino acid content, organic acid content, free sugar content, and α-amylase activities. Total polyphenol content of unripe peach ranged between 137.27-151.64 µg/g whereas that of apricot was 160.73 µg/g. DPPH radical scavenging activities of Backaha was the highest (89.16%) followed by Mibaekdo (85.05%) and Nagasawa Hakuho (41.50%). The highest amount of oxalic acid (612.8 mg/100 g) was observed in Mibaekdo while that of Nagasawa Hakuho and Backaha were (184.6±18.1) and (334.8±16.1) mg/100 g, respectively. Amygdalin contents of Mibaekdo, Nagasawa Hakuho and Backaha were 486.61, 548.60 and 174.28 µg/g, respectively. The results suggest that the unripe fruit of peach has a significant biochemical potential of using as a food supplement with potential health benefit for human health.

  2. Comparative assessment of physicochemical properties of unripe peach (Prunus persica) and Japanese apricot (Prunus mume)

    Science.gov (United States)

    Kim, Hye-Ryun; Kim, Il-Doo; Dhungana, Sanjeev Kumar; Kim, Mi-Ok; Shin, Dong-Hyun

    2014-01-01

    Objective To investigate the physicochemical properties of unripe peach-Prunus persica cv. Mibaekdo (Mibaekdo) and Prunus persica cv. Nagasawa Hakuho (Nagasawa Hakuho) as an alternative to food supplement while Japanese apricot (Prunus mume cv. Backaha) (Backaha) was used as a control sample. Methods The unripe fruits were analyzed for soluble solid ( ˚Brix), titratable acidity, pH, total polyphenol content, 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging activity, amygdalin content, free amino acid content, organic acid content, free sugar content, and α-amylase activities. Results Total polyphenol content of unripe peach ranged between 137.27-151.64 µg/g whereas that of apricot was 160.73 µg/g. DPPH radical scavenging activities of Backaha was the highest (89.16%) followed by Mibaekdo (85.05%) and Nagasawa Hakuho (41.50%). The highest amount of oxalic acid (612.8 mg/100 g) was observed in Mibaekdo while that of Nagasawa Hakuho and Backaha were (184.6±18.1) and (334.8±16.1) mg/100 g, respectively. Amygdalin contents of Mibaekdo, Nagasawa Hakuho and Backaha were 486.61, 548.60 and 174.28 µg/g, respectively. Conclusions The results suggest that the unripe fruit of peach has a significant biochemical potential of using as a food supplement with potential health benefit for human health. PMID:25182279

  3. Transcriptional Responses in Root and Leaf of Prunus persica under Drought Stress Using RNA Sequencing.

    Science.gov (United States)

    Ksouri, Najla; Jiménez, Sergio; Wells, Christina E; Contreras-Moreira, Bruno; Gogorcena, Yolanda

    2016-01-01

    Prunus persica L. Batsch, or peach, is one of the most important crops and it is widely established in irrigated arid and semi-arid regions. However, due to variations in the climate and the increased aridity, drought has become a major constraint, causing crop losses worldwide. The use of drought-tolerant rootstocks in modern fruit production appears to be a useful method of alleviating water deficit problems. However, the transcriptomic variation and the major molecular mechanisms that underlie the adaptation of drought-tolerant rootstocks to water shortage remain unclear. Hence, in this study, high-throughput sequencing (RNA-seq) was performed to assess the transcriptomic changes and the key genes involved in the response to drought in root tissues (GF677 rootstock) and leaf tissues (graft, var. Catherina) subjected to 16 days of drought stress. In total, 12 RNA libraries were constructed and sequenced. This generated a total of 315 M raw reads from both tissues, which allowed the assembly of 22,079 and 17,854 genes associated with the root and leaf tissues, respectively. Subsets of 500 differentially expressed genes (DEGs) in roots and 236 in leaves were identified and functionally annotated with 56 gene ontology (GO) terms and 99 metabolic pathways, which were mostly associated with aminobenzoate degradation and phenylpropanoid biosynthesis. The GO analysis highlighted the biological functions that were exclusive to the root tissue, such as "locomotion," "hormone metabolic process," and "detection of stimulus," indicating the stress-buffering role of the GF677 rootstock. Furthermore, the complex regulatory network involved in the drought response was revealed, involving proteins that are associated with signaling transduction, transcription and hormone regulation, redox homeostasis, and frontline barriers. We identified two poorly characterized genes in P. persica: growth-regulating factor 5 (GRF5), which may be involved in cellular expansion, and AtHB12

  4. Peach (Prunus persica) fruit response to anoxia: reversible ripening delay and biochemical changes.

    Science.gov (United States)

    Lara, María V; Budde, Claudio O; Porrini, Lucía; Borsani, Julia; Murray, Ricardo; Andreo, Carlos S; Drincovich, María F

    2011-02-01

    The use of modified atmospheres has been successfully applied in different fruits to delay the ripening process and to prevent physiological disorders. In addition, during normal ripening, hypoxic areas are generated inside the fruit; moreover, anaerobic conditions may also arise during fruit post-harvest storage and handling. In consequence, the fruit is an interesting model to analyze the metabolic modifications due to changes in oxygen levels. In this work, a 72 h anoxic treatment by using an N(2) storage atmosphere was applied to peaches (Prunus persica L. Batsch) after harvest. Ripening was effectively delayed in treated fruits, preventing fruit softening, color changes and ethylene production. Metabolic changes induced by anoxia included induction of fermentative pathways, glycolysis and enzymes involved in both sucrose synthesis and degradation. Sucrose, fructose and glucose contents remained unchanged in treated fruit, probably due to sucrose cycling. Sorbitol was not consumed and citrate was increased, correlating with citric acid cycle impairment due to O(2) deprivation. Malate content was not affected, indicating compensation in the reactions producing and consuming malate. Changes in malic enzymes and pyruvate orthophosphate dikinase may provide pyruvate for fermentation or even act to regenerate NADP. After fruit transfer to aerobic conditions, no signs of post-anoxia injury were observed and metabolic changes were reversed, with the exception of acetaldehyde levels. The results obtained indicate that peach fruit is an organ with a high capacity for anoxic tolerance, which is in accord with the presence of hypoxic areas inside fruits and the fact that hypoxic pre-treatment improves tolerance to subsequent anoxia.

  5. Six-year performance of 14 Prunus rootstocks at 11 sites in the 2001 NC-140 peach trial

    Science.gov (United States)

    Fourteen Prunus rootstock cultivars and selections budded with either ‘Redtop’, ‘Redhaven’ or ‘Cresthaven’ peach [Prunus persica (L.) Batsch] were planted at 11 locations in North America in 2001 in a randomized block design with a tree spacing of 5 by 6 m and 8 replicates. This test planting was a...

  6. Genotypic differences in cyanogenic glycosides levels of compatible Prunus persica P. persica and incompatible P. persica P. mume combinations

    Directory of Open Access Journals (Sweden)

    Ivan dos Santos Pereira

    2017-12-01

    Full Text Available ABSTRACT Graft incompatibility is a phenomenon associated with complex physiological, biochemical, and genetic interactions between scion and rootstock. The main objective of this work was to assess the role of cyanogenic glycosides (CGs, amygdalin and prunasin, in the graft incompatibility of Prunus and possible biochemical effects in compounds of the phenylpropanoid pathway. Graft compatibility, amygdalin and prunasin content, phenylalanine ammonia-lyase activity, total phenolic compounds content and antioxidant activity, were studied in different graft combinations (Chimarrita/Capdeboscq; Chimarrita/Tsukuba 1; Chimarrita/Umezeiro; Maciel/Capdeboscq; Maciel/’Tsukuba 1; Maciel/Umezeiro and ungrafted genotypes. The results indicate that there was graft incompatibility of Chimarrita and Maciel cultivars grafted into Umezeiro rootstock. Combinations identified as incompatible showed higher prunasin concentration and phenylalanine ammonialyase (PAL activity in rootstock and greater concentration of total phenolics compounds and antioxidant activity in scion and rootstock. The results indicate that large differences in CGs concentration, especially prunasin, can be the graft incompatibility cause between Prunus persic. and P. mume. The prunasin concentration may be considered a promising marker to predict graft compatibility between P. persica and P. mume.

  7. Effect of aqueous sprays of ammonium fluoride on oxygen consumption and firmness of suture and dorsal tissues of Early Improved Elberta peaches. [Prunus persica

    Energy Technology Data Exchange (ETDEWEB)

    Facteau, T.J.; Rowe, K.E.

    1976-06-01

    Aqueous ammonium fluoride (NH/sub 4/F) sprays on Early Improved Elberta peaches (Prunus persica (L.) Batsch) resulted in increased O/sub 2/ consumption of suture tissue and inconsistent changes in O/sub 2/ consumption of dorsal tissue as the spray concentration was increased. Flesh firmness on the suture side of treated fruit was less than non-sprayed fruit and decreased as either the NH/sub 4/F spray concentration or number of sprays increased. The effect of spray on the dorsal side differed from year to year. Levels of fluoride (F) in the fruit tissue were associated with F concentration and number of F sprays applied only within the same year. 3 references, 1 table.

  8. Anti-allergic inflammatory activity of the fruit of Prunus persica: role of calcium and NF-kappaB.

    Science.gov (United States)

    Shin, Tae-Yong; Park, Seung-Bin; Yoo, Jin-Su; Kim, In Kyeom; Lee, Hyun-Shik; Kwon, Taeg Kyu; Kim, Moon Kyu; Kim, Jung Chul; Kim, Sang-Hyun

    2010-10-01

    Mast cell-mediated allergic symptoms are involved in many diseases, such as asthma and sinusitis. In this study, we investigated the effect of ethanol extract of fruits of Prunus persica (L) Batsch (FPP) on the mast cell-mediated allergic inflammation and studied the possible mechanism of action. FPP dose-dependently inhibited compound 48/80-induced systemic anaphylaxis and immunoglobulin E-mediated local allergic reactions. Histamine releasing from mast cells was reduced by FPP, which was mediated by modulation of intracellular calcium. In addition, FPP attenuated the phorbol 12-myristate 13-acetate and calcium ionophore A23187 (PMACI)-stimulated expression and secretion of pro-inflammatory cytokines in human mast cells. The inhibitory effect of FPP on pro-inflammatory cytokines was nuclear factor (NF)-kappaB dependent. Our findings provide evidence that FPP inhibits mast cell-derived allergic inflammation and involvement of calcium and NF-kappaB in these effects. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  9. Dormancy in Peach (Prunus persica L.) Flower Buds 1

    Science.gov (United States)

    Luna, Virginia; Lorenzo, Eugenia; Reinoso, Herminda; Tordable, Maria C.; Abdala, Guillermina; Pharis, Richard P.; Bottini, Ruben

    1990-01-01

    Flower buds of peach (Prunus persica L.) trees, cv Novedad de Cordoba (Argentina), were collected near the end of the dormant period and immediately before anthesis. After removal of scale leaves, morphological observations of representative buds, made on transverse and longitudinal microtome sections, showed that all verticils making up the flower are present in an undifferentiated form during the dormant period (June). Flower buds collected at the end of dormant period (August) showed additional growth and differentiation, at which time formation of two ovules was beginning in the unicarpelar gynoecium. Dehiscence of anthers had not yet occurred 10 days before full bloom, and the ovules were still developing. Free endogenous gibberellin (GA)-like substances were quantified by bioassay (Tan-ginbozu dwarf rice microdrop) after SiO2 partition column chromatography, reversed phase C18-high performance liquid chromatography, and finally Nucleosil [N(CH3)2]high performance liquid chromatography. Bioactive fractions were then subjected to capillary gas chromatography-mass spectrometry-selected ion monitoring (GC-MS-SIM). Gibberellins A1, A3, and A8 were tentatively identified in peach flower buds using GC-SIM and Kovat's retention indices, and relative amounts approximated by GC-SIM (2:8:6 for GA1, GA3, and GA8, respectively). The highest concentration (330 nanograms per gram dry weight) of free GA1/GA3 was found in dormant buds (June) and diminished thereafter. The concentration free of GA1/GA3 did not increase immediately prior to bud break. However, high GA1/GA3 concentrations occurred during stages where rate of growth and cellular differentiation of (mainly fertile) verticils can be influenced. Images Figure 1 PMID:16667435

  10. Genome wide identification of chilling responsive microRNAs in Prunus persica.

    Science.gov (United States)

    Barakat, Abdelali; Sriram, Aditya; Park, Joseph; Zhebentyayeva, Tetyana; Main, Dorrie; Abbott, Albert

    2012-09-15

    MicroRNAs (miRNAs) are small RNAs (sRNAs) approximately 21 nucleotides in length that negatively control gene expression by cleaving or inhibiting the translation of target gene transcripts. Within this context, miRNAs and siRNAs are coming to the forefront as molecular mediators of gene regulation in plant responses to annual temperature cycling and cold stress. For this reason, we chose to identify and characterize the conserved and non-conserved miRNA component of peach (Prunus persica (L.) Batsch) focusing our efforts on both the recently released whole genome sequence of peach and sRNA transcriptome sequences from two tissues representing non-dormant leaves and dormant leaf buds. Conserved and non-conserved miRNAs, and their targets were identified. These sRNA resources were used to identify cold-responsive miRNAs whose gene targets co-localize with previously described QTLs for chilling requirement (CR). Analysis of 21 million peach sRNA reads allowed us to identify 157 and 230 conserved and non-conserved miRNA sequences. Among the non-conserved miRNAs, we identified 205 that seem to be specific to peach. Comparative genome analysis between peach and Arabidopsis showed that conserved miRNA families, with the exception of miR5021, are similar in size. Sixteen of these conserved miRNA families are deeply rooted in land plant phylogeny as they are present in mosses and/or lycophytes. Within the other conserved miRNA families, five families (miR1446, miR473, miR479, miR3629, and miR3627) were reported only in tree species (Populustrichocarpa, Citrus trifolia, and Prunus persica). Expression analysis identified several up-regulated or down-regulated miRNAs in winter buds versus young leaves. A search of the peach proteome allowed the prediction of target genes for most of the conserved miRNAs and a large fraction of non-conserved miRNAs. A fraction of predicted targets in peach have not been previously reported in other species. Several conserved and non

  11. Genome wide identification of chilling responsive microRNAs in Prunus persica

    Directory of Open Access Journals (Sweden)

    Barakat Abdelali

    2012-09-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small RNAs (sRNAs approximately 21 nucleotides in length that negatively control gene expression by cleaving or inhibiting the translation of target gene transcripts. Within this context, miRNAs and siRNAs are coming to the forefront as molecular mediators of gene regulation in plant responses to annual temperature cycling and cold stress. For this reason, we chose to identify and characterize the conserved and non-conserved miRNA component of peach (Prunus persica (L. Batsch focusing our efforts on both the recently released whole genome sequence of peach and sRNA transcriptome sequences from two tissues representing non-dormant leaves and dormant leaf buds. Conserved and non-conserved miRNAs, and their targets were identified. These sRNA resources were used to identify cold-responsive miRNAs whose gene targets co-localize with previously described QTLs for chilling requirement (CR. Results Analysis of 21 million peach sRNA reads allowed us to identify 157 and 230 conserved and non-conserved miRNA sequences. Among the non-conserved miRNAs, we identified 205 that seem to be specific to peach. Comparative genome analysis between peach and Arabidopsis showed that conserved miRNA families, with the exception of miR5021, are similar in size. Sixteen of these conserved miRNA families are deeply rooted in land plant phylogeny as they are present in mosses and/or lycophytes. Within the other conserved miRNA families, five families (miR1446, miR473, miR479, miR3629, and miR3627 were reported only in tree species (Populustrichocarpa, Citrus trifolia, and Prunus persica. Expression analysis identified several up-regulated or down-regulated miRNAs in winter buds versus young leaves. A search of the peach proteome allowed the prediction of target genes for most of the conserved miRNAs and a large fraction of non-conserved miRNAs. A fraction of predicted targets in peach have not been previously reported in other

  12. Phenotypic diversity among peach and nectarine (Prunus persica L.) fruit in the national prunus collection at the USDA-ARS, National Clonal Germplasm Repository (NCGR)

    Science.gov (United States)

    The diversity and relationships of fruit quality traits peach and nectarine (Prunus persica L.) in the National Prunus collection were studied using comprehensive phenotyping methods. The collection was re-propagated in 2013 and planted in 2014 providing a unique opportunity to evaluate an even-aged...

  13. Genética de la introgresión de genes del almendro (prunus dulcis Mill.) en el melocotonero [P. persica (l.) Batsch]: desarrollo de una estrategia de selección de líneas casi isogénicas (Nils) con marcadores moleculares

    OpenAIRE

    Donoso Contreras, José M.

    2014-01-01

    El melocotonero es el frutal de hueso más importante a nivel mundial, y el tercer árbol de fruta dulce cultivada después del manzano y el peral. A nivel genético es una de las especies mejor caracterizadas de la familia Rosaceae. El melocotonero presenta un bajo nivel de variabilidad genética pero es sexualmente compatible con otras especies de Prunus, como el almendro, los cuales podrían ser una posible fuente de nuevos genes para enriquecer su pool genético. Estudiamos un conjunto de caract...

  14. Anti-allergic inflammatory effects of cyanogenic and phenolic glycosides from the seed of Prunus persica.

    Science.gov (United States)

    Kim, Geum Jin; Choi, Hyun Gyu; Kim, Ji Hyang; Kim, Sang Hyun; Kim, Jeong Ah; Lee, Seung Ho

    2013-12-01

    A methanol extract of the seed of Prunus persica (Rosaceae) was found to inhibit histamine release in human mast cells. Activity-guided fractionation of the methanol extract yielded three cyanogenic glycosides (1-3) and other phenolic compounds (4-8). To evaluate their anti-allergic and anti-inflammatory activities, the isolates (1-8) were tested for their inhibitory effects on histamine release and on the gene expressions of tumor necrosis factor (TNF)-alpha and interleukin (IL)-6 in human mast cells. Of these, phenolic glycosides 7 and 8 suppressed histamine release and inhibited the pro-inflammatory cytokines TNF-alpha and IL-6. These results suggest that isolates from P. persica are among the anti-allergic inflammatory principles in this medicinal plant.

  15. Characterization and expression analysis of AGAMOUS-like, SEEDSTICK-like, and SEPALLATA-like MADS-box genes in peach (Prunus persica) fruit.

    Science.gov (United States)

    Tani, Eleni; Polidoros, Alexios N; Flemetakis, Emmanouil; Stedel, Catalina; Kalloniati, Chrissanthi; Demetriou, Kyproula; Katinakis, Panagiotis; Tsaftaris, Athanasios S

    2009-08-01

    MADS-box genes encode transcriptional regulators that are critical for flowering, flower organogenesis and plant development. Although there are extensive reports on genes involved in flower organogenesis in model and economically important plant species, there are few reports on MADS-box genes in woody plants. In this study, we have cloned and characterized AGAMOUS (AG), SEEDSTICK (STK) and SEPALLATA (SEP) homologs from peach tree (Prunus persica L. Batsch) and studied their expression patterns in different tissues as well as in fruit pericarp during pit hardening. AG- STK- and SEP-like homologs, representative of the C-, D-, E-like MADS-box gene lineages, respectively, play key roles in stamen, carpel, ovule and fruit development in Arabidopsis thaliana. Sequence similarities, phylogenetic analysis and structural characteristics were used to provide classification of the isolated genes in type C (PPERAG), type D (PPERSTK) and type E (PPERSEP1, PPERSEP3, PPERFB9) organ identity genes. Expression patterns were determined and in combination with phylogenetic data provided useful indications on the function of these genes. These data suggest the involvement of MADS-box genes in peach flower and fruit development and provide further evidence for the role of these genes in woody perennial trees that is compatible with their function in model plant species.

  16. Effects of iron chlorosis and iron resupply on leaf xylem architecture, water relations, gas exchange and stomatal performance of field-grown peach (Prunus persica).

    Science.gov (United States)

    Eichert, Thomas; Peguero-Pina, José Javier; Gil-Pelegrín, Eustaquio; Heredia, Antonio; Fernández, Victoria

    2010-01-01

    There is increasing evidence suggesting that iron (Fe) deficiency induces not only leaf chlorosis and a decline of photosynthesis, but also structural changes in leaf morphology, which might affect the functionality of leaves. In this study, we investigated the effects of Fe deficiency on the water relations of peach (Prunus persica (L.) Batsch.) leaves and the responses of previously chlorotic leaves to Fe resupply via the root or the leaf. Iron deficiency induced a decline of maximum potential photosystem II (PSII) efficiency (F(V)/F(M)), of rates of net photosynthesis and transpiration and of water use efficiency. Iron chlorosis was associated with a reduction of leaf xylem vessel size and of leaf hydraulic conductance. In the course of the day, water potentials in chlorotic leaves remained higher (less negative) than in green leaves. In chlorotic leaves, normal stomatal functioning was disturbed, as evidenced by the lack of opening upon withdrawal of external CO(2) and stomatal closure after sudden illumination of previously darkened leaves. We conclude that the Fe deficiency induced limitations of xylem conductivity elicited a water saving strategy, which poses an additional challenge to plant growth on high pH, calcareous soils. Fertilisation with Fe improved photosynthetic performance but the proper xylem structure and water relations of leaves were not fully restored, indicating that Fe must be available at the first stages of leaf growth and development.

  17. DETERMINATION OF A MATHEMATICAL MODEL TO ESTIMATE THE AREA AND DRY WEIGHT OF THE LEAF LIMBO OF Prunus persica CV. Jarillo DETERMINACIÓN DE UN MODELO MATEMÁTICO PARA LA ESTIMACIÓN DEL ÁREA FOLIAR Y PESO SECO DEL LIMBO DE Prunus persica CV. Jarillo

    Directory of Open Access Journals (Sweden)

    Enrique Quevedo García

    2012-06-01

    Full Text Available Abstract. A study was conducted to determine the variables that estimated the leaf limbo area and the leaf limbo dry weight of peach Prunus persica (L. Batsch cv. Jarillo. Fifty leaves, aged 2.5 months, were selected and measured: leaf limbo length and width, petiole length, leaf length, petiole diameter, leaf limbo fresh weight, petiole fresh weight, leaf fresh weight, leaf limbo dry weight, petiole dry weight, leaf dry weight, length/width limbo, petiole length/limbo length and leaf limbo area. The results allowed to obtain regression equations for estimating the leaf area and the limbo dry weight. Using the lineal models LA = b1 + b2 (LLL x LLW and LA= b1+ b2LLL + b3LLW a leaf area equation was determined. Alternative models to calculate limbo dry weight were evaluated LLDW = -b1+ b2 LLFW and LLDW= - b1 + b2LLL + b3PL. The best equations found with an R2 of 0.99 were LA = 1.572 + 0.65169(LLL x LLW, LA=-23.106+2.8064LLW + 3.6761LLL and LLDW = -0.002+0.401(LLFW.Resumen. Se realizó un estudio para determinar las variables que estimaran el área del limbo foliar y el peso seco del limbo de durazno Prunus persica (L. Batsch cv. Jarillo. Se seleccionaron cincuenta hojas con 2,5 meses de edad, fueron medidos: ancho del limbo, longitud del limbo, longitud del peciolo, longitud hoja, diámetro peciolo, peso fresco del limbo, peso fresco del peciolo, peso fresco de la hoja, peso seco del limbo, peso seco peciolo, peso seco de la hoja, longitud /ancho limbo, longitud del peciolo/longitud del limbo, área foliar del limbo. Los resultados alcanzados permitieron obtener ecuaciones de regresión para estimar el área foliar del limbo y el peso seco del limbo. Se halló una ecuación para la determinación del área foliar del limbo con los modelos lineales LA = b1 + b2 (LLL x LLW y LA= b1 + b2LLL + b3LLW. También se evaluaron modelos alternativas para calcular el peso seco del limbo, LLDW = -b1+ b2LLFW y LLDW= - b1 + b2LLL + b3PL. Las mejores ecuaciones

  18. Accelerated solvent extraction of carotenoids from: Tunisian Kaki (Diospyros kaki L.), peach (Prunus persica L.) and apricot (Prunus armeniaca L.).

    Science.gov (United States)

    Zaghdoudi, Khalil; Pontvianne, Steve; Framboisier, Xavier; Achard, Mathilde; Kudaibergenova, Rabiga; Ayadi-Trabelsi, Malika; Kalthoum-Cherif, Jamila; Vanderesse, Régis; Frochot, Céline; Guiavarc'h, Yann

    2015-10-01

    Extraction of carotenoids from biological matrices and quantifications remains a difficult task. Accelerated solvent extraction was used as an efficient extraction process for carotenoids extraction from three fruits cultivated in Tunisia: kaki (Diospyros kaki L.), peach (Prunus persica L.) and apricot (Prunus armeniaca L.). Based on a design of experiment (DoE) approach, and using a binary solvent consisting of methanol and tetrahydrofuran, we could identify the best extraction conditions as being 40°C, 20:80 (v:v) methanol/tetrahydrofuran and 5 min of extraction time. Surprisingly and likely due to the high extraction pressure used (103 bars), these conditions appeared to be the best ones both for extracting xanthophylls such as lutein, zeaxanthin or β-cryptoxanthin and carotenes such as β-carotene, which present quite different polarities. Twelve surface responses were generated for lutein, zeaxanthin, β-cryptoxanthin and β-carotene in kaki, peach and apricot. Further LC-MS analysis allowed comparisons in carotenoids profiles between the fruits. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Genome-Wide Analysis Characterization and Evolution of SBP Genes in Fragaria vesca, Pyrus bretschneideri, Prunus persica and Prunus mume

    Directory of Open Access Journals (Sweden)

    Muhammad Abdullah

    2018-03-01

    Full Text Available The SQUAMOSA promoter binding protein (SBP-box proteins are plant-specific transcriptional factors in plants. SBP TFs are known to play important functions in a diverse development process and also related in the process of evolutionary novelties. SBP gene family has been characterized in several plant species, but little is known about molecular evolution, functional divergence and comprehensive study of SBP gene family in Rosacea. We carried out genome-wide investigations and identified 14, 32, 17, and 17 SBP genes from four Rosacea species (Fragaria vesca, Pyrus bretschneideri, Prunus persica and Prunus mume, respectively. According to phylogenetic analysis arranged the SBP protein sequences in seven groups. Localization of SBP genes presented an uneven distribution on corresponding chromosomes of Rosacea species. Our analyses designated that the SBP genes duplication events (segmental and tandem and divergence. In addition, due to highly conserved structure pattern of SBP genes, recommended that highly conserved region of microsyneteny in the Rosacea species. Type I and II functional divergence was detected among various amino acids in SBP proteins, while there was no positive selection according to substitutional model analysis using PMAL software. These results recommended that the purifying selection might be leading force during the evolution process and dominate conservation of SBP genes in Rosacea species according to environmental selection pressure analysis. Our results will provide basic understanding and foundation for future research insights on the evolution of the SBP genes in Rosacea.

  20. Archaeological evidence for peach (Prunus persica) cultivation and domestication in China.

    Science.gov (United States)

    Zheng, Yunfei; Crawford, Gary W; Chen, Xugao

    2014-01-01

    The cultivated/domesticated peach (Prunus persica var. persica; Rosaceae, subgenus Amygdalus; synonym: Amygdalus persica) originated in China, but its wild ancestor, as well as where, when, and under what circumstances the peach was domesticated, is poorly known. Five populations of archaeological peach stones recovered from Zhejiang Province, China, document peach use and evolution beginning ca. 8000 BP. The majority of the archaeological sites from which the earliest peach stones have been recovered are from the Yangzi River valley, indicating that this is where early selection for favorable peach varieties likely took place. Furthermore, peach stone morphology through time is consistent with the hypothesis that an unknown wild P. persica was the ancestor of the cultivated peach. The oldest archaeological peach stones are from the Kuahuqiao (8000-7000 BP) and Tianluoshan (7000-6500 BP) sites and both stone samples segregate into two size groups, suggesting early selection of preferred types. The first peach stones in China most similar to modern cultivated forms are from the Liangzhu culture (ca. 5300 to 4300 BP), where the peach stones are significantly larger and more compressed than earlier stones. Similar peach stones are reported from Japan much earlier (6700-6400 BP). This large, compressed-stone peach was introduced to Japan and indicates a yet unidentified source population in China that was similar to the Liangzhu culture peach. This study proposes that the lower Yangzi River valley is a region, if not the region, of early peach selection and domestication and that the process began at least 7500 years ago.

  1. Evaluation of Antioxidant Compounds and Total Sugar Content in a Nectarine [Prunus persica (L. Batsch] Progeny

    Directory of Open Access Journals (Sweden)

    Yolanda Gogorcena

    2011-10-01

    Full Text Available Epidemiological studies suggest that consumption of fruit rich in phenolic compounds is associated with health-protective effects due to their antioxidant properties. For these reasons quality evaluation has become an important issue in fruit industry and in breeding programs. Phytochemical traits such as total phenolics, flavonoids, anthocyanins, L-ascorbic acid, sugar content and relative antioxidant capacity (RAC were analyzed over four years in flesh fruit of an F1 population “Venus” × “Big Top” nectarines. Other traits such as harvesting date, yield, fruit weight, firmness, soluble solids concentration (SSC, pH, titratable acidity (TA and ripening index (RI were also determined in the progeny. Results showed high variability among genotypes for all analyzed traits. Total phenolics and flavonoids showed significant positive correlations with RAC implying that both are important antioxidant bioactive compounds in peaches. We found genotypes with enhanced antioxidant capacity and a better performance than progenitors, and in consequence the best marketability.

  2. Evaluation of antioxidant compounds and total sugar content in a nectarine [Prunus persica (L.) Batsch] progeny.

    Science.gov (United States)

    Abidi, Walid; Jiménez, Sergio; Moreno, María Ángeles; Gogorcena, Yolanda

    2011-01-01

    Epidemiological studies suggest that consumption of fruit rich in phenolic compounds is associated with health-protective effects due to their antioxidant properties. For these reasons quality evaluation has become an important issue in fruit industry and in breeding programs. Phytochemical traits such as total phenolics, flavonoids, anthocyanins, L-ascorbic acid, sugar content and relative antioxidant capacity (RAC) were analyzed over four years in flesh fruit of an F1 population "Venus" × "Big Top" nectarines. Other traits such as harvesting date, yield, fruit weight, firmness, soluble solids concentration (SSC), pH, titratable acidity (TA) and ripening index (RI) were also determined in the progeny. Results showed high variability among genotypes for all analyzed traits. Total phenolics and flavonoids showed significant positive correlations with RAC implying that both are important antioxidant bioactive compounds in peaches. We found genotypes with enhanced antioxidant capacity and a better performance than progenitors, and in consequence the best marketability.

  3. A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].

    Science.gov (United States)

    Wells, Christina E; Vendramin, Elisa; Jimenez Tarodo, Sergio; Verde, Ignazio; Bielenberg, Douglas G

    2015-02-07

    MADS-box genes encode a family of eukaryotic transcription factors distinguished by the presence of a highly-conserved ~58 amino acid DNA-binding and dimerization domain (the MADS-box). The central role played by MADS-box genes in peach endodormancy regulation led us to examine this large gene family in more detail. We identified the locations and sequences of 79 MADS-box genes in peach, separated them into established subfamilies, and broadly surveyed their tissue-specific and dormancy-induced expression patterns using next-generation sequencing. We then focused on the dormancy-related SVP/AGL24 and FLC subfamilies, comparing their numbers and phylogenetic relationships with those of other sequenced woody perennial genomes. We identified 79 MADS-box genes distributed across all eight peach chromosomes and frequently located in clusters of two or more genes. They encode proteins with a mean length of 248 ± 72 amino acids and include representatives from most of the thirteen Type II (MIKC) subfamilies, as well as members of the Type I Mα, Mβ, and Mγ subfamilies. Most Type I genes were present in species-specific monophyletic lineages, and their expression in the peach sporophyte was low or absent. Most Type II genes had Arabidopsis orthologs and were expressed at much higher levels throughout vegetative and fruit tissues. During short-day-induced growth cessation, seven Type II genes from the SVP/AGL24, AGL17, and SEP subfamilies showed significant changes in expression. Phylogenetic analyses indicated that multiple, independent expansions have taken place within the SVP/AGL24 and FLC lineages in woody perennial species. Most Type I genes appear to have arisen through tandem duplications after the divergence of the Arabidopsis and peach lineages, whereas Type II genes appear to have increased following whole genome duplication events. An exception to the latter rule occurs in the FLC and SVP/AGL24 Type II subfamilies, in which species-specific tandem duplicates have been retained in a number of perennial species. These subfamilies comprise part of a genetic toolkit that regulates endodormancy transitions, but phylogenetic and expression data suggest that individual orthologs may not function identically across all species.

  4. Relationship between endogenous hormonal content and somatic organogenesis in callus of peach (Prunus persica L. Batsch) cultivars and Prunus persica×Prunus dulcis rootstocks.

    Science.gov (United States)

    Pérez-Jiménez, Margarita; Cantero-Navarro, Elena; Pérez-Alfocea, Francisco; Le-Disquet, Isabel; Guivarc'h, Anne; Cos-Terrer, José

    2014-05-01

    The relationship between endogenous hormones content and the induction of somatic peach plant was studied. To induce multiple shoots from callus derived from the base of stem explants of the scion cultivars 'UFO-3', 'Flariba' and 'Alice Bigi', and the peach×almond rootstocks 'Garnem' and 'GF677', propagated plants were cultured on Murashige and Skoog salts augmented with 0.1mgL(-1) of indolebutyric acid, 1mgL(-1) of 6-benzylaminopurine and 3% sucrose. The highest regeneration rate was obtained with the peach×almond rootstocks. Endogenous levels of abscisic acid (ABA), indole-3-acetic acid (IAA), zeatin (Z), zeatin riboside (ZR), ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC), salicylic acid (SA), and jasmonic acid (JA) were analyzed in the organogenic callus. Lower levels of several hormones, namely Z, ZR, ABA, and ACC were found in the peach×almond rootstock compared to peach cultivars, while IAA and SA presented inconclusive returns. These results suggest that the difference in somatic organogenesis capacity observed in peach and peach×almond hybrids is markedly affected by the endogenous hormonal content of the studied genotypes. Copyright © 2014 Elsevier GmbH. All rights reserved.

  5. Bioactive compounds contents, antioxidant and antimicrobial activities during ripening of Prunus persica L. varieties from the North West of Tunisia.

    Science.gov (United States)

    Belhadj, Feten; Somrani, Imen; Aissaoui, Neyssene; Messaoud, Chokri; Boussaid, Mohamed; Marzouki, M Nejib

    2016-08-01

    Bioactive molecules from fruits of four varieties of Prunus persica at different stages of ripening (green, small orange, red) were studied. For example, contents on polyphenols (20.36mg GAE/g FW) and flavonoids (0.764mg RE/g FW) were high and varied according variety. The antioxidant activity, using four different tests (DPPH radical scavenging activity, reducing power, β carotene bleaching system and TBARS assay) showed that the variety Chatos exhibited the highest antioxidant activity comparing with others varieties. The antibacterial activity of Prunus persica varieties studied seems to be more sensitive against Staphylococcus aureus and Listeria monocytogenes. The capacity of peach DMSO extracts to inhibit Candida albicans growth was more pronounced, especially, in the presence of Chatos DMSO extract. Enzymes inhibition gives results which correlate with polyphenols, flavonoids and condensed tannins contents, and so, confirm the fascinating bioactivity of this fruit. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Cinnamyl alcohol dehydrogenases in the mesocarp of ripening fruit of Prunus persica genotypes with different flesh characteristics: changes in activity and protein and transcript levels.

    Science.gov (United States)

    Gabotti, Damiano; Negrini, Noemi; Morgutti, Silvia; Nocito, Fabio F; Cocucci, Maurizio

    2015-07-01

    Development of fruit flesh texture quality traits may involve the metabolism of phenolic compounds. This study presents molecular and biochemical results on the possible role played by cinnamyl alcohol dehydrogenase (CAD; EC 1.1.1.195) during ripening [S3, S4 I (pre-climacteric) and S4 III (climacteric) stages] of peach [Prunus persica (L.) Batsch] fruit with different flesh firmness [non-melting flesh (NMF) 'Oro A'/melting flesh (MF) 'Springcrest' and 'Sanguinella'] and color (blood-flesh Sanguinella). A total of 24 putative full-length PRUPE_CAD genes were identified (in silico analysis) in the peach genome. The most abundant CAD isoforms, encoded by genes located on scaffolds 8 and 6, were probed by specifically developed anti-PRUPE_CAD sc8 and by anti-FaCAD (PRUPE_CAD sc6) polyclonal antibodies, respectively. PRUPE_CAD sc8 proteins (SDS-PAGE and native-PAGE/western blot) appeared responsible for the CAD activity (in vitro/in-gel assays) that increased with ripening (parallel to PRUPE_ACO1 transcripts accumulation and ethylene evolution) only in the mesocarp of Oro A and blood-flesh Sanguinella. Accumulation of PRUPE_CAD sc8 transcripts (semi-quantitative RT-PCR) occurred in all three cultivars, but in Oro A and Springcrest it was not always accompanied by that of the related proteins, suggesting possible post-transcriptional regulation. Flesh firmness, as well as levels of lignin, total phenolics and, where present (Sanguinella), anthocyanins, declined with ripening, suggesting that, at least in the studied peach cultivars, CAD activity is related to neither lignification nor differences in flesh firmness (NMF/MF). Further studies are necessary to clarify whether the high levels of CAD activity/expression in Sanguinella play a role in determining the characteristics of this blood-flesh fruit. © 2014 Scandinavian Plant Physiology Society.

  7. Transcriptomic profiling during the post-harvest of heat-treated Dixiland Prunus persica fruits: common and distinct response to heat and cold.

    Science.gov (United States)

    Lauxmann, Martin A; Brun, Bianca; Borsani, Julia; Bustamante, Claudia A; Budde, Claudio O; Lara, María V; Drincovich, María F

    2012-01-01

    Cold storage is extensively used to slow the rapid deterioration of peach (Prunus persica L. Batsch) fruit after harvest. However, peach fruit subjected to long periods of cold storage develop chilling injury (CI) symptoms. Post-harvest heat treatment (HT) of peach fruit prior to cold storage is effective in reducing some CI symptoms, maintaining fruit quality, preventing softening and controlling post-harvest diseases. To identify the molecular changes induced by HT, which may be associated to CI protection, the differential transcriptome of peach fruit subjected to HT was characterized by the differential display technique. A total of 127 differentially expressed unigenes (DEUs), with a presence-absence pattern, were identified comparing peach fruit ripening at 20°C with those exposed to a 39°C-HT for 3 days. The 127 DEUs were divided into four expression profile clusters, among which the heat-induced (47%) and heat-repressed (36%) groups resulted the most represented, including genes with unknown function, or involved in protein modification, transcription or RNA metabolism. Considering the CI-protection induced by HT, 23-heat-responsive genes were selected and analyzed during and after short-term cold storage of peach fruit. More than 90% of the genes selected resulted modified by cold, from which nearly 60% followed the same and nearly 40% opposite response to heat and cold. Moreover, by using available Arabidopsis microarray data, it was found that nearly 70% of the peach-heat responsive genes also respond to cold in Arabidopsis, either following the same trend or showing an opposite response. Overall, the high number of common responsive genes to heat and cold identified in the present work indicates that HT of peach fruit after harvest induces a cold response involving complex cellular processes; identifying genes that are involved in the better preparation of peach fruit for cold-storage and unraveling the basis for the CI protection induced by HT.

  8. Transcriptional Responses in root and leaf of Prunus persica Under Drought Stress Using RNA Sequencing

    Directory of Open Access Journals (Sweden)

    Najla Ksouri

    2016-11-01

    Full Text Available Prunus persica L. Batch, or peach, is one of the most important crops and it is widely established in irrigated arid and semi-arid regions. However, due to variations in the climate and the increased aridity, drought has become a major constraint, causing crop losses worldwide. The use of drought-tolerant rootstocks in modern fruit production appears to be a useful method of alleviating water deficit problems. However, the transcriptomic variation and the major molecular mechanisms that underlie the adaptation of drought-tolerant rootstocks to water shortage remain unclear. Hence, in this study, high-throughput sequencing (RNA-seq was performed to assess the transcriptomic changes and the key genes involved in the response to drought in root tissues (GF677 rootstock and leaf tissues (graft, var. Catherina subjected to 16 days of drought stress. In total, 12 RNA libraries were constructed and sequenced. This generated a total of 315M raw reads from both tissues, which allowed the assembly of 22,079 and 17,854 genes associated with the root and leaf tissues, respectively. Subsets of 500 differentially expressed genes (DEGs in roots and 236 in leaves were identified and functionally annotated with 56 gene ontology (GO terms and 99 metabolic pathways, which were mostly associated with aminobenzoate degradation and phenylpropanoid biosynthesis. The GO analysis highlighted the biological functions that were exclusive to the root tissue, such as locomotion, hormone metabolic process, and detection of stimulus, indicating the stress-buffering role of the GF677 rootstock. Furthermore, the complex regulatory network involved in the drought response was revealed, involving proteins that are associated with signaling transduction, transcription and hormone regulation, redox homeostasis, and frontline barriers. We identified two poorly characterized genes in P. persica: growth-regulating factor 5 (GRF5, which may be involved in cellular expansion, and AtHB12

  9. Comparative population genomics reveals the domestication history of the peach, Prunus persica, and human influences on perennial fruit crops.

    Science.gov (United States)

    Cao, Ke; Zheng, Zhijun; Wang, Lirong; Liu, Xin; Zhu, Gengrui; Fang, Weichao; Cheng, Shifeng; Zeng, Peng; Chen, Changwen; Wang, Xinwei; Xie, Min; Zhong, Xiao; Wang, Xiaoli; Zhao, Pei; Bian, Chao; Zhu, Yinling; Zhang, Jiahui; Ma, Guosheng; Chen, Chengxuan; Li, Yanjun; Hao, Fengge; Li, Yong; Huang, Guodong; Li, Yuxiang; Li, Haiyan; Guo, Jian; Xu, Xun; Wang, Jun

    2014-07-31

    Recently, many studies utilizing next generation sequencing have investigated plant evolution and domestication in annual crops. Peach, Prunus persica, is a typical perennial fruit crop that has ornamental and edible varieties. Unlike other fruit crops, cultivated peach includes a large number of phenotypes but few polymorphisms. In this study, we explore the genetic basis of domestication in peach and the influence of humans on its evolution. We perform large-scale resequencing of 10 wild and 74 cultivated peach varieties, including 9 ornamental, 23 breeding, and 42 landrace lines. We identify 4.6 million SNPs, a large number of which could explain the phenotypic variation in cultivated peach. Population analysis shows a single domestication event, the speciation of P. persica from wild peach. Ornamental and edible peach both belong to P. persica, along with another geographically separated subgroup, Prunus ferganensis. Our analyses enhance our knowledge of the domestication history of perennial fruit crops, and the dataset we generated could be useful for future research on comparative population genomics.

  10. Pattern recognition of peach cultivars (Prunus persica L.) from their volatile components.

    Science.gov (United States)

    Montero-Prado, Pablo; Bentayeb, Karim; Nerín, Cristina

    2013-05-01

    The volatile compounds of four peach cultivars (Prunus persica L.) were studied: Sudanell, San Lorenzo, Miraflores and Calanda (two clones, Calante and Jesca). 17-23 Samples of each cultivar with the same maturity level were analyzed, measuring color, firmness, and soluble solids content. The pulp was crushed and mixed with water prior to HS-SPME analysis, and GC-MS was used to determine the volatile compounds. Sixty-five compounds were identified using spectral library matching, Kovat's indices and, when available, pure standards. The main components were lactones and C6 compounds. From the distribution of these compounds, Principal Component Analysis led to the clustering of the samples according to their different cultivars. Finally, Canonical Component Analysis was used to create a classification function that identifies the origin of an unknown sample from its volatile composition. The results obtained will help to avoid fraud and protect the European Designation of Origin 'Melocotón de Calanda'. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Identification of Proteins from Prunus persica That Interact with Peach Latent Mosaic Viroid▿

    Science.gov (United States)

    Dubé, Audrey; Bisaillon, Martin; Perreault, Jean-Pierre

    2009-01-01

    Peach latent mosaic viroid (PLMVd) is a small, single-stranded, circular RNA pathogen that infects Prunus persica trees. As with all other known viroids, the PLMVd genome does not encode any proteins. Consequently, it must interact with host cellular factors in order to ensure its life cycle. With the objective of identifying cellular proteins that interact with PLMVd, Northwestern hybridizations were performed using partially purified peach leaf extracts. Mass spectrometric analysis of the detected RNA-protein complexes led to the identification of six putative RNA-binding proteins. One of these was found to be elongation factor 1-alpha (eEF1A), and because of its known involvement in the replication and translation of various RNA viruses, further characterizations were performed. Initially, the existence of this interaction received support from an experiment that immunoprecipitated the eEF1A from a crude extract of infected peach leaves, coupled with reverse transcription-PCR detection of the PLMVd. Subsequently, eEF1A interaction with PLMVd strands of both polarities was confirmed in vitro by electrophoresis mobility shift assays, fluorescence spectroscopy, and the prediction of an altered PLMVd RNase mapping profile in the presence of the protein. The potential contribution of eEF1A to the molecular biology of PLMVd, including for viroid replication, is discussed. PMID:19759139

  12. Glucitol dehydrogenase from peach (Prunus persica) fruits is regulated by thioredoxin h.

    Science.gov (United States)

    Hartman, Matías D; Figueroa, Carlos M; Piattoni, Claudia V; Iglesias, Alberto A

    2014-06-01

    Glucitol (Gol) is a major photosynthetic product in plants from the Rosaceae family. Herein we report the molecular cloning, heterologous expression and characterization of Gol dehydrogenase (GolDHase, EC 1.1.1.14) from peach (Prunus persica) fruits. The recombinant enzyme showed kinetic parameters similar to those reported for orthologous enzymes purified from apple and pear fruits. The activity of recombinant GolDHase was strongly inhibited by Cu(2+) and Hg(2+), suggesting that it might have cysteine residues critical for functionality. Oxidizing compounds (such as diamide, hydrogen peroxide and oxidized glutathione) inactivated the enzyme, whereas its activity was restored after incubation with reduced glutathione and thioredoxin from Escherichia coli. Recombinant thioredoxin h from peach fruits also recovered the activity of oxidized GolDHase. Our results suggest that peach fruit GolDHase could be redox regulated in vivo and this would be of relevance to determine carbon assimilation and partitioning in plants accumulating sugar alcohols. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  13. Prunus persica crop management as step toward AMF diversity conservation for the sustainable soil management

    Science.gov (United States)

    Alguacil, M. M.; Torrecillas, E.; Lozano, Z.; Garcia-Orenes, F.; Roldan, A.

    2012-04-01

    We investigated the diversity of arbuscular mycorrhizal fungi (AMF) in roots of Prunus persica under two fertilization treatments (CF: consisted of application of chicken manure (1400 kg.ha-1), urea (140 kg.ha-1), complex fertilizer 12-12-17/2 (280 kg.ha-1), and potassium sulfate (40 kg.ha-1) and IF: consisted of application of urea (140 kg.ha-1), complex fertilizer 12-12-17/2 (400 kg.ha-1) and potassium sulfate (70 kg.ha-1)) combined with integrated pest management (IM) or chemical pest management (CM), in a tropical agroecosystem in the north of Venezuela. Our goal was to ascertain how different fertilizers/pest management can modify the AMF diversity colonizing P. persica roots as an important step towards sustainable soil use and therefore protection of biodiversity. The AM fungal small-subunit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty-one different phylotypes were identified, which were grouped in five families: Glomeraceae, Paraglomeraceae, Acaulosporaceae, Gigasporaceae and Archaeosporaceae. Sixteen of these sequence groups belonged to the genus Glomus, two to Paraglomus, one to Acaulospora, one to Scutellospora and one to Archaeospora. A different distribution of the AMF phylotypes as consequence of the difference between treatments was observed. Thus, the AMF communities of tree roots in the (IF+CM) treatment had the lowest diversity (H'=1.78) with the lowest total number of AMF sequence types (9). The trees from both (CF+IM) and (IF+IM) treatments had similar AMF diversity (H'?2.00); while the treatment (CF+CM) yielded the highest number of different AMF sequence types (17) and showed the highest diversity index (H'=2.69). In conclusion, the crop management including combination of organic and inorganic fertilization and chemical pest control appears to be the most suitable strategy with respect to reactivate the AMF diversity in the roots of this crop and thus, the agricultural and environmental

  14. Prunus persica crop management differentially promotes arbuscular mycorrhizal fungi diversity in a tropical agro-ecosystem.

    Science.gov (United States)

    Alguacil, Maria del Mar; Torrecillas, Emma; Lozano, Zenaida; Torres, Maria Pilar; Roldán, Antonio

    2014-01-01

    Due to the important role of arbuscular mycorrhizal fungi (AMF) in ecosystem functioning, determination of the effect of management practices on the AMF diversity in agricultural soils is essential for the sustainability of these agro-ecosystems. The objective of this study was to compare the AMF diversity in Prunus persica roots under two types of fertilisation (inorganic, with or without manure) combined with integrated or chemical pest management in a Venezuelan agro-ecosystem. The AM fungal small-subunit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty-one different phylotypes were identified: 15 belonged to the genus Glomus, one to Claroideoglomus, two to Paraglomus, one to Acaulospora, one to Scutellospora and one to Archaeospora. The distribution of the AMF community composition differed as a consequence of the treatment effects. The treatment combining organic and inorganic fertilisation with chemical pest control had the highest AMF richness and the treatment combining inorganic fertilisation with chemical pest had the lowest. The real causes and effects of these differences in the AMF community are very difficult to establish, since the crop management regimes tested were composed of several interacting factors. In conclusion, the crop management practices can exert a significant influence on the populations of AMF. The treatment combining organic and inorganic fertilisation with chemical pest control appears to be the most suitable agricultural management strategy with respect to improving the AMF diversity in this crop under tropical conditions, and thus for maintaining the agricultural and environmental sustainability of this agro-ecosystem.

  15. Extrafloral nectaries alter arthropod community structure and mediate peach (Prunus persica) plant defense.

    Science.gov (United States)

    Mathews, Clarissa R; Bottrell, Dale G; Brown, Mark W

    2009-04-01

    We investigated the role of extrafloral nectaries (EFNs) in mediating plant defense for newly established peach (Prunus persica) trees. We used peaches of a single cultivar ("Lovell") that varied with respect to EFN leaf phenotype (with or without EFNs) to determine if the EFNs affected the structure of the arthropod community colonizing newly planted seedlings. We also tested if the plants producing EFNs benefited from reduced herbivory or enhanced productivity. In the first year following planting, the young peach trees with EFNs were dominated by ants, and arthropod community diversity was lower than for trees without EFNs. The young trees with EFNs harbored fewer herbivores and experienced a twofold reduction in folivory compared to trees without EFNs. Productivity was also enhanced for the trees with EFNs, which attained significantly higher rates of trunk growth, greater terminal carbon composition, and a threefold increase in buds produced in subsequent years. In the second year of the field study, ants remained numerically dominant on trees with EFNs, but arthropod community diversity was higher than for trees without EFNs. An additional study revealed that folivory rates in May increased dramatically for trees with EFNs if ants were excluded from their canopies, indicating that ants have a protective function when the perennial trees produce new leaves. However, in later months, regardless of ants' presence, the trees with EFNs suffered less folivory than trees lacking EFNs. The diversity and richness of the predator trophic group increased when ants were excluded from trees with EFNs, but overall community diversity (i.e., herbivores and predators combined) was not affected by the ants' presence. Our research indicates that the EFNs play an important role in attracting predators that protect the trees from herbivores, and the EFN host-plant characteristic should be retained in future peach cultivar selections. Furthermore, peach production programs aimed

  16. Unique expression, processing regulation, and regulatory network of peach (Prunus persica) miRNAs.

    Science.gov (United States)

    Zhu, Hong; Xia, Rui; Zhao, Bingyu; An, Yong-qiang; Dardick, Chris D; Callahan, Ann M; Liu, Zongrang

    2012-08-21

    MicroRNAs (miRNAs) have recently emerged as important gene regulators in plants. MiRNAs and their targets have been extensively studied in Arabidopsis and rice. However, relatively little is known about the characterization of miRNAs and their target genes in peach (Prunus persica), which is a complex crop with unique developmental programs. We performed small RNA deep sequencing and identified 47 peach-specific and 47 known miRNAs or families with distinct expression patterns. Together, the identified miRNAs targeted 80 genes, many of which have not been reported previously. Like the model plant systems, peach has two of the three conserved trans-acting siRNA biogenesis pathways with similar mechanistic features and target specificity. Unique to peach, three of the miRNAs collectively target 49 MYBs, 19 of which are known to regulate phenylpropanoid metabolism, a key pathway associated with stone hardening and fruit color development, highlighting a critical role of miRNAs in the regulation of peach fruit development and ripening. We also found that the majority of the miRNAs were differentially regulated in different tissues, in part due to differential processing of miRNA precursors. Up to 16% of the peach-specific miRNAs were differentially processed from their precursors in a tissue specific fashion, which has been rarely observed in plant cells. The miRNA precursor processing activity appeared not to be coupled with its transcriptional activity but rather acted independently in peach. Collectively, the data characterizes the unique expression pattern and processing regulation of peach miRNAs and demonstrates the presence of a complex, multi-level miRNA regulatory network capable of targeting a wide variety of biological functions, including phenylpropanoid pathways which play a multifaceted spatial-temporal role in peach fruit development.

  17. Unique expression, processing regulation, and regulatory network of peach (Prunus persica miRNAs

    Directory of Open Access Journals (Sweden)

    Zhu Hong

    2012-08-01

    Full Text Available Abstract Background MicroRNAs (miRNAs have recently emerged as important gene regulators in plants. MiRNAs and their targets have been extensively studied in Arabidopsis and rice. However, relatively little is known about the characterization of miRNAs and their target genes in peach (Prunus persica, which is a complex crop with unique developmental programs. Results We performed small RNA deep sequencing and identified 47 peach-specific and 47 known miRNAs or families with distinct expression patterns. Together, the identified miRNAs targeted 80 genes, many of which have not been reported previously. Like the model plant systems, peach has two of the three conserved trans-acting siRNA biogenesis pathways with similar mechanistic features and target specificity. Unique to peach, three of the miRNAs collectively target 49 MYBs, 19 of which are known to regulate phenylpropanoid metabolism, a key pathway associated with stone hardening and fruit color development, highlighting a critical role of miRNAs in the regulation of peach fruit development and ripening. We also found that the majority of the miRNAs were differentially regulated in different tissues, in part due to differential processing of miRNA precursors. Up to 16% of the peach-specific miRNAs were differentially processed from their precursors in a tissue specific fashion, which has been rarely observed in plant cells. The miRNA precursor processing activity appeared not to be coupled with its transcriptional activity but rather acted independently in peach. Conclusions Collectively, the data characterizes the unique expression pattern and processing regulation of peach miRNAs and demonstrates the presence of a complex, multi-level miRNA regulatory network capable of targeting a wide variety of biological functions, including phenylpropanoid pathways which play a multifaceted spatial-temporal role in peach fruit development.

  18. Polinização entomófila em pessegueiro (Prunus persica L.

    Directory of Open Access Journals (Sweden)

    Manoel Octávio Silveira da Mota

    2002-01-01

    Full Text Available Este experimento, realizado na região de Jaboticabal (SP, utilizou uma cultura de pêssego (Prunus persica L., durante a sua florada com a finalidade de verificar a atuação dos insetos visitantes nas flores na produção de frutos. A concentração média de açucares no néctar e a quantidade média produzida por dia de néctar é de 27,9% e de 3,2 mg, respectivamente. O peso médio das anteras por flor foi de 1,59 mg. A abelha Apis mellifera (73% foi o principal inseto visitante seguida da Trigona spinipes (17% e Xylocopa sp (4%. Observou-se a presença de beija-flores (6%, coletando néctar. A freqüência máxima das abelhas A. mellifera, para coleta de néctar e pólen, ocorreu as 12 horas. O número de frutos resultantes do tratamento em que as flores recebiam as visitas foi 14% maior que no tratamento em as flores não eram visitadas. Do total de frutos colhidos no tratamento coberto (sem visitas, 82% apresentaram-se perfeitos, com boa formação e simetria. No tratamento descoberto, 90,2% apresentaram-se com boa formação, havendo diferença estatística entre os dois tratamentos.

  19. The early spring N uptake of young peach trees (Prunus persica) is affected by past and current fertilizations and levels of C and N stores.

    Science.gov (United States)

    Jordan, Marie-Odile; Vercambre, Gilles; Gomez, Laurent; Pagès, Loïc

    2014-01-01

    In deciduous trees, shoot development in early spring is assumed to be achieved mainly at the expense of nitrogen (N) stores. Indeed, the possible compensation for poor autumn N storage by early spring N uptake has been little studied. We therefore determined the dynamics of spring N uptake in relation to spring N supply, carbon and N storage and shoot development. Young peach trees (Prunus persica L. Batsch, cv. 'GF305') were raised outdoors in a hydroponic set-up during the spring and summer, with an excessive N supply. During the autumn, half of the trees were then N limited. The following spring, the N supply remained either high or low, or changed from high to low or low to high. Between 6 March and 13 May, N uptake was measured automatically on an hourly basis, while shoot growth was monitored once a week. These in situ measurements were completed by three destructive harvests to assess organ composition in N and total non-structural carbohydrates (TNC). Until the end of April, N uptake was dependent on the autumn N treatment, being higher in trees that had been N limited in the autumn. Total non-structural carbohydrate mobilization was also higher in those trees that had lost at least 17 g TNC by 24 April, while TNC levels in non-limited trees remained stable or even rose. Shoot development, estimated by the number of elongated axes and leaves per axis, was also slightly delayed by an N limitation in autumn. After 24 April, N uptake rates increased notably under all treatments and was determined by the spring N supply. In trees receiving a high N supply in the spring, the uptake rates also displayed marked short-term variations. That reduced the differences between treatments and by 13 May no differences could be evidenced between the trees in terms of organ biomass and TNC and N contents, whatever the treatment. We concluded that in the early spring, N uptake may compensate for a deficit of N storage insofar as large quantities of TNC can be mobilized for

  20. A review on the complexity of insect-plant interactions under varying levels of resources and host resistance: the case of Myzus persicae-Prunus persica

    Directory of Open Access Journals (Sweden)

    Verdugo, JA.

    2016-01-01

    Full Text Available Introduction. Insect-plant interactions are affected directly or indirectly by stress factors. The effect of environmental resource availability on insect-plant interactions is here reviewed. Subsequently, the analysis focuses on aphid-host plant interactions, particularly in the system composed by the green peach aphid Myzus persicae and its primary host plant Prunus persica. Literature. Plant defenses arise in two ways: resistance and tolerance, both are affected by abiotic factors. The information gathered from studies (n = 29 on plant-aphid interactions addressing the reduction in water availability on plant resistance, showed that in 41,4% of the studies, drought stress elicits lower resistance, while 34.5%, 20.1% and 3.4%, showed higher, no change and conditional effects on plant resistance, respectively. Conclusions. Water stress elicits mixed effects on plant resistance to aphids. However, the literature review also suggests that cultural practices play a role in the fate of the peach-aphid interactions, whereas the development of predictive models aimed to assist crop-pest management systems still requires more basic information. Aphid responses to plant defenses under stressed conditions are still largely unexplored.

  1. Changes in biochemical compounds in flesh and peel from Prunus persica fruits grown in Tunisia during two maturation stages.

    Science.gov (United States)

    Dabbou, Samia; Lussiana, Carola; Maatallah, Samira; Gasco, Laura; Hajlaoui, Hichem; Flamini, Guido

    2016-03-01

    Plants can synthesize tens to hundreds of thousands of primary and secondary metabolites with diverse biological properties and functions. Fatty acids (FA), phenolic compounds (PC) and volatile compounds (VC) of flesh and peel from three Prunus persica cultivars were evaluated at the Regional Centre of Agricultural Research--Experimental Farm (Sidi Bouzid, Tunisia) during two maturation stages. Palmitic, oleic and linoleic acids are the most abundant FA in Prunus persica cultivars. A genetic effect on FA composition was observed throughout the two sampling periods. Peel was rich in oleic acid with the highest content (31.3% on total FA) in 'O'Henry' cultivar at the commercial ripening date; flesh was rich in linoleic acid with the highest content (44.7% on total FA) in 'Sweet Cap' cultivar at the full ripening date. The monounsaturated/polyunsaturated fatty acids ratios were higher in the commercial ripe than in the full ripe fruits. The analysis of the composition of the VC led to the characterization of 98 different compounds, showing a very high variability among the cultivars. The full ripe fruit (peel and flesh) exhibited the highest total number of terpenoids. Commercial ripe peels were richest in the percentage of hydrocarbons. Comparing cultivars, 'Sweet Cap' cultivar showed the lowest contents of alcohols in peel and flesh of full ripe fruit but highest in peel of commercial ripe fruit, and lowest content of aldehydes in peel and flesh of commercial ripe fruit but highest in peel of ripe ones and the highest ones of lactones. Among PC, the highest contents were observed for o-diphenols and the values showed varietal influence. Total phenols contents decreased during ripening process (p peel and flesh tissues, except found for 'Sweet Cap' cultivar. In conclusion, to achieve better FA composition and greater VC and PC production of the peach fruit, P. persica cultivars should be harvested at the commercial ripening date. Copyright © 2015 Elsevier Masson SAS

  2. Characterization of cytokinin signaling and homeostasis gene families in two hardwood tree species: Populus trichocarpa and Prunus persica.

    Science.gov (United States)

    Immanen, Juha; Nieminen, Kaisa; Duchens Silva, Héctor; Rodríguez Rojas, Fernanda; Meisel, Lee A; Silva, Herman; Albert, Victor A; Hvidsten, Torgeir R; Helariutta, Ykä

    2013-12-16

    Through the diversity of cytokinin regulated processes, this phytohormone has a profound impact on plant growth and development. Cytokinin signaling is involved in the control of apical and lateral meristem activity, branching pattern of the shoot, and leaf senescence. These processes influence several traits, including the stem diameter, shoot architecture, and perennial life cycle, which define the development of woody plants. To facilitate research about the role of cytokinin in regulation of woody plant development, we have identified genes associated with cytokinin signaling and homeostasis pathways from two hardwood tree species. Taking advantage of the sequenced black cottonwood (Populus trichocarpa) and peach (Prunus persica) genomes, we have compiled a comprehensive list of genes involved in these pathways. We identified genes belonging to the six families of cytokinin oxidases (CKXs), isopentenyl transferases (IPTs), LONELY GUY genes (LOGs), two-component receptors, histidine containing phosphotransmitters (HPts), and response regulators (RRs). All together 85 Populus and 45 Prunus genes were identified, and compared to their Arabidopsis orthologs through phylogenetic analyses. In general, when compared to Arabidopsis, differences in gene family structure were often seen in only one of the two tree species. However, one class of genes associated with cytokinin signal transduction, the CKI1-like family of two-component histidine kinases, was larger in both Populus and Prunus than in Arabidopsis.

  3. Characterization of cytokinin signaling and homeostasis gene families in two hardwood tree species: Populus trichocarpa and Prunus persica

    Science.gov (United States)

    2013-01-01

    Background Through the diversity of cytokinin regulated processes, this phytohormone has a profound impact on plant growth and development. Cytokinin signaling is involved in the control of apical and lateral meristem activity, branching pattern of the shoot, and leaf senescence. These processes influence several traits, including the stem diameter, shoot architecture, and perennial life cycle, which define the development of woody plants. To facilitate research about the role of cytokinin in regulation of woody plant development, we have identified genes associated with cytokinin signaling and homeostasis pathways from two hardwood tree species. Results Taking advantage of the sequenced black cottonwood (Populus trichocarpa) and peach (Prunus persica) genomes, we have compiled a comprehensive list of genes involved in these pathways. We identified genes belonging to the six families of cytokinin oxidases (CKXs), isopentenyl transferases (IPTs), LONELY GUY genes (LOGs), two-component receptors, histidine containing phosphotransmitters (HPts), and response regulators (RRs). All together 85 Populus and 45 Prunus genes were identified, and compared to their Arabidopsis orthologs through phylogenetic analyses. Conclusions In general, when compared to Arabidopsis, differences in gene family structure were often seen in only one of the two tree species. However, one class of genes associated with cytokinin signal transduction, the CKI1-like family of two-component histidine kinases, was larger in both Populus and Prunus than in Arabidopsis. PMID:24341635

  4. Genome-Wide Analysis Suggests the Relaxed Purifying Selection Affect the Evolution of WOX Genes in Pyrus bretschneideri, Prunus persica, Prunus mume, and Fragaria vesca.

    Science.gov (United States)

    Cao, Yunpeng; Han, Yahui; Meng, Dandan; Li, Guohui; Li, Dahui; Abdullah, Muhammad; Jin, Qing; Lin, Yi; Cai, Yongping

    2017-01-01

    WUSCHEL-related homeobox (WOX) family is one of the largest group of transcription factors (TFs) specifically found in plant kingdom. WOX TFs play an important role in plant development processes and evolutionary novelties. Although the roles of WOXs in Arabidopsis and rice have been well-studied, however, little are known about the relationships among the main clades in the molecular evolution of these genes in Rosaceae. Here, we carried out a genome-wide analysis and identified 14, 10, 10, and 9 of WOX genes from four Rosaceae species (Fragaria vesca, Prunus persica, Prunus mume, and Pyrus bretschneideri, respectively). According to evolutionary analysis, as well as amino acid sequences of their homodomains, these genes were divided into three clades with nine subgroups. Furthermore, due to the conserved structural patterns among these WOX genes, it was proposed that there should exist some highly conserved regions of microsynteny in the four Rosaceae species. Moreover, most of WOX gene pairs were presented with the conserved orientation among syntenic genome regions. In addition, according to substitution models analysis using PMAL software, no significant positive selection was detected, but type I functional divergence was identified among certain amino acids in WOX protein. These results revealed that the relaxed purifying selection might be the main driving force during the evolution of WOX genes in the tested Rosaceae species. Our result will be useful for further precise research on evolution of the WOX genes in family Rosaceae.

  5. Genome-Wide Analysis Suggests the Relaxed Purifying Selection Affect the Evolution of WOX Genes in Pyrus bretschneideri, Prunus persica, Prunus mume, and Fragaria vesca

    Directory of Open Access Journals (Sweden)

    Yunpeng Cao

    2017-06-01

    Full Text Available WUSCHEL-related homeobox (WOX family is one of the largest group of transcription factors (TFs specifically found in plant kingdom. WOX TFs play an important role in plant development processes and evolutionary novelties. Although the roles of WOXs in Arabidopsis and rice have been well-studied, however, little are known about the relationships among the main clades in the molecular evolution of these genes in Rosaceae. Here, we carried out a genome-wide analysis and identified 14, 10, 10, and 9 of WOX genes from four Rosaceae species (Fragaria vesca, Prunus persica, Prunus mume, and Pyrus bretschneideri, respectively. According to evolutionary analysis, as well as amino acid sequences of their homodomains, these genes were divided into three clades with nine subgroups. Furthermore, due to the conserved structural patterns among these WOX genes, it was proposed that there should exist some highly conserved regions of microsynteny in the four Rosaceae species. Moreover, most of WOX gene pairs were presented with the conserved orientation among syntenic genome regions. In addition, according to substitution models analysis using PMAL software, no significant positive selection was detected, but type I functional divergence was identified among certain amino acids in WOX protein. These results revealed that the relaxed purifying selection might be the main driving force during the evolution of WOX genes in the tested Rosaceae species. Our result will be useful for further precise research on evolution of the WOX genes in family Rosaceae.

  6. Pomological and biochemical peculiarities of peach hybrids and varieties for genus Persica Mill. (Prunus persica Borkh. with anthocyanidin Persica vulgaris Mill, pigmentation of fruits pulp and leaves

    Directory of Open Access Journals (Sweden)

    О. О. Ріхтер

    2009-10-01

    Full Text Available The chemical composition and the links between different groups of substances (content of dry substances, monosaccharides, saccharose, sum of sugars, titratable acids, proanthocyanidins, anthocyanidins, water soluble pectine, protopectin, sum of pectines and sugar-acid index have been studied in hybrids fruits of Persica vulgaris Mill, subsp. erytrocarpa Zajats and Persica vulgaris Mill, subsp. atropurpurea (Schneid. Zajats. The obtained data were compared with the characteristics typical for fruits of P. vulgaris Mill, subsp. nectarina (Ait. Shof. and P. vulgaris Mill. Brief information about the biology of obtained distant hybrids forms have been given. The content of anthocyanine pigments (Cy-3-Glu, Cy-3- Ara, Cy-3-(6-Kum- Glu in fruits and leaves of different taxons for genus Persica Mill, has been analysed.

  7. Green synthesis of nitrogen-doped graphitic carbon sheets with use of Prunus persica for supercapacitor applications

    Energy Technology Data Exchange (ETDEWEB)

    Atchudan, Raji, E-mail: atchudanr@yu.ac.kr [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of); Edison, Thomas Nesakumar Jebakumar Immanuel [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of); Perumal, Suguna [Department of Applied Chemistry, Kyungpook National University, Daegu 41566 (Korea, Republic of); Lee, Yong Rok, E-mail: yrlee@yu.ac.kr [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of)

    2017-01-30

    Highlights: • N-GCSs was synthesized from the unripe Prunus persica by direct hydrothermal method. • The resulting N-GCSs-2 exhibit an excellent graphitization with 9.33% of nitrogen. • N-GCSs-2 provide high C{sub s} of 176 F g{sup −1} at current density of 0.1 A g{sup −1} in 1 M H{sub 2}SO{sub 4}. • N-GCSs-2 have high capacitance retention and 20% capacity growth after 2000 cycles. • First time, N-GCSs resulted from peach via green route for flexible supercapacitors. - Abstract: Nitrogen-doped graphitic carbon sheets (N-GCSs) were prepared from the extract of unripe Prunus persica fruit by a direct hydrothermal method. The synthesized N-GCSs were examined by high resolution transmission electron microscopy (HRTEM), nitrogen adsorption-desorption isotherms, X-ray diffraction (XRD), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and Fourier transform infrared (FT-IR) spectroscopy. HRTEM showed that the synthesized carbon sheets were graphitic with lattice fringes and an inter-layer distance of 0.36 nm. Doping with the nitrogen moiety present over the synthesized GCSs was confirmed by XPS, FT-IR spectroscopy, and energy dispersive X-ray spectroscopy elemental mapping. The fruit extract associated with hydrothermal-carbonization method is economical and eco-friendly with a single step process. The resulting carbon sheets could be modified and are promising candidates for nano-electronic applications, including supercapacitors. The synthesized N-GCSs-2 provided a high specific capacitance of 176 F g{sup −1} at a current density of 0.1 A g{sup −1}. This electrode material has excellent cyclic stability, even after 2000 cycles of charge-discharge at a current density of 0.5 A g{sup −1}.

  8. Evaluación de la maduración y calidad del fruto de cinco nuevos cultivares de durazno [Prunus pérsica (L) Batsch] de bajo requerimiento de frío.

    OpenAIRE

    Pérez Ríos, Enrique

    2013-01-01

    En los últimos años se han desarrollado nuevos cultivares de durazno (Prunus pérsica (L) Batsch) con bajo requerimiento de frio y es necesario evaluar su comportamiento postcosecha. En este estudio, se realizaron tratamientos con y sin refrigeración almacenados a una, dos y tres semanas a 5°C, evaluándose características de calidad como firmeza, cambios en color, acidez titulable, °Brix, Relación °Brix/acidez, pérdida de peso, producción de etanol y Acetaldehido, intensidad respiratoria y p...

  9. Towards further understanding on the antioxidative activities of Prunus persica fruit: A comparative study with four different fractions

    Science.gov (United States)

    Dhingra, Naveen; Sharma, Rajesh; Kar, Anand

    2014-11-01

    In the present study we have evaluated the antioxidant activities of different fractions (hexane, ethyl acetate, n-butanol and aqueous fractions) of Prunus persica fruit. For extraction simple warring blender method was employed and total phenolic and flavonoid contents were correlated with different antioxidant activities (total antioxidant, 2,2-diphenyl-1-picrylhydrazyl (DPPH), H2O2 scavenging, superoxide radical scavenging, iron chelating and their reducing power properties). Different in vitro antioxidant studies showed that ethyl acetate and n-butanol fractions had the maximum activities that were well correlated with total phenolic and flavonoid contents. Maximum yield (25.14 ± 2.2%) was obtained in its aqueous fraction. Both ethyl acetate and n-butanol fractions showed significant inhibitory effects on different antioxidant activities. A significantly high correlation coefficient existed between total antioxidant activities and with total phenolic as well as total flavonoid contents. It appears that ethyl acetate and n-butanol fractions of P. persica may serve as new potential sources of natural antioxidants and could be of therapeutic use in treating several diseases.

  10. Prunus persica var. platycarpa (Tabacchiera Peach): Bioactive Compounds and Antioxidant Activity of Pulp, Peel and Seed Ethanolic Extracts.

    Science.gov (United States)

    Loizzo, Monica R; Pacetti, Deborah; Lucci, Paolo; Núñez, Oscar; Menichini, Francesco; Frega, Natale Giuseppe; Tundis, Rosa

    2015-09-01

    A comparative analysis of ethanol extracts from peel, pulp and seed of Prunus persica var. platycarpa (Tabacchiera peach) was done. The total phenol, flavonoid and carotenoid content as well as the antioxidant properties by using different in vitro assays (DPPH, ABTS, FRAP, Fe-chelating, β-carotene bleaching test) were evaluated. Pulp extract was subjected to liquid chromatography-electrospray-tandem mass spectrometry (HPLC-ESI-MS/MS). Gallic acid, protocatechuic acid, protocatechualdehyde, chlorogenic acid, p-coumaric acid, and ferulic acid were identified as main constituents. Pulp extract was characterized by the highest total phytonutrients content and exhibited the highest antioxidant activity in all in vitro assays (IC(50) values of 2.2 μg/mL after 60 min of incubation by using β-carotene bleaching test and 2.9 μg/mL by using Fe-chelating assay). Overall, the obtained results suggest that P. persica var. platycarpa displays a good antioxidant activity and its consumption could be promoted.

  11. Genome-Wide Transcriptional Profile Analysis of Prunus persica in Response to Low Sink Demand after Fruit Removal.

    Science.gov (United States)

    Duan, Wei; Xu, Hongguo; Liu, Guotian; Fan, Peige; Liang, Zhenchang; Li, Shaohua

    2016-01-01

    Prunus persica fruits were removed from 1-year-old shoots to analysis photosynthesis, chlorophyll fluorescence and genes changes in leaves to low sink demand caused by fruit removal (-fruit) during the final stage of rapid fruit growth. A decline in net photosynthesis rate was observed, accompanied with a decrease in stomatal conductance. The intercellular CO2 concentrations and leaf temperature increased as compared with a normal fruit load (+fruit). Moreover, low sink demand significantly inhibited the donor side and the reaction center of photosystem II. 382 genes in leaf with an absolute fold change ≥1 change in expression level, representing 116 up- and 266 down-regulated genes except for unknown transcripts. Among these, 25 genes for photosynthesis were down-regulated, 69 stress and 19 redox related genes up-regulated under the low sink demand. These studies revealed high leaf temperature may result in a decline of net photosynthesis rate through down-regulation in photosynthetic related genes and up-regulation in redox and stress related genes, especially heat shock proteins genes. The complex changes in genes at the transcriptional level under low sink demand provided useful starting points for in-depth analyses of source-sink relationship in P. persica.

  12. Variation in Minerals, Phenolics and Antioxidant Activity of Peel and Pulp of Different Varieties of Peach (Prunus persica L.) Fruit from Pakistan

    OpenAIRE

    Muhammad Ashraf; Zahed Mahmood; Umer Rashid; Maleeha Manzoor; Farooq Anwar

    2012-01-01

    Peach (Prunus persica L.), being a potential source of bioactive compounds, has been demonstrated to have medicinal benefits. In this study variation of minerals and antioxidant characteristics (total phenolic contents, total flavonoid contents, reducing power, inhibition of peroxidation using linoleic acid system and DPPH free radical scavenging activity) between peel and pulp parts of different peach varieties, namely Golden, Shireen, and Shahpasand were investigated. T...

  13. Influência do ácido indolbutírico e ethefon no enraizamento de estacas de pessegueiro (Prunus persica (L. Batsch Influence of indolebutyric acid and ethephon on rooting of cuttings of peach (Prunus persica (L. Batsch

    Directory of Open Access Journals (Sweden)

    Adilson Tonietto

    1997-12-01

    Full Text Available Este trabalho foi conduzido no Departamento de Fitotecnia da Faculdade de Agronomia Eliseu Maciel, Universidade Federal de Pelotas, em estufa com nebulização intermitente, com o objetivo de verificar o efeito do ácido indolbutírico(AIB e ethefon (ácido 2-cloroetil fosfônico no enraizamento de estacas de ramos de pessegueiro. Utilizou-se estacas medianas retiradas de ramos de plantas com seis anos de idade, da cultivar Diamante, com comprimento de 15cm. Efetuou-se duas lesões laterais na base das estacas que foram tratadas com ácido indolbutírico nas concentrações 0; 1000; 2000 e 3000ppm, na forma líquida e, ethefon nas concentrações de 0; 50; 100 e 150ppm. Após a imersão de 5 segundos, acondicionou-se as estacas em sacos de polietileno contendo como substrato a mistura de areia+cinza (2:1 v/v. Pelos resultados obtidos concluiu-se que o ácido indolbutírico aumentou o percentual de estacas realizadas até a concentração de 1752ppm. e o número de raízes até a concentração de 1791ppm. O ethefon não apresentou resultados significativos na forma e concentração utilizadas.This work was conducted at the Plant Science Departament Eliseu Maciel Agronomy College of Federal University of Pelotas, in greenhouse with intermitent mist, aiming to evaluate the effect of indolebutyric acid and ethephon (2-chloroetyl phosphonic acid on peach hranch cutting rooting. Median cuttings with 15cm length removed from Diamante cultivar branch were used. Two lateral lesions were made on cutting basis and they were treated with indolebutyric acid in liquid at 0; 1000; 2000; and 3000ppm concentrations and ethefon at 0; 50; 100 and 150ppm concentrations. The immersion time was five seconds and the cuttings were packed in polietylene sacks containing a mixture of sand and rice husk ash substrate (2:1 v/v. Results showed that the indolebutyric acid increased the rooted cuttings percentage up to 1752ppm concentration and the number of roots until 1791ppm concentration. The ethephon did not show significant variation for the form and concentrations used.

  14. Cianamida hidrogenada no raleio químico de flores e frutos de pessegueiros (Prunus persica, L. Batsch cv. Eldorado Hydrogen cyanamide on chemical thinning of peach-tree (Prunus persica, L. Batsch Flowers and fruits of Eldorado cultivar

    Directory of Open Access Journals (Sweden)

    Alexandre Couto Rodrigues

    1999-12-01

    Full Text Available O trabalho foi realizado com o objetivo de avaliar o efeito da cianamida hidrogenada (CH2N2 no raleio de flores e frutos de pessegueiros do cultivar Eldorado. Utilizaram-se plantas com idade de 6 anos, conduzidas sob a forma de vaso e espaçamento de 6,0 x 4,0m, localizadas no Centro Agropecuário da Palma - UFPel. Os tratamentos (0; 0,15; 0,3; 0,45 e 0,6% de CH2N2 foram pulverizados em cobertura sobre ramos selecionados aleatoriamente, até o início de gotejamento, quando 100% das flores encontravam-se totalmente abertas. O produto comercial utilizado foi o Dormex (52% de CH2N2. O delineamento experimental foi o inteiramente casualizado, com três repetições. As variáveis avaliadas foram: percentual de flores raleadas 36 dias após a aplicação do produto e percentual de frutos raleados, peso médio, coloração, diâmetro, firmeza da polpa e sólidos solúveis totais por ocasião da colheita. A maior intensidade de raleio de flores (50,96% foi obtida com utilização de 0,5% de CH2N2. Na percentagem de frutos raleados, observou-se valor máximo de 9,53%, utilizando-se CH2N2 a 0,6%. O peso dos frutos aumentou com o raleio químico, porém, este não interferiu nos sólidos solúveis totais, firmeza de polpa e índice de cor dos frutos.The objective of this research was to evaluate the effect of hydrogen cyanamide (CH2N2 on the chemical thinning of peach-tree flowers and fruits of Eldorado cultivar. Six-year plants localized at Agricultural Center of Palma - UFPel were used and conducted in vase with spacing of 6.0 x 4.0m. Treatments with 0, 0.15, 0.3, 0.45 and 0.6% of CH2N2 were sprayed on randomly selected shoots until drip point, when 100% of the flowers were totally blown. Dormex (52% of hydrogen cyanamide was the commercial chemical used. A completely randomized experimental design was used, with three replications. Percentage of flowers thinned 36 days after chemical application and percentage of thinned fruits, mean fruit weight, color, diameter, flesh firmness and total soluble solids at harvest time were evaluated. It was observed statistical difference among treatments on the thinning of flowers. The use of CH2N2 0.5% showed high intensity of thinning (50,96%. Differences were also observed for the percentage of thinned fruits, however, the highest thinning was reached at 9.53% of CH2N2 0.6%. Fruit weight increased with chemical thinning, however, no changes in total soluble solids, color and fruit flesh firmness were observed.

  15. Comportamento do pessegueiro (Prunus persica L. Batsch cv. Chimarrita em diferentes sistemas de condução Behavior of the peach tree (Prunus persica L. Batsch cv. Chimarrita in different training systems

    Directory of Open Access Journals (Sweden)

    Clevison Luiz Giacobbo

    2003-08-01

    Full Text Available A persicultura, no Brasil, é praticada há bastante tempo, porém poucos estudos foram realizados visando alternativas de manejo nos pomares para aumento de produtividade. Este trabalho teve por objetivo avaliar o desenvolvimento anual do diâmetro do tronco e produção nos terceiro e quarto anos, em pessegueiro cv. Chimarrita, enxertado sobre o porta-enxerto Capdeboscq. Foram avaliados quatro sistemas de condução: I - espaçamento de 0,5 m entre plantas, conduzido em 'Áxis colunar'; II e III - 1,0 m e 2,0 m, respectivamente, conduzidos em 'Y' e IV - 4,0 m em 'Vaso' (sistema tradicional. Entre as linhas de plantio o espaçamento foi constante de 5,0 m para todos os sistemas de condução. O pomar foi implantado em julho de 1997 na Fazenda experimental do Centro Agropecuário da Palma, propriedade da Universidade Federal de Pelotas, localizada no município de Capão do Leão, RS. Avaliou-se a taxa de crescimento anual do diâmetro do tronco, produtividade, qualidade físico-química das frutas e ocorrência de podridão parda. Os resultados obtidos na taxa de crescimento foram semelhantes em ambos os anos, porém observou-se maior incremento relativo no período 2000/2001, no sistema de condução I. A produtividade foi superior no sistema I e II diferindo do sistema IV, no entanto, a qualidade físico-química e a ocorrência de podridão parda foram semelhantes em todos os sistemas.The peach culture has been practiced for a long time in Brazil but a few studies were performed aiming to define choices of orchard management for increasing productivity. The purpose of this study was to evaluate fruit production and annual growth rate of the trunk diameter in the third and fourth year after planting of peach-trees cv. "Chimarrita" on Capdeboscq rootstock. Four training systems were evaluated, as follow: I -spacing of 0,5 m among plants trained as "columnar axis"; II and III - spacing of 1 and 2 m, respectively trained as an "Y shape" and IV - 4,0 m as an "open vase" (traditional system. The space between tree rows was steady in 5,0 m for all the training systems. The orchard was implanted in July 1997 in the Experimental Farm of Centro Agropecuário da Palma, Universidade Federal de Pelotas located in a rural district of Capão do Leão, RS. The annual growth rate of the trunk diameter, productivity, physicochemical quality of fruits and rottenness occurrence were evaluated. The trunk rate was similar in both years, but a greater relative increasing was observed in 2000/2001 period for training system I. The productivity was higher in system I and II differing from the IV system, nonetheless the physicochemical quality and rottenness occurrence were similar in all systems.

  16. Exceso de agua en el suelo: efecto sobre la calidad del fruto del duraznero prunus persica (L.) batsch Excess water in the soil: effect on fruit quality of peach prunus persica (l.) batsch

    OpenAIRE

    Mirta G González; Gisela Moreno; Giardina, Ernesto B.; Mariano Di Miro

    2006-01-01

    El duraznero es un cultivo perenne que requiere para su crecimiento un suelo sin limitaciones, en base a ello el objetivo de este trabajo fue estudiar los cambios químicos producidos en el suelo en condiciones de anegamiento, desde floración hasta fructificación, relacionándolo a la calidad y cantidad de la fruta. Se trabajó con un suelo Argiudol de características vérticas, con un destacado horizonte Bt que posee 35-38% de arcilla. Se realizaron dos tratamientos: control, sin anegamiento (C)...

  17. Exceso de agua en el suelo: efecto sobre la calidad del fruto del duraznero prunus persica (L. batsch Excess water in the soil: effect on fruit quality of peach prunus persica (l. batsch

    Directory of Open Access Journals (Sweden)

    Mirta G. González

    2006-07-01

    Full Text Available El duraznero es un cultivo perenne que requiere para su crecimiento un suelo sin limitaciones, en base a ello el objetivo de este trabajo fue estudiar los cambios químicos producidos en el suelo en condiciones de anegamiento, desde floración hasta fructificación, relacionándolo a la calidad y cantidad de la fruta. Se trabajó con un suelo Argiudol de características vérticas, con un destacado horizonte Bt que posee 35-38% de arcilla. Se realizaron dos tratamientos: control, sin anegamiento (C y con anegamiento (T. En el tratamiento (C, la disponibilidad hídrica de los mismos estuvo sujeta a las condiciones climáticas que se presentaron durante el ensayo, incluyendo la realización de riego complementario permitiendo en todo momento que el suelo se mantenga en condiciones óptimas de humedad. Los resultados del ensayo estuvieron relacionados a los cambios en las características químicas del suelo, planta y fruto. Los suelos anegados tuvieron, contenidos de fósforo y potasio deficientes que repercutió en un menor rendimiento (peso del fruto fresco y seco. Los análisis químicos en planta siguieron la misma tendencia en relación a los contenidos de nitrógeno total, fósforo y potasio que disminuyeron sustancialmente como así también el contenido de materia seca. Estas variables determinaron la disminución de la calidad de fruta en relación a su firmeza y tamaño.Peach is a perennial culture that requires for its growth soils without limitations, on the basis of it the objective of this work was to study the chemical changes produced in soils on flooding conditions, from flowering to fruit production, relating it to the quality and amount of the fruit. The experiment was a done at an Argiudoll soil of vertic characteristics, with an outstanding Bt horizon that has 35- 38% of clay. Two treatments were made: control, without flooding (c and with flooding (T. In the treatment (C, the hydric availability was subject to the climatic conditions that happened during the test, including the accomplishment of complementary irrigation allowing at any moment soil to stay in optimal conditions of moisture. The results of the test were related to changes in soil chemical characteristics. Flooded soils had, deficient levels of phosphorus and potassium that resulted in a smaller yield (Fresh and dry weight of fruit. Chemical analyses in plant followed the same tendency in relation to the contents of total nitrogen, phosphorus and potassium that diminished substantially as the content of dry matter, that was reflected in the diminution of the quality of fruit in relation to its firmness and size.

  18. Screening Quality Evaluation Factors of Freeze-Dried Peach (Prunus Persica L. Batsch Powders from Different Ripening Time Cultivars

    Directory of Open Access Journals (Sweden)

    Chun-ju Liu

    2017-01-01

    Full Text Available The quality evaluation of processed products is complex. To simplify the quality evaluation process and improve the efficiency, fourteen evaluation factors of freeze-dried powders of seventeen cultivars of peach at different ripening times were analyzed. The most important evaluation indicators and criteria were obtained by analysis of variance (ANOVA, correlation analysis (CA, principal component analysis (PCA, system cluster analysis (SCA, and analytic hierarchy process (AHP. Results showed that the peach powders had the significant differences in quality (P<0.05, and some processing factors were related with some physicochemical and nutritional factors. Five principle components were extracted by PCA and the cumulative contribution achieved was 84.46%. Through the score plot of the first two principal components, a clear differentiation among ripening times was found and three distinct groups were separated according to ripening time. Five characteristic factors were obtained as titratable acid, browning index, hemicellulose, hygroscopicity, and vitamin C by SCA. Their weights of 0.1249, 0.3007, 0.0514, 0.4916, and 0.0315 were obtained by AHP, respectively. The peach cultivars were divided into four evaluation grades by the comprehensive quality score.

  19. Obtaining of nectarinum (Prunus persica (L. Batsch subsp. nectarina (Ait. Shof. polyploid plants in Nikitsky Botanical Gardens

    Directory of Open Access Journals (Sweden)

    Є. П. Шоферістов

    2008-04-01

    Full Text Available Firstly in Ukraine as the result of resiprocal interbreedings of autotetraploid (2n=4x=32 / diploid (2n=2x=16 and diploid (2n=2x=16 / autotetraploid (2n=4x=32 four sintetic triploid (2n=3x=24 hybrid forms (611-91, 13-93, 14-93, 18-93 have been obtained. Spontaneous triploid nectarinum 166-80 has been shared out from diploid hybrid seedlings population. Tetraploid and triploid nectarinum forms are valuable sources for directoinal selection and making hybrids with the complex of new signs, which are difficult or impossible to receive on diploid level.

  20. Gene regulation of anthocyanin biosynthesis in two blood-flesh peach (Prunus persica (L.) Batsch) cultivars during fruit development.

    Science.gov (United States)

    Jiao, Yun; Ma, Rui-juan; Shen, Zhi-jun; Yan, Juan; Yu, Ming-liang

    2014-09-01

    The blood-flesh peach has become popular in China due to its attractive anthocyanin-induced pigmentation and antioxidant properties. In this study, we investigated the molecular mechanisms underlying anthocyanin accumulation by examining the expression of nine genes of the anthocyanin biosynthesis pathway found in the peach mesocarp. Expression was measured at six developmental stages in fruit of two blood-flesh and one white-flesh peach cultivars, using quantitative reverse transcription polymerase chain reaction (qRT-PCR). Results show that the expression of the chalcone synthase (CHS) gene was closely related to anthocyanin accumulation in both of the blood-flesh peaches. In the white-flesh peach, we found that the transcription level of phenylalanine ammonia-lyase (PAL) during fruit development was much lower than that in the blood-flesh peach, even though all other genes of the anthocyanin biosynthesis pathway were highly expressed, suggesting that the PAL gene may be limiting in anthocyanin production in the white-flesh peach. Moreover, the transcription levels of the CHS and UDP-glucose-flavonoid 3-O-glucosyltransferase (UFGT) genes were markedly up-regulated at three days after bag removal (DABR) in the blood-flesh peach, suggesting that CHS and UFGT are the key genes in the process of anthocyanin biosynthesis for both of the blood-flesh peaches. The present study will be of great help in improving understanding of the molecular mechanisms involved in anthocyanin accumulation in blood-flesh peaches.

  1. Antioxidant capacity, quality, and anthocyanin and nutrient contents of several peach cultivars [Prunus persica (L.) Batsch] grown in Spain.

    Science.gov (United States)

    Reig, G; Iglesias, I; Gatius, F; Alegre, S

    2013-07-03

    Antioxidant capacity, quality, and anthocyanin and nutrient contents of 106 peach cultivars from different breeding programs were evaluated at the Estació Experimental de Lleida, IRTA (Catalonia, Spain), during two growing seasons (2010 and 2011). High variability was found among cultivars within each quality trait, where different cultivars were scored as the best and the worst. For example, a 5-fold range (2.17-12.07 g of malic acid L⁻¹), 6-fold range (144.20-711.73 μg of Trolox g⁻¹ of FW), and 11-fold range (0.70-11.43 mg of cyanidin-3-glucoside kg⁻¹ of FW) were observed in titratable acidity, relative antioxidant capacity, and anthocyanin content, respectively. The breeding program within each fruit type (melting peach, nectarine, and flat peach) and qualitative pomological traits also had significant effects on the quality. Nevertheless, each breeding program had specific characteristics that distinguished it from the others. Even so, within each breeding program, there is high variability among cultivars. Therefore, growers should not base their strategy exclusively on the choice of breeding program. Principal component analysis for each fruit type (melting peach, nectarine, nonmelting peach, and flat peach) allowed a selection of a set of cultivars from different breeding programs with the highest quality performance. For example, cultivars such as 'Azurite', 'IFF 1230', 'Amiga', 'Fire Top', 'African Bonnigold', 'Ferlot', 'Mesembrine', and 'Platifirst' had higher sweetness and flavor compared to the others. Therefore, this study could help breeders to make decisions for the selection of new cultivars able to improve the quality features of fruit intake, technicians to know better quality performance of peach cultivars, and consumers to meet their expectations for fruit with high health benefits and a specific taste.

  2. Genetic diversity in peach [Prunus persica (L.) Batsch] at the University of Florida: past present and future

    Science.gov (United States)

    The University of Florida (UF) stone fruit breeding and genetics program was created in 1952 to develop early ripening stone fruit cultivars with high quality, adaptation to summer rainfall, low chilling requirements, and the ability to withstand high disease pressure. Diverse germplasm sources were...

  3. Mapping quantitative trait loci associated with chilling requirement, heat requirement and bloom date in peach [Prunus persica (L.) Batsch

    Science.gov (United States)

    Chilling requirement (CR), together with heat requirement (HR), determines blooming date (BD) and climatic distribution of genotypes of temperate tree species. However, information on the genetic components underlying these important traits remains unknown or fragmentary. Here the identification o...

  4. Evaluación del comportamiento agroindustrial de variedades de duraznos conserveros (Prunus persica (L.) Batsch) en Mendoza, Argentina

    OpenAIRE

    Miguel Alejandro Ojer

    2010-01-01

    Con el objeto de aumentar los rendimientos a campo, mejorar la calidad de la materia prima y sentar las bases de futuros programas de introducción de nuevas variedades, se evaluaron 13 variedades de duraznos conserveros. A fin de dar marco a la propuesta, se analizó la situación del sector industrial, el sector de producción primaria y el panorama varietal. Se efectuaron mediciones en 5 áreas: maduración, comportamiento en la cosecha, capacidad productiva, parámetros vinculados al procesamien...

  5. Evaluación del comportamiento agroindustrial de variedades de duraznos conserveros (Prunus persica (L. Batsch en Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    Miguel Alejandro Ojer

    2010-07-01

    Full Text Available Con el objeto de aumentar los rendimientos a campo, mejorar la calidad de la materia prima y sentar las bases de futuros programas de introducción de nuevas variedades, se evaluaron 13 variedades de duraznos conserveros. A fin de dar marco a la propuesta, se analizó la situación del sector industrial, el sector de producción primaria y el panorama varietal. Se efectuaron mediciones en 5 áreas: maduración, comportamiento en la cosecha, capacidad productiva, parámetros vinculados al procesamiento en mitades y comportamiento en la agroindustria. Las determinaciones se realizaron durante 6 temporadas en 2 montes frutales en plena producción comercial. La oferta varietal se caracterizó por una sobreoferta (56,0 % del total implantado entre la última semana de enero y primera de febrero, y una escasa oferta, tan sólo del 12,2 %, a partir de mediados de febrero. Se observó un progresivo y sostenido reemplazo de las máquinas descarozadotas de torsión por las de sección. El máximo valor de la producción depende de los rendimientos, el peso de los frutos y su distribución en categorías comerciales. Sólo las variedades, Fortuna, Loadel y Carson, no superaron el nivel de producción mínimo (40 t/ha, pretendido por el sector primario. Sullivan’s Late mostró un comportamiento errático, con años de alto rendimiento y otros con baja producción. El rendimiento industrial es función principalmente del peso de frutos y la firmeza de pulpa. En el ingreso a la línea de procesamiento, la firmeza de pulpa debe estar en el rango 6 a 12 lb, aunque el óptimo es de 7 a 10 lb. Una visión integral del problema indica que la definición de la carga frutal óptima para cada variedad y el manejo de la cosecha son los dos factores de determinantes del rendimiento en campo, la calidad de la materia prima y del rendimiento industrial.

  6. Evaluación del comportamiento agroindustrial de variedades de duraznos conserveros (Prunus persica (L. Batsch en Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    Miguel Alejandro Ojer

    2010-06-01

    Full Text Available Con el objeto de aumentar los rendimientos a campo, mejorar la calidad de la materia prima y sentar las bases de futuros programas de introducción de nuevas variedades, se evaluaron 13 variedades de duraznos conserveros. A fin de dar marco a la propuesta, se analizó la situación del sector industrial, el sector de producción primaria y el panorama varietal. Se efectuaron mediciones en 5 áreas: maduración, comportamiento en la cosecha, capacidad productiva, parámetros vinculados al procesamiento en mitades y comportamiento en la agroindustria. Las determinaciones se realizaron durante 6 temporadas en 2 montes frutales en plena producción comercial. La oferta varietal se caracterizó por una sobreoferta (56,0 % del total implantado entre la última semana de enero y primera de febrero, y una escasa oferta, tan sólo del 12,2 %, a partir de mediados de febrero. Se observó un progresivo y sostenido reemplazo de las máquinas descarozadoras de torsión por las de sección. El máximo valor de la producción depende de los rendimientos, el peso de los frutos y su distribución en categorías comerciales. Sólo las variedades, Fortuna, Loadel y Carson, no superaron el nivel de producción mínimo (40 t/ha, pretendido por el sector primario. Sullivan’s Late mostró un comportamiento errático, con años de alto rendimiento y otros con baja producción. El rendimiento industrial es función principalmente del peso de frutos y la firmeza de pulpa. En el ingreso a la línea de procesamiento, la firmeza de pulpa debe estar en el rango 6 a 12 lb, aunque el óptimo es de 7 a 10 lb. Una visión integral del problema indica que la definición de la carga frutal óptima para cada variedad y el manejo de la cosecha son los dos factores determinantes del rendimiento en campo, la calidad de la materia prima y del rendimiento industrial.

  7. Parámetros de calidad durante la cosecha de durazno (Prunus persica L. Batsch cv. “Rubidoux”

    Directory of Open Access Journals (Sweden)

    Lisney Alessandra Bastidas Parrado

    2015-03-01

    Full Text Available El durazno es una fruta de importancia agrícola como parte de los cultivos caducifolios producidos en Colombia; su calidad y aceptacion comercial, asi como el momento de la cosecha, estan definidos en funcion de sus características fisicoquimicas. Esta investigacion tuvo como propósito caracterizar algunos parametros de calidad de durazno variedad Rubidoux durante el periodo de cosecha, a partir de la seleccion hecha por operarios en campo, de acuerdo al color de la piel como indicador de madurez. Durante seis semanas de la cosecha se evaluaron muestras de frutos, considerando aspectos como peso fresco, contenido de solidos solubles (oBrix, categoria comercial de acuerdo al diametro ecuatorial y color del fruto. Se registro un peso fresco promedio de 130,7 g por fruto, con un contenido de solidos solubles promedio de 11,8 oBrix, parametro que incremento progresivamente de la semana uno a la cinco. La clasificacion visual por el color de la piel permitio definir siete categorias, tres predominaron durante la cosecha (pinton, pinton-maduro y maduro, estos se correspondieron con el contenido de solidos solubles; es asi como el analisis de varianza mostro diferencias estadisticas entre oBrix y el color de piel. Durante el periodo evaluado, se cosecharon con mayor frecuencia duraznos pintones y frutos con diametro entre 60 mm a 70 mm.

  8. Parámetros de calidad durante la cosecha de durazno (Prunus persica L. Batsch cv. “Rubidoux”)

    OpenAIRE

    Lisney Alessandra Bastidas Parrado; Gloria Acened Puentes Montañez; Angela Lemus Cerón

    2015-01-01

    El durazno es una fruta de importancia agrícola como parte de los cultivos caducifolios producidos en Colombia; su calidad y aceptacion comercial, asi como el momento de la cosecha, estan definidos en funcion de sus características fisicoquimicas. Esta investigacion tuvo como propósito caracterizar algunos parametros de calidad de durazno variedad Rubidoux durante el periodo de cosecha, a partir de la seleccion hecha por operarios en campo, de acuerdo al color de la piel como indicador de mad...

  9. Estudo de conservação de pêssego [Prunus persica (L.) Batsch] minimamente processado.

    OpenAIRE

    Costa, Amauri Costa da

    2010-01-01

    O escurecimento enzimático e o amolecimento são as principais alterações em pêssegos minimamente processados. Inicialmente estudou-se a combinação de moléculas antioxidantes e protetores de textura no controle da atividade das enzimas polifenoloxidase (PPO) e peroxidase (POD), do escurecimento enzimático e do amolecimento da polpa de pêssegos, cv. Esmeralda, minimamente processados e refrigerados (MPR). Para isso testou-se o uso de L-cisteína (Cis), ácido L-ascórbico (AA) e cloreto de cálcio ...

  10. Molecular characterization of cDNAs corresponding to genes expressed during almond (Prunus amygdalus Batsch) seed development.

    Science.gov (United States)

    Garcia-Mas, J; Messeguer, R; Arús, P; Puigdomènech, P

    1995-01-01

    A number of different cDNA clones corresponding to the most abundant mRNAs present in immature seeds have been isolated from an almond (Prunus amygdalus cv. Texas) immature seed cDNA library. Those corresponding to proteins involved in storage processes have been further characterized. Two of these cDNAs (PA3BF1 and PA3BE12) code for the almond globulins (prunins), the main family of storage proteins synthesized in seeds during embryogenesis, and another cDNA (PA3BA1) codes for the 15.7 kDa almond oleosin, a protein located on the surface of oil bodies in plant seeds. These cDNAs have been sequenced and their expression during almond fruit development has been studied. Their expression is seed-specific and localized in cotyledons around 100 days after flowering. Both prunin and oleosin genes are present in one or two copies in the almond genome.

  11. Discovery and Annotation of Plant Endogenous Target Mimicry Sequences from Public Transcriptome Libraries: A Case Study of Prunus persica.

    Science.gov (United States)

    Karakülah, Gökhan

    2017-06-28

    Novel transcript discovery through RNA sequencing has substantially improved our understanding of the transcriptome dynamics of biological systems. Endogenous target mimicry (eTM) transcripts, a novel class of regulatory molecules, bind to their target microRNAs (miRNAs) by base pairing and block their biological activity. The objective of this study was to provide a computational analysis framework for the prediction of putative eTM sequences in plants, and as an example, to discover previously un-annotated eTMs in Prunus persica (peach) transcriptome. Therefore, two public peach transcriptome libraries downloaded from Sequence Read Archive (SRA) and a previously published set of long non-coding RNAs (lncRNAs) were investigated with multi-step analysis pipeline, and 44 putative eTMs were found. Additionally, an eTM-miRNA-mRNA regulatory network module associated with peach fruit organ development was built via integration of the miRNA target information and predicted eTM-miRNA interactions. My findings suggest that one of the most widely expressed miRNA families among diverse plant species, miR156, might be potentially sponged by seven putative eTMs. Besides, the study indicates eTMs potentially play roles in the regulation of development processes in peach fruit via targeting specific miRNAs. In conclusion, by following the step-by step instructions provided in this study, novel eTMs can be identified and annotated effectively in public plant transcriptome libraries.

  12. Green synthesis of nitrogen-doped graphitic carbon sheets with use of Prunus persica for supercapacitor applications

    Science.gov (United States)

    Atchudan, Raji; Edison, Thomas Nesakumar Jebakumar Immanuel; Perumal, Suguna; Lee, Yong Rok

    2017-01-01

    Nitrogen-doped graphitic carbon sheets (N-GCSs) were prepared from the extract of unripe Prunus persica fruit by a direct hydrothermal method. The synthesized N-GCSs were examined by high resolution transmission electron microscopy (HRTEM), nitrogen adsorption-desorption isotherms, X-ray diffraction (XRD), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and Fourier transform infrared (FT-IR) spectroscopy. HRTEM showed that the synthesized carbon sheets were graphitic with lattice fringes and an inter-layer distance of 0.36 nm. Doping with the nitrogen moiety present over the synthesized GCSs was confirmed by XPS, FT-IR spectroscopy, and energy dispersive X-ray spectroscopy elemental mapping. The fruit extract associated with hydrothermal-carbonization method is economical and eco-friendly with a single step process. The resulting carbon sheets could be modified and are promising candidates for nano-electronic applications, including supercapacitors. The synthesized N-GCSs-2 provided a high specific capacitance of 176 F g-1 at a current density of 0.1 A g-1. This electrode material has excellent cyclic stability, even after 2000 cycles of charge-discharge at a current density of 0.5 A g-1.

  13. Mapping quantitative trait loci associated with chilling requirement, heat requirement and bloom date in peach (Prunus persica).

    Science.gov (United States)

    Fan, Shenghua; Bielenberg, Douglas G; Zhebentyayeva, Tetyana N; Reighard, Gregory L; Okie, William R; Holland, Doron; Abbott, Albert G

    2010-03-01

    *Chilling requirement, together with heat requirement, determines the bloom date, which has an impact on the climatic distribution of the genotypes of tree species. The molecular basis of floral bud chilling requirement is poorly understood, despite its importance to the adaptation and production of fruit trees. In addition, the genetic nature of heat requirement and the genetic interrelationships among chilling requirement, heat requirement and bloom date remain unclear. *A peach (Prunus persica) F(2) population of 378 genotypes developed from two genotypes with contrasting chilling requirements was used for linkage map construction and quantitative trait loci (QTL) mapping. The floral bud chilling and heat requirements of each genotype were evaluated over 2 yr and the bloom date was scored over 4 yr. *Twenty QTLs with additive effects were identified for three traits, including one major QTL for chilling requirement and two major QTLs for bloom date. The majority of QTLs colocalized with QTLs for other trait(s). In particular, one genomic region of 2 cM, pleiotropic for the three traits, overlapped with the sequenced peach EVG region. *This first report on the QTL mapping of floral bud chilling requirement will facilitate marker-assisted breeding for low chilling requirement cultivars and the map-based cloning of genes controlling chilling requirement. The extensive colocalization of QTLs suggests that there may be one unified temperature sensing and action system regulating chilling requirement, heat requirement and bloom date together.

  14. Genome-wide analysis and identification of KT/HAK/KUP potassium transporter gene family in peach (Prunus persica).

    Science.gov (United States)

    Song, Z Z; Ma, R J; Yu, M L

    2015-01-30

    The KT/HAK/KUP family members encoding high-affinity potassium (K(+)) transporters mediate K(+) transport across the plasma membranes of plant cells to maintain plant normal growth and metabolic activities. In this paper, we identified 16 potassium transporter genes in the peach (Prunus persica) using the Hidden Markov model scanning strategy and searching the peach genome database. Utilizing the Arabidopsis KT/HAK/KUP family as a reference, phylogenetic analysis indicates that the KT/HAK/KUP family in the peach can be classified into 3 groups. Genomic localization indicated that 16 KT/HAK/KUP family genes were well distributed on 7 scaffolds. Gene structure analysis showed that the KT/HAK/KUP family genes have 6-9 introns. In addition, all of the KT/HAK/KUP family members were hydrophobic proteins; they exhibited similar secondary structure patterns and homologous tertiary structures. Putative cis-elements involved in abiotic stress adaption, Ca(2+) response, light and circadian rhythm regulation, and seed development were observed in the promoters of the KT/HAK/KUP family genes. Subcellular localization prediction indicated that the KT/HAK/KUP members were mainly located in the plasma membrane. Expression levels of the KT/HAK/ KUP family genes were much higher in the fruit and flower than those in the other 7 tissues examined, indicating that the KT/HAK/KUP family genes may have important roles in K(+) uptake and transport, which mainly contribute to flower formation and fruit development in the peach.

  15. Chemometric evaluation of trace metals in Prunus persica L. Batech and Malus domestica from Minićevo (Serbia).

    Science.gov (United States)

    Alagić, Slađana Č; Tošić, Snežana B; Dimitrijević, Mile D; Petrović, Jelena V; Medić, Dragana V

    2017-02-15

    The samples of spatial soils and different organs of Prunus persica L. Batech and Malus domestica were analyzed by methods such as inductively coupled plasma optical emission spectroscopy (ICP-OES), Hierarchical Cluster Analysis (HCA), One-way ANOVA, and calculation of biological accumulation factors (BAFs) with the aim of investigating whether these methods may help in the evaluation of trace metals in plants, as well as in the estimation of plant bioaccumulation potentials. ICP-OES provided accurate data on present concentrations of Cu, Zn, Pb, As, Cd, and Ni which showed that most concentrations were in normal ranges, except in some cases for Cu, Zn, and As. HCA illustrated nicely various specifics in the distribution of metals in both investigated systems plant-soil. One-way ANOVA pointed successfully on the existing statistical differences between metal concentrations. Calculated BAFs showed that both plants had very low accumulation rates for all elements; they acted as metal excluders. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Chemical characterization and thermal properties of kernel oils from Tunisian peach and nectarine varieties of Prunus persica

    Directory of Open Access Journals (Sweden)

    D. Chamli

    2017-09-01

    Full Text Available A comparative study was conducted to determine the fatty acids, triacylglycerol compositions and thermal properties of Tunisian kernel oils from the Prunus persica varieties, peach and nectarine, grown in two areas of Tunisia, Gabes and Morneg. Qualitatively, the fatty acids composition and triacylglycerol species were identical for all samples. Oleic acid (67.7-75.0% was the main fatty acid, followed by linoleic (15.7-22.1% and palmitic (5.6-6.3% acids. The major triacylglycerol species were triolein, OOO (38.4-50.5%, followed by OOL (18.2-23.2%, POO (8.3-9.7% and OLL (6.3-10.1%. The thermal profiles were highly influenced by the high content of triolein due to the importance of oleic acid in these oils. Moreover, the fatty acids distribution in TAG external positions was determined as corresponding to an α asymmetry coefficient that was between 0.10 and 0.12, indicating a high asymmetry in the distribution of saturated fatty acids in the position sn-1 and sn-3 in the TAG species of all samples.

  17. Improvement of physicochemical properties and phenolic compounds bioavailability by concentrating dietary fiber of peach (Prunus persica) juice by-product.

    Science.gov (United States)

    Rodríguez-González, Sarahí; Pérez-Ramírez, Iza F; Castaño-Tostado, Eduardo; Amaya-Llano, Silvia; Rodríguez-García, Mario E; Reynoso-Camacho, Rosalía

    2017-12-06

    This study aimed to concentrate dietary fiber (DF) from peach (Prunus persica) juice by-product (PJBP), to improve its functional properties, and its polyphenols bioavailability. The dietary fiber concentrates (DFC) were obtained from PJBP using water/ethanol treatments (100:0, 20:80, 50:50, 80:20, and 0:100, v/v) at 1:5 ratio (wet weight/solvent, w/v) for 5 and 20 min at 21 °C. All treatments concentrated condensed tannins, total and insoluble DF, founding the highest content with 100% H2O treatment. The major polyphenols of DFC were 4-O-caffeoylquinic, chlorogenic, and 1,5-Di-O-caffeoylquinic acids. Water and oil retention capacity and maximum glucose diffusion rate were improved mainly with 100% H2O treatment. Healthy rats were fed with standard diet supplemented with 8% of PJBP, DFC obtained with 100% H2O for 5 min, or DFC obtained with 20% EtOH for 5 min. Gastrointestinal digesta weight and viscosity were increased in animals supplemented with 100% H2O DFC. Moreover, the urinary excretion of polyphenol metabolites, mainly glucuronide and sulfate conjugates, was increased with this treatment, indicating a greater bioavailability of PJBP polyphenols, which was associated with an increased dietary fiber porosity. Water treatment could be used to potentiate PJBP functional properties and polyphenols bioavailability. This article is protected by copyright. All rights reserved.

  18. Evaluation of different doses of gamma radiation on physicochemical characteristics of peach Prunus persica (cv. Chimarrita) minimally processed

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Ana Claudia S.; Silva, Lucia C.A.S.; Perecin, Thalita Neme; Arthur, Valter; Harder, Marcia N.C. [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil). Dept. de Radiobiologia e Ambiente], e-mail: acsoliveira@usp.br, e-mail: arthur@cena.usp.br; Mansi, Debora N.; Canniatti-Brazaca, Solange G. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ/USP), Piracicaba, SP (Brazil). Dept. de Agroindustria, Alimentos e Nutricao

    2009-07-01

    The objective was to evaluate the effect of different doses of gamma radiation on the physico-chemical characteristics of peach Prunus persica (cv. Chimarrita) minimally processed, to increase the useful life of the fruit. The peaches were purchased at Ceasa of Campinas/SP and taken to the Laboratory of Radiobiology and Environment of CENA/USP (Piracicaba/SP), which were washed in tap water, peeled and cut into four pieces. The pieces of peach were dipped in sodium hypochlorite solution of 15 mL/L for 4 minutes and dry in a plastic support. Then it were placed in plastic containers (polypropylene). Subsequently, they were irradiated in a Cobalt-60 source, type Gammacell-220 (dose rate of 0,543 kGy/hour) with doses of: 0 (control), 1.0 and 2.0 kGy and stored at a temperature of 8 deg C. The experimental was developed entirely at random with 3 replicates for each treatment. For the statistic analysis was using the Tuckey test at 5% level of probability. Subsequently, analysis was carried out: color factors (l, a, b), pH, soluble solids (deg Brix), acidity and vitamin C. The tests were performed at 1, 3 and 6 days after irradiation. According to the results concluded that the analysis of color and acidity there was no significant difference between treatments, however, for the soluble solids (deg Brix), vitamin C and texture significant difference showing a decrease proportional to increasing doses of radiation and storage time. But the pH increased in relation to dose and during the analysis. (author)

  19. Differences in cold hardiness, carbohydrates, dehydrins and related gene expressions under an experimental deacclimation and reacclimation in Prunus persica.

    Science.gov (United States)

    Shin, Hyunsuk; Oh, Youngjae; Kim, Daeil

    2015-08-01

    To boost our understanding of a recent outbreak of freezing injury, we sought to confirm distinctive features between the shoot tissues of the peach (Prunus persica) cultivars Daewol and Kiraranokiwami by mimicking unseasonable changes of temperatures that occur in the early spring through repeated deacclimation and reacclimation treatments. Patterns of cold hardiness declined dramatically during the deacclimation and rose during the reacclimation in both cultivars. Our results indicated that 'Daewol' possessed higher capacity in response to repeated deacclimation and reacclimation treatments than 'Kiraranokiwami'. 'Daewol' showed more sensitive changes in the carbohydrates in response to warm and low temperatures compared with 'Kiraranokiwami'. 'Daewol' indicated almost similar repeated down- and up-patterns in soluble sugar content in response to repeated deacclimation and reacclimation, whereas it indicated repeated up- and down-patterns in starch content. However, 'Kiraranokiwami' showed a progressive increase in the soluble sugar content and a progressive decrease in starch content. Notably, patterns of accumulation of a 60-kDa dehydrin protein encoded by the PpDhn1 gene were confirmed through western blotting and paralleled fluctuations of cold hardiness in both cultivars. Expression of this dehydrin was weak in both cultivars during deacclimation but its band intensity increased during reacclimation. Changes in related genes (β-amylase, PpDhn1, PpDhn2 and PpDhn3) were positively correlated with changes in cold hardiness throughout the experiment. Our results indicate that recent repeated warm periods may cause premature deacclimation in the early spring, and that more cold-tolerant cultivar may be more resilient to freezing injury caused by unstable temperature conditions. © 2014 Scandinavian Plant Physiology Society.

  20. Transcriptional regulation of flavonoid biosynthesis in nectarine (Prunus persica) by a set of R2R3 MYB transcription factors.

    Science.gov (United States)

    Ravaglia, Daniela; Espley, Richard V; Henry-Kirk, Rebecca A; Andreotti, Carlo; Ziosi, Vanina; Hellens, Roger P; Costa, Guglielmo; Allan, Andrew C

    2013-04-25

    Flavonoids such as anthocyanins, flavonols and proanthocyanidins, play a central role in fruit colour, flavour and health attributes. In peach and nectarine (Prunus persica) these compounds vary during fruit growth and ripening. Flavonoids are produced by a well studied pathway which is transcriptionally regulated by members of the MYB and bHLH transcription factor families. We have isolated nectarine flavonoid regulating genes and examined their expression patterns, which suggests a critical role in the regulation of flavonoid biosynthesis. In nectarine, expression of the genes encoding enzymes of the flavonoid pathway correlated with the concentration of proanthocyanidins, which strongly increases at mid-development. In contrast, the only gene which showed a similar pattern to anthocyanin concentration was UDP-glucose-flavonoid-3-O-glucosyltransferase (UFGT), which was high at the beginning and end of fruit growth, remaining low during the other developmental stages. Expression of flavonol synthase (FLS1) correlated with flavonol levels, both temporally and in a tissue specific manner. The pattern of UFGT gene expression may be explained by the involvement of different transcription factors, which up-regulate flavonoid biosynthesis (MYB10, MYB123, and bHLH3), or repress (MYB111 and MYB16) the transcription of the biosynthetic genes. The expression of a potential proanthocyanidin-regulating transcription factor, MYBPA1, corresponded with proanthocyanidin levels. Functional assays of these transcription factors were used to test the specificity for flavonoid regulation. MYB10 positively regulates the promoters of UFGT and dihydroflavonol 4-reductase (DFR) but not leucoanthocyanidin reductase (LAR). In contrast, MYBPA1 trans-activates the promoters of DFR and LAR, but not UFGT. This suggests exclusive roles of anthocyanin regulation by MYB10 and proanthocyanidin regulation by MYBPA1. Further, these transcription factors appeared to be responsive to both

  1. Unravelling early events in the Taphrina deformans-Prunus persica interaction: an insight into the differential responses in resistant and susceptible genotypes.

    Science.gov (United States)

    Svetaz, Laura A; Bustamante, Claudia A; Goldy, Camila; Rivero, Nery; Müller, Gabriela L; Valentini, Gabriel H; Fernie, Alisdair R; Drincovich, María F; Lara, María V

    2017-08-01

    Leaf peach curl is a devastating disease affecting leaves, flowers and fruits, caused by the dimorphic fungus Taphrina deformans. To gain insight into the mechanisms of fungus pathogenesis and plant responses, leaves of a resistant and two susceptible Prunus persica genotypes were inoculated with blastospores (yeast), and the infection was monitored during 120 h post inoculation (h.p.i.). Fungal dimorphism to the filamentous form and induction of reactive oxygen species (ROS), callose synthesis, cell death and defence compound production were observed independently of the genotype. Fungal load significantly decreased after 120 h.p.i. in the resistant genotype, while the pathogen tended to grow in the susceptible genotypes. Metabolic profiling revealed a biphasic re-programming of plant tissue in susceptible genotypes, with an initial stage co-incident with the yeast form of the fungus and a second when the hypha is developed. Transcriptional analysis of PRs and plant hormone-related genes indicated that pathogenesis-related (PR) proteins are involved in P. persica defence responses against T. deformans and that salicylic acid is induced in the resistant genotype. Conducted experiments allowed the elucidation of common and differential responses in susceptible versus resistant genotypes and thus allow us to construct a picture of early events during T. deformans infection. © 2017 John Wiley & Sons Ltd.

  2. Evidence of differences between the communities of arbuscular mycorrhizal fungi colonizing galls and roots of Prunus persica infected by the root-knot nematode Meloidogyne incognita.

    Science.gov (United States)

    Alguacil, Maria del Mar; Torrecillas, Emma; Lozano, Zenaida; Roldán, Antonio

    2011-12-01

    Arbuscular mycorrhizal fungi (AMF) play important roles as plant protection agents, reducing or suppressing nematode colonization. However, it has never been investigated whether the galls produced in roots by nematode infection are colonized by AMF. This study tested whether galls produced by Meloidogyne incognita infection in Prunus persica roots are colonized by AMF. We also determined the changes in AMF composition and biodiversity mediated by infection with this root-knot nematode. DNA from galls and roots of plants infected by M. incognita and from roots of noninfected plants was extracted, amplified, cloned, and sequenced using AMF-specific primers. Phylogenetic analysis using the small-subunit (SSU) ribosomal DNA (rDNA) data set revealed 22 different AMF sequence types (17 Glomus sequence types, 3 Paraglomus sequence types, 1 Scutellospora sequence type, and 1 Acaulospora sequence type). The highest AMF diversity was found in uninfected roots, followed by infected roots and galls. This study indicates that the galls produced in P. persica roots due to infection with M. incognita were colonized extensively by a community of AMF, belonging to the families Paraglomeraceae and Glomeraceae, that was different from the community detected in roots. Although the function of the AMF in the galls is still unknown, we hypothesize that they act as protection agents against opportunistic pathogens.

  3. Bioinformatics prediction of miRNAs in the Prunus persica genome with validation of their precise sequences by miR-RACE.

    Science.gov (United States)

    Zhang, Yanping; Bai, Youhuang; Han, Jian; Chen, Ming; Kayesh, Emrul; Jiang, Weibing; Fang, Jinggui

    2013-01-01

    We predicted 262 potential MicroRNAs (miRNAs) belonging to 70 miRNA families from the peach (Prunus persica) genome and two specific 5' and 3' miRNA rapid amplification of cDNA ends (miR-RACE) PCR reactions and sequence-directed cloning were employed to accurately validate 61 unique P. persica miRNAs (Ppe-miRNAs) sequences belonging to 61 families comprising 97 Ppe-miRNAs. Validation of the termini nucleotides in particular can define the real sequences of the Ppe-miRNAs on peach genome. Comparison between predicted and validated Ppe-miRNAs through alignment revealed that 43 unique orthologous sequences were identical, while the remaining 18 exhibited some divergences at their termini nucleotides. Quantitative real-time polymerase chain reaction (qRT-PCR) was further employed to analyze the expression of all the 61 miRNAs and 10 putative targets of 8 randomly selected Ppe-miRNAs in peach leaves, flowers and fruits at different stages of development, where both the miRNAs and the putative target genes showed tissue-specific expression. Copyright © 2012 Elsevier GmbH. All rights reserved.

  4. The high-quality draft genome of peach (Prunus persica) identifies unique patterns of genetic diversity, domestication and genome evolution.

    Science.gov (United States)

    Verde, Ignazio; Abbott, Albert G; Scalabrin, Simone; Jung, Sook; Shu, Shengqiang; Marroni, Fabio; Zhebentyayeva, Tatyana; Dettori, Maria Teresa; Grimwood, Jane; Cattonaro, Federica; Zuccolo, Andrea; Rossini, Laura; Jenkins, Jerry; Vendramin, Elisa; Meisel, Lee A; Decroocq, Veronique; Sosinski, Bryon; Prochnik, Simon; Mitros, Therese; Policriti, Alberto; Cipriani, Guido; Dondini, Luca; Ficklin, Stephen; Goodstein, David M; Xuan, Pengfei; Del Fabbro, Cristian; Aramini, Valeria; Copetti, Dario; Gonzalez, Susana; Horner, David S; Falchi, Rachele; Lucas, Susan; Mica, Erica; Maldonado, Jonathan; Lazzari, Barbara; Bielenberg, Douglas; Pirona, Raul; Miculan, Mara; Barakat, Abdelali; Testolin, Raffaele; Stella, Alessandra; Tartarini, Stefano; Tonutti, Pietro; Arús, Pere; Orellana, Ariel; Wells, Christina; Main, Dorrie; Vizzotto, Giannina; Silva, Herman; Salamini, Francesco; Schmutz, Jeremy; Morgante, Michele; Rokhsar, Daniel S

    2013-05-01

    Rosaceae is the most important fruit-producing clade, and its key commercially relevant genera (Fragaria, Rosa, Rubus and Prunus) show broadly diverse growth habits, fruit types and compact diploid genomes. Peach, a diploid Prunus species, is one of the best genetically characterized deciduous trees. Here we describe the high-quality genome sequence of peach obtained from a completely homozygous genotype. We obtained a complete chromosome-scale assembly using Sanger whole-genome shotgun methods. We predicted 27,852 protein-coding genes, as well as noncoding RNAs. We investigated the path of peach domestication through whole-genome resequencing of 14 Prunus accessions. The analyses suggest major genetic bottlenecks that have substantially shaped peach genome diversity. Furthermore, comparative analyses showed that peach has not undergone recent whole-genome duplication, and even though the ancestral triplicated blocks in peach are fragmentary compared to those in grape, all seven paleosets of paralogs from the putative paleoancestor are detectable.

  5. Firmness prediction in Prunus persica 'Calrico' peaches by visible/short-wave near infrared spectroscopy and acoustic measurements using optimised linear and non-linear chemometric models.

    Science.gov (United States)

    Lafuente, Victoria; Herrera, Luis J; Pérez, María del Mar; Val, Jesús; Negueruela, Ignacio

    2015-08-15

    In this work, near infrared spectroscopy (NIR) and an acoustic measure (AWETA) (two non-destructive methods) were applied in Prunus persica fruit 'Calrico' (n = 260) to predict Magness-Taylor (MT) firmness. Separate and combined use of these measures was evaluated and compared using partial least squares (PLS) and least squares support vector machine (LS-SVM) regression methods. Also, a mutual-information-based variable selection method, seeking to find the most significant variables to produce optimal accuracy of the regression models, was applied to a joint set of variables (NIR wavelengths and AWETA measure). The newly proposed combined NIR-AWETA model gave good values of the determination coefficient (R(2)) for PLS and LS-SVM methods (0.77 and 0.78, respectively), improving the reliability of MT firmness prediction in comparison with separate NIR and AWETA predictions. The three variables selected by the variable selection method (AWETA measure plus NIR wavelengths 675 and 697 nm) achieved R(2) values 0.76 and 0.77, PLS and LS-SVM. These results indicated that the proposed mutual-information-based variable selection algorithm was a powerful tool for the selection of the most relevant variables. © 2014 Society of Chemical Industry.

  6. Identification of miRNAs and their target genes in peach (Prunus persica L.) using high-throughput sequencing and degradome analysis.

    Science.gov (United States)

    Luo, Xiaoyan; Gao, Zhihong; Shi, Ting; Cheng, Zongming; Zhang, Zhen; Ni, Zhaojun

    2013-01-01

    MicroRNAs play critical roles in various biological and metabolic processes. The function of miRNAs has been widely studied in model plants such as Arabidopsis and rice. However, the number of identified miRNAs and related miRNA targets in peach (Prunus persica) is limited. To understand further the relationship between miRNAs and their target genes during tissue development in peach, a small RNA library and three degradome libraries were constructed from three tissues for deep sequencing. We identified 117 conserved miRNAs and 186 novel miRNA candidates in peach by deep sequencing and 19 conserved miRNAs and 13 novel miRNAs were further evaluated for their expression by RT-qPCR. The number of gene targets that were identified for 26 conserved miRNA families and 38 novel miRNA candidates, were 172 and 87, respectively. Some of the identified miRNA targets were abundantly represented as conserved miRNA targets in plant. However, some of them were first identified and showed important roles in peach development. Our study provides information concerning the regulatory network of miRNAs in peach and advances our understanding of miRNA functions during tissue development.

  7. Drought resistance of introdused nectarine varieties (Prunus persica (L. Batsch subsp. nucipersica Dipp. in the conditions of South Coast of the Crimea

    Directory of Open Access Journals (Sweden)

    Т. В. Шишова

    2008-04-01

    Full Text Available The studying results of drought resistance for introdused nectarine varieties in the conditions of South Coast of the Crimea have been given. Four varieties shoved high resistance to drought conditions during two years have been selected.

  8. Drought-resistant of nectarine varieties and forms (Prunus persica (L. Batsch subsp. nectarina (Ait. Shof. with the sign of male infertility.

    Directory of Open Access Journals (Sweden)

    О. О. Іващенко

    2011-07-01

    Full Text Available The drought-resistance of 15 nectarine varieties and forms with a sign of male infertility is studied. The research identified genotypes with varying degrees of drought-resistance. The greatest degree of drought-resistance demonstrated the form 33-3-1, 512-86,41-15-2, and grade Kul'dzhinskiy 4x, Krymtsuht, Elbertaziya.

  9. The antitussive activity of polysaccharides from Althaea officinalis l., var. Robusta, Arctium lappa L., var. Herkules, and Prunus persica L., Batsch.

    Science.gov (United States)

    Sutovska, M; Nosalova, G; Franova, S; Kardosova, A

    2007-01-01

    The therapy of pathological type of cough presents serious medical problem. The aim of experiments was to investigate polysaccacharide influence on experimentally induced cough. The purified and/or modified polysaccharides from the flowers and plants, characterized by chemical composition and molecular properties were subjected to tests for antitussive activity on cough, induced mechanically in conscious cats of both sexes. The results revealed that the tested polysaccharides exhibited statistically significant cough-suppressing activity, which was noticeably higher than that of the non-narcotic drug used in clinical practice to treat coughing. The most expressive antitussive activity was observed with the polysaccharide from marsh mallow, containing the highest proportion of the uronic acid constituent. Negative influence of the tested compounds on expectoration was negligible when compared to that of codeine. Antitussive activity of various plant polysaccharides was confirmed. These results allow ranging them among prospective antitussive agents (Tab. 2, Fig. 6, Ref. 15) Full Text (Free, PDF) www.bmj.sk.

  10. DNA-based identification of Armillaria isolates from peach [Prunus persica (l.) batsch] orchards in méxico state, Mexico

    Science.gov (United States)

    Ruben D. Elias-Roman; Ned B. Klopfenstein; Mee-Sook Kim; Dionicio Alvarado-Rosales; John W. Hanna; Amy L. Ross-Davis; Remigio Anastacio Guzman-Plazola; Guillermo Calderon-Zavala; Antonio Mora-Aguilera

    2013-01-01

    A collaborative project between the Programa de Fitopatología, Colegio de Postgraduados, Texcoco, Edo. de México and the USDA Forest Service-RMRS, Moscow Forest Pathology Laboratory began in 2011 to identify which species of Armillaria are causing widespread and severe damage to the peach orchards from México State, México. We are employing a DNA-based approach in...

  11. PpYUC11, a strong candidate gene for the stony hard phenotype in peach (Prunus persica L. Batsch), participates in IAA biosynthesis during fruit ripening.

    Science.gov (United States)

    Pan, Lei; Zeng, Wenfang; Niu, Liang; Lu, Zhenhua; Liu, Hui; Cui, Guochao; Zhu, Yunqin; Chu, Jinfang; Li, Weiping; Fang, Weichao; Cai, Zuguo; Li, Guohuai; Wang, Zhiqiang

    2015-12-01

    High concentrations of indole-3-acetic acid (IAA) are required for climacteric ethylene biosynthesis to cause fruit softening in melting flesh peaches at the late ripening stage. By contrast, the fruits of stony hard peach cultivars do not soften and produce little ethylene due to the low IAA concentrations. To investigate the regulation of IAA accumulation during peach ripening [the transition from stage S3 to stage S4 III (climacteric)], a digital gene expression (DGE) analysis was performed. The expression patterns of auxin-homeostasis-related genes were compared in fruits of the melting flesh peach 'Goldhoney 3' and the stony hard flesh peach 'Yumyeong' during the ripening stage. It is revealed here that a YUCCA flavin mono-oxygenase gene (PpYUC11, ppa008176m), a key gene in auxin biosynthesis, displayed an identical differential expression profile to the profiles of IAA accumulation and PpACS1 transcription: the mRNA transcripts increased at the late ripening stage in melting flesh peaches but were below the limit of detection in mature fruits of stony hard peaches. In addition, the strong association between intron TC microsatellite genotypes of PpYUC11 and the flesh texture (normal or stony hard) is described in 43 peach varieties, indicating that this locus may be responsible for the stony hard phenotype in peach. These findings support the hypothesis that PpYUC11 may play an essential role in auxin biosynthesis during peach fruit ripening and is a candidate gene for the control of the stony hard phenotype in peach. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  12. Effects of storage temperature, storage duration, and subsequent ripening on the physicochemical characteristics, volatile compounds, and phytochemicals of Western Red nectarine (Prunus persica L. Batsch).

    Science.gov (United States)

    Aubert, Christophe; Bony, Philippe; Chalot, Guillaume; Landry, Pierre; Lurol, Sebastien

    2014-05-21

    Western Red nectarines, harvested at commercial maturity, were stored for up to 20 days at 1, 4, or 8 °C and then transferred to 25 °C for 0 or 4 days. The main physicochemical attributes, phytochemicals, and volatile compounds were then determined. During storage and ripening, firmness, titratable acidity, organic acids, and C6 volatile compounds decreased, whereas ethylene production, lactones, and C13 norisoprenoids greatly increased. Soluble solids content, sugars, and polyphenols remained quite constant during both stages. During storage, vitamin C decreased and carotenoids did not significantly change, whereas both greatly increased during ripening. Increased time of low-temperature storage has been found to decrease lactones and C13 norisoprenoids in nectarine and, consequently, to limit its aroma during maturation. Finally, Western Red nectarine was found hardly chilling injury sensitive, and trends for sugars, polyphenols and lactones observed in this study were contrary to those generally reported in the literature for chilling-injured fruit.

  13. The KNOTTED-like genes of peach (Prunus persica L. Batsch) are differentially expressed during drupe growth and the class 1 KNOPE1 contributes to mesocarp development.

    Science.gov (United States)

    Testone, Giulio; Condello, Emiliano; Di Giacomo, Elisabetta; Nicolodi, Chiara; Caboni, Emilia; Rasori, Angela; Bonghi, Claudio; Bruno, Leonardo; Bitonti, Maria Beatrice; Giannino, Donato

    2015-08-01

    The Knotted-like transcription factors (KNOX) contribute to plant organ development. The expression patterns of peach KNOX genes showed that the class 1 members act precociously (S1-S2 stages) and differentially during drupe growth. Specifically, the transcription of KNOPE1 and 6 decreased from early (cell division) to late (cell expansion) S1 sub-stages, whilst that of STMlike1, 2, KNOPE2, 2.1 ceased at early S1. The KNOPE1 role in mesocarp was further addressed by studying the mRNA localization in the pulp cells and vascular net at early and late S1. The message signal was first diffuse in parenchymatous cells and then confined to hypodermal cell layers, showing that the gene down-tuning accompanied cell expansion. As for bundles, the mRNA mainly featured in the procambium/phloem of collateral open types and subsequently in the phloem side of complex structures (converging bundles, ducts). The KNOPE1 overexpression in Arabidopsis caused fruit shortening, decrease of mesocarp cell size, diminution of vascular lignification together with the repression of the major gibberellin synthesis genes AtGA20ox1 and AtGA3ox1. Negative correlation between the expression of KNOPE1 and PpGA3ox1 was observed in four cultivars at S1, suggesting that the KNOPE1 repression of PpGA3ox1 may regulate mesocarp differentiation by acting on gibberellin homeostasis. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  14. Genotyping by Sequencing for SNP-Based Linkage Map Construction and QTL Analysis of Chilling Requirement and Bloom Date in Peach [Prunus persica (L.) Batsch].

    Science.gov (United States)

    Bielenberg, Douglas Gary; Rauh, Bradley; Fan, Shenghua; Gasic, Ksenija; Abbott, Albert Glenn; Reighard, Gregory Lynn; Okie, William R; Wells, Christina Elizabeth

    2015-01-01

    Low-cost, high throughput genotyping methods are crucial to marker discovery and marker-assisted breeding efforts, but have not been available for many 'specialty crops' such as fruit and nut trees. Here we apply the Genotyping-By-Sequencing (GBS) method developed for cereals to the discovery of single nucleotide polymorphisms (SNPs) in a peach F2 mapping population. Peach is a genetic and genomic model within the Rosaceae and will provide a template for the use of this method with other members of this family. Our F2 mapping population of 57 genotypes segregates for bloom time (BD) and chilling requirement (CR) and we have extensively phenotyped this population. The population derives from a selfed F1 progeny of a cross between 'Hakuho' (high CR) and 'UFGold' (low CR). We were able to successfully employ GBS and the TASSEL GBS pipeline without modification of the original methodology using the ApeKI restriction enzyme and multiplexing at an equivalent of 96 samples per Illumina HiSeq 2000 lane. We obtained hundreds of SNP markers which were then used to construct a genetic linkage map and identify quantitative trait loci (QTL) for BD and CR.

  15. Genotyping by Sequencing for SNP-Based Linkage Map Construction and QTL Analysis of Chilling Requirement and Bloom Date in Peach [Prunus persica (L. Batsch].

    Directory of Open Access Journals (Sweden)

    Douglas Gary Bielenberg

    Full Text Available Low-cost, high throughput genotyping methods are crucial to marker discovery and marker-assisted breeding efforts, but have not been available for many 'specialty crops' such as fruit and nut trees. Here we apply the Genotyping-By-Sequencing (GBS method developed for cereals to the discovery of single nucleotide polymorphisms (SNPs in a peach F2 mapping population. Peach is a genetic and genomic model within the Rosaceae and will provide a template for the use of this method with other members of this family. Our F2 mapping population of 57 genotypes segregates for bloom time (BD and chilling requirement (CR and we have extensively phenotyped this population. The population derives from a selfed F1 progeny of a cross between 'Hakuho' (high CR and 'UFGold' (low CR. We were able to successfully employ GBS and the TASSEL GBS pipeline without modification of the original methodology using the ApeKI restriction enzyme and multiplexing at an equivalent of 96 samples per Illumina HiSeq 2000 lane. We obtained hundreds of SNP markers which were then used to construct a genetic linkage map and identify quantitative trait loci (QTL for BD and CR.

  16. Influence of antioxidant compounds, total sugars and genetic background on the chilling injury susceptibility of a non-melting peach (Prunus persica (L.) Batsch) progeny.

    Science.gov (United States)

    Abidi, Walid; Cantín, Celia M; Jiménez, Sergio; Giménez, Rosa; Moreno, María Ángeles; Gogorcena, Yolanda

    2015-01-01

    To identify genotypes with good organoleptic properties, antioxidant-rich content and low susceptibility to chilling injury (CI), fruits from 130 peach cultivars were studied over three consecutive years. Pomological traits, l-ascorbic acid, flavonoids, total phenolics, relative antioxidant capacity (RAC) and sugars were determined. Major symptoms of CI developed at 5 °C, such as leatheriness, flesh browning, bleeding and loss of flavor, were evaluated. The population exhibited wide phenotypic variation in agronomic and biochemical traits. Six genotypes with high total phenolics, RAC, flavonoids and total sugars were selected. The progeny also showed variability for all evaluated CI symptoms, and 16 genotypes showed considerably lower susceptibility to CI. After 2 weeks of cold storage, leatheriness and bleeding were the main CI symptoms observed, whereas flesh browning was predominant after 4 weeks. It was possible to find varieties with high phenolic concentration and relatively low or intermediate CI susceptibility (22, 33, 68, 80, 81, 96 and 120). However, the correlations observed between CI and phenolic contents highlight their potential influence on susceptibility to internal browning. This relationship should be considered in the current breeding programs to select cultivars with high bioactive compound contents, health-enhancing properties and good postharvest performance. © 2014 Society of Chemical Industry.

  17. Construction of a genetic linkage map for identification of molecular markers associated with resistance to Xanthomonas arboriciola pv. pruni in peach [Prunus persica (L.) Batsch

    Science.gov (United States)

    Bacterial spot, caused by Xanthomonas campestris pv. pruni, is a serious disease that can affect peach fruit quality and production. The molecular basis of its tolerance and susceptibility is yet to be understood. To study the genetics of the peach in response to bacterial spot, an F2 population of ...

  18. Determinación del requerimiento de frío y de calor en duraznero [Prunus persica (L. Batsch.] mediante un modelo de correlación

    Directory of Open Access Journals (Sweden)

    CHAAR, J

    2012-11-01

    Full Text Available Los árboles frutales de hoja no persistente poseen un período de reposo entre los ciclos vegetativos. Para salir de reposo invernal, las yemas deben acumular primero frío (endodormancia y luego calor (ecodormancia.El objetivo de este trabajo fue determinar el requerimiento de frío y de calor en cinco cultivares de duraznero mediante un método de correlación, con datos de fecha de plena floración y temperatura del aire de siete años, en el este de Mendoza. El requerimiento de frío varió entre 914 y 1262 unidades de frío, mientras que el de calor fluctuó entre 2177 y 6490 horas grado de crecimiento. Excepto en cv. “Prima”, la variabilidad entre años del requerimiento de frío (coeficiente de variación, CV: 18,3 a 18,9% fue mayor que la correspondiente al requerimiento de calor, (CV: 6,9 a 13,9%. Los requerimientos de calor disminuyeron en años de mayor acumulación de frío e indicaron una compensación. El modelo utilizado, permite disponer de información más precisa sobre los requerimientos térmicos de los cultivares, y así poder realizar una zonificación que racionaliceel cultivo y maximice su aprovechamiento, en las áreas agroclimáticamente adecuadas.

  19. Inactivation of contaminated fungi and antioxidant effects of peach (Prunus persica L. Batsch cv Dangeumdo) by 0.5-2 kGy gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kyoung-Hee; Kim, Mi-Seon [Department of Food and Nutrition, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Kim, Hong-Gi [Department of Applied Biology, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Yook, Hong-Sun, E-mail: yhsuny@naver.co [Department of Food and Nutrition, Chungnam National University, Daejeon 305-764 (Korea, Republic of)

    2010-04-15

    The effect of gamma irradiation (0.5-2 kGy) on the physicochemical properties of peaches was investigated during a 6-day storage at 20+-3 deg. C. Gamma irradiation is able to inactivate the four pathogens, namely Botrytis cinerea, Penicillium expansum, Rhizopus stolonifer var. stolonifer and Monilinia fructicola in peaches. Hardness significantly decreased with the increment of irradiation dose level whereas soluble solid and total polyphenol contents increased with increment of irradiation dose level. 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical-scavenging activity of the irradiated peach was higher than that of control, and its activity increased with increment of irradiation dose level. These results suggest that gamma irradiation of peaches improved antioxidant activity, but dramatically affects the hardness throughout the entire storage time.

  20. Inactivation of contaminated fungi and antioxidant effects of peach ( Prunus persica L. Batsch cv Dangeumdo) by 0.5-2 kGy gamma irradiation

    Science.gov (United States)

    Kim, Kyoung-Hee; Kim, Mi-Seon; Kim, Hong-Gi; Yook, Hong-Sun

    2010-04-01

    The effect of gamma irradiation (0.5-2 kGy) on the physicochemical properties of peaches was investigated during a 6-day storage at 20±3 °C. Gamma irradiation is able to inactivate the four pathogens, namely Botrytis cinerea, Penicillium expansum, Rhizopus stolonifer var. stolonifer and Monilinia fructicola in peaches. Hardness significantly decreased with the increment of irradiation dose level whereas soluble solid and total polyphenol contents increased with increment of irradiation dose level. 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical-scavenging activity of the irradiated peach was higher than that of control, and its activity increased with increment of irradiation dose level. These results suggest that gamma irradiation of peaches improved antioxidant activity, but dramatically affects the hardness throughout the entire storage time.

  1. Expressional regulation of PpDAM5 and PpDAM6, peach (Prunus persica) dormancy-associated MADS-box genes, by low temperature and dormancy-breaking reagent treatment

    OpenAIRE

    Yamane, Hisayo; Ooka, Tomomi; Jotatsu, Hiroaki; Hosaka, Yukari; Sasaki, Ryuta; Tao, Ryutaro

    2011-01-01

    The present study investigated the expressional regulation of PpDAM5 and PpDAM6, two of the six peach (Prunus persica) dormancy-associated MADS-box genes, in relation to lateral bud endodormancy. PpDAM5 and PpDAM6 were originally identified as homologues of Arabidopsis SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 identified in the EVERGROWING locus of peach. Furthermore, PpDAM5 and PpDAM6 have recently been suggested to be involved in terminal bud dormancy. In this study, seasonal expression analys...

  2. Fibra dietaria de durazno (Prunus persica L.): influencia de la técnica de obtención en las propiedades químicas, físicas y funcionales

    OpenAIRE

    Nieto Calvache, Jhon Edinson

    2013-01-01

    Se estudió la optimización de las condiciones de proceso en relación a la obtención de fracciones enriquecidas en fibra dietaria a partir de residuos de duraznos (Prunus persica L.). Se evaluó la influencia de la relación etanol/muestra durante la extracción de la fibra y de la temperatura de secado con microondas, sobre las propiedades funcionales evaluadas: capacidad de atrapamiento de agua, de retención de agua, de hinchamiento, porcentaje de retención de agua, capacidad de absorción de ac...

  3. Variation in minerals, phenolics and antioxidant activity of peel and pulp of different varieties of peach (Prunus persica L.) fruit from Pakistan.

    Science.gov (United States)

    Manzoor, Maleeha; Anwar, Farooq; Mahmood, Zahed; Rashid, Umer; Ashraf, Muhammad

    2012-05-30

    Peach (Prunus persica L.), being a potential source of bioactive compounds, has been demonstrated to have medicinal benefits. In this study variation of minerals and antioxidant characteristics (total phenolic contents, total flavonoid contents, reducing power, inhibition of peroxidation using linoleic acid system and DPPH free radical scavenging activity) between peel and pulp parts of different peach varieties, namely Golden, Shireen, and Shahpasand were investigated. The peel and pulp extracts, derived from the varieties analyzed, exhibited an appreciable amount of total phenolics (TP) and total flavonoids (TF), ranging from 1,209.3-1,354.5, 711.7-881.3 mg GAE/100 g and 599.7-785.5, 301.3-499.7 mg CE/100 g on a dry weight basis, respectively. Reducing power of peel and pulp extracts (12.5 mg/mL concentration) ranged from 2.57-2.77 and 1.54-1.99.The inhibition of linoleic acid peroxidation and DPPH scavenging activity of the extracts varied from 70.8-80.9% and 66.8-76.5% in peels, and 51.9-60.1% and 43.4-49.1% in pulps. The mineral analysis revealed that the content of K was highest in both parts of the peach fruit followed by Mg, Ca, Fe, Mn and Zn. The results of our present study indicate that peach peel had significantly higher levels of minerals, antioxidant capacity and phenolics than those of the pulp, suggesting the intake of unpeeled peach as a potential source of high-value components. The peach peel can be a useful as a viable source of natural antioxidants for functional foods and nutraceutical applications.

  4. Variation in Minerals, Phenolics and Antioxidant Activity of Peel and Pulp of Different Varieties of Peach (Prunus persica L. Fruit from Pakistan

    Directory of Open Access Journals (Sweden)

    Muhammad Ashraf

    2012-05-01

    Full Text Available Peach (Prunus persica L., being a potential source of bioactive compounds, has been demonstrated to have medicinal benefits. In this study variation of minerals and antioxidant characteristics (total phenolic contents, total flavonoid contents, reducing power, inhibition of peroxidation using linoleic acid system and DPPH free radical scavenging activity between peel and pulp parts of different peach varieties, namely Golden, Shireen, and Shahpasand were investigated. The peel and pulp extracts, derived from the varieties analyzed, exhibited an appreciable amount of total phenolics (TP and total flavonoids (TF, ranging from 1,209.3–1,354.5, 711.7–881.3 mg GAE/100 g and 599.7–785.5, 301.3–499.7 mg CE/100 g on a dry weight basis, respectively. Reducing power of peel and pulp extracts (12.5 mg/mL concentration ranged from 2.57–2.77 and 1.54–1.99.The inhibition of linoleic acid peroxidation and DPPH scavenging activity of the extracts varied from 70.8–80.9% and 66.8–76.5% in peels, and 51.9–60.1% and 43.4–49.1% in pulps. The mineral analysis revealed that the content of K was highest in both parts of the peach fruit followed by Mg, Ca, Fe, Mn and Zn. The results of our present study indicate that peach peel had significantly higher levels of minerals, antioxidant capacity and phenolics than those of the pulp, suggesting the intake of unpeeled peach as a potential source of high-value components. The peach peel can be a useful as a viable source of natural antioxidants for functional foods and nutraceutical applications.

  5. Differential responses of peach (Prunus persica) seedlings to elevated ozone are related with leaf mass per area, antioxidant enzymes activity rather than stomatal conductance.

    Science.gov (United States)

    Dai, Lulu; Li, Pin; Shang, Bo; Liu, Shuo; Yang, Aizhen; Wang, Younian; Feng, Zhaozhong

    2017-08-01

    To evaluate the ozone (O3) sensitivity among peach tree (Prunus persica) cultivars widely planted in Beijing region and explore the possible eco-physiological response mechanisms, thirteen cultivars of peach seedlings were exposed to either charcoal-filtered air or elevated O3 (E-O3, non-filtered ambient air plus 60 ppb) for one growing season in open-top chambers. Leaf structure, stomatal structure, gas exchange and chlorophyll a fluorescence, photosynthetic pigments, antioxidant defense system and lipid peroxidation were measured in three replicated chambers. Results showed that E-O3 significantly reduced abaxial epidemis thickness, but no effects on the thicknesses of adaxial epidemis, palisade parenchyma and spongy parenchyma. Stomatal area, density and conductance were not significantly affected by E-O3. E-O3 significantly accelerated leaf senescence, as indicated by increased lipid peroxidation and more declines in light-saturated photosynthetic rate and pigments contents. The reduced ascorbate content (ASC) was decreased but antioxidant enzyme activity (CAT, APX and SOD) and total antioxidant capacity (TAC) were significantly increased by E-O3 among cultivars. The cultivars with visible symptoms also had more reductions in net photosynthetic rate than those without visible symptoms. Ozone sensitivity among cultivars was strongly linked to leaf mass per area (LMA), antioxidant enzymes activity e.g. SOD, APX rather than stomatal parameters (stomatal area, density and conductance) and ASC. Results could provide a theoretical basis for selecting and breeding the ozone-resistant cultivars of peach trees grown in high O3-polluted regions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Dormancy in Peach (Prunus persica L.) Flower Buds : I. Floral Morphogenesis and Endogenous Gibberellins at the End of the Dormancy Period.

    Science.gov (United States)

    Luna, V; Lorenzo, E; Reinoso, H; Tordable, M C; Abdala, G; Pharis, R P; Bottini, R

    1990-05-01

    Flower buds of peach (Prunus persica L.) trees, cv Novedad de Cordoba (Argentina), were collected near the end of the dormant period and immediately before anthesis. After removal of scale leaves, morphological observations of representative buds, made on transverse and longitudinal microtome sections, showed that all verticils making up the flower are present in an undifferentiated form during the dormant period (June). Flower buds collected at the end of dormant period (August) showed additional growth and differentiation, at which time formation of two ovules was beginning in the unicarpelar gynoecium. Dehiscence of anthers had not yet occurred 10 days before full bloom, and the ovules were still developing. Free endogenous gibberellin (GA)-like substances were quantified by bioassay (Tan-ginbozu dwarf rice microdrop) after SiO(2) partition column chromatography, reversed phase C18-high performance liquid chromatography, and finally Nucleosil [N(CH(3))(2)]high performance liquid chromatography. Bioactive fractions were then subjected to capillary gas chromatography-mass spectrometry-selected ion monitoring (GC-MS-SIM). Gibberellins A(1), A(3), and A(8) were tentatively identified in peach flower buds using GC-SIM and Kovat's retention indices, and relative amounts approximated by GC-SIM (2:8:6 for GA(1), GA(3), and GA(8), respectively). The highest concentration (330 nanograms per gram dry weight) of free GA(1)/GA(3) was found in dormant buds (June) and diminished thereafter. The concentration free of GA(1)/GA(3) did not increase immediately prior to bud break. However, high GA(1)/GA(3) concentrations occurred during stages where rate of growth and cellular differentiation of (mainly fertile) verticils can be influenced.

  7. Elaboración de néctar de durazno (Prunus persica L., endulzado con sucralosa como aprovechamiento de pérdidas poscosecha

    Directory of Open Access Journals (Sweden)

    Darío Alberto Pinto Medina

    2015-12-01

    Full Text Available En el durazno (Prunus persica L, así como en la mayoría de los frutos climatéricos, la calidad y el tiempo de vida útil comercial son afectados por los inadecuados manejos durante la cosecha, transporte y empaque, evidenciados por una serie de daños y defectos que el consumidor rechaza a la hora de adquirir el producto en fresco y que representan cuantiosas pérdidas al final del proceso de mercadeo, esta investigación se basó principalmente en el aprovechamiento de las pérdidas en durazno en el eslabón de la poscosecha, agroindustrializando la materia prima; se realizaron pruebas sensoriales para determinar la variedad más aceptada de tres probadas: Rubidoux, Dorado y Rubidoux-Dorado, no se evidenciaron diferencias significativas entre las muestras. Para darle valor agregado al producto, se fabricó néctar de la variedad Rubidoux endulzado con sucralosa, se realizaron análisis fisicoquímicos, microbiológicos y bromatológicos siguiendo la normatividad vigente. Se encontró que la sucralosa contribuyó a disminuir considerablemente el aporte calórico en el néctar elaborado, pasando de 48 Kcal/100g a 38,69 Kcal/100g. Se concluye que el costo de producción unitario para envase de 350ml ($ 1.054 resulta favorable, puesto que la rentabilidad puede superar el 40%, para un precio de venta de $1.476, generando un producto competitivo en el mercado, dada la calidad y el valor agregado como alimento funcional

  8. Isolation and characterization of a TERMINAL FLOWER 1 homolog from Prunus serotina Ehrh.

    Science.gov (United States)

    Wang, Ying; Pijut, Paula M

    2013-08-01

    Flowering control is one of the several strategies for gene containment of transgenic plants. TERMINAL FLOWER 1 (TFL1) is known to be involved in the transcriptional repression of genes for inflorescence development. Two TFL1 transcripts with different 3' UTR were cloned from black cherry (Prunus serotina Ehrh.) using reverse transcription-polymerase chain reaction (RT-PCR) and rapid amplification of cDNA ends (RACE). Corresponding to the two TFL1 transcripts, two PsTFL1 gene sequences, 1248 bp and 1579 bp, were obtained and both contained the same 519 bp coding region which encoded a putative protein of 172 amino acid residues. The phylogenetic analysis of the amino acid sequences showed high identity of PsTFL1 to TFL1 orthologs of other Prunus species, including Yoshino cherry (Prunus × yedoensis Matsum.), peach (Prunus persica (L.) Batsch), apricot (Prunus armeniaca L.) and Japanese apricot (Prunus mume Sieb. et Zucc.). The real-time quantitative PCR detected a single copy of PsTFL1 gene sequences in the black cherry genome with two alleles. The gene expression of PsTFL1 was examined in several tissues including the stems, leaves, shoot tips, and vegetative and floral buds. The highest mRNA level was detected in shoot tips, and the lowest level in the leaves. Transgenic Arabidopsis thaliana (L.) Heynh. plants overexpressing PsTFL1 showed significantly delayed flowering. These plants also showed largely increased vegetative growth, plant height, number of nodes, trichome density, and the conversion of flower to shoot was observed at each node and shoot apex.

  9. Identification of Known and Novel microRNAs and Their Targets in Peach (Prunus persica) Fruit by High-Throughput Sequencing.

    Science.gov (United States)

    Zhang, Chunhua; Zhang, Binbin; Ma, Ruijuan; Yu, Mingliang; Guo, Shaolei; Guo, Lei; Korir, Nicholas Kibet

    2016-01-01

    MicroRNAs (miRNAs) are a group of non-coding RNAs that have functions in post-transcriptional gene regulation in plants. Although the most important economic component of peach trees (Prunus persica) is the fruit, not much is known about miRNAs in this organ. In this study, miRNAs and their targets were identified and characterized from libraries of small RNAs of peach fruit through Solexa based-sequencing and bioinformatics approaches. A total of 557 known peach miRNAs belonging to 34 miRNA families were identified, and some of these miRNAs were found to be highly conserved in at least four other plant species. Using the most current criteria for miRNA annotation, 275 putative novel miRNAs were predicted, and the sequencing frequencies of these novel miRNAs were less than those of the conserved miRNAs. In total, 3959 and 1614 target genes for 349 known and 193 novel miRNAs, respectively, were predicted with the criteria that a single target gene can be targeted by different miRNAs and that a single miRNA can also have a large number of target genes. Three targets were even found to be targeted by 13 novel miRNAs that contained the same complete miRNA sequence at different locations and had different scaffolds. The proteins predicted to be targeted by the miRNAs identified in this study encompass a wide range of transcription factors and are involved in many biological processes and pathways, including development, metabolism, stress responses and signal transduction. A total of 115 and 101 target genes were identified to be cleaved by 60 known miRNAs and 27 novel miRNAs through degradome sequencing, respectively. These miRNAs induce cleavage of their targets precisely at the position between nucleotides 10 and 11 of the miRNA sequences from the 5' to the 3' end. Thirty conserved miRNAs and 19 novel miRNAs exhibited differential expression profiles in the peach, and the expression patterns of some miRNAs appeared to be tissue- or developmental stage-specific. The

  10. Genome-wide identification of miRNAs responsive to drought in peach (Prunus persica) by high-throughput deep sequencing.

    Science.gov (United States)

    Eldem, Vahap; Çelikkol Akçay, Ufuk; Ozhuner, Esma; Bakır, Yakup; Uranbey, Serkan; Unver, Turgay

    2012-01-01

    Peach (Prunus persica L.) is one of the most important worldwide fresh fruits. Since fruit growth largely depends on adequate water supply, drought stress is considered as the most important abiotic stress limiting fleshy fruit production and quality in peach. Plant responses to drought stress are regulated both at transcriptional and post-transcriptional level. As post-transcriptional gene regulators, miRNAs (miRNAs) are small (19-25 nucleotides in length), endogenous, non-coding RNAs. Recent studies indicate that miRNAs are involved in plant responses to drought. Therefore, Illumina deep sequencing technology was used for genome-wide identification of miRNAs and their expression profile in response to drought in peach. In this study, four sRNA libraries were constructed from leaf control (LC), leaf stress (LS), root control (RC) and root stress (RS) samples. We identified a total of 531, 471, 535 and 487 known mature miRNAs in LC, LS, RC and RS libraries, respectively. The expression level of 262 (104 up-regulated, 158 down-regulated) of the 453 miRNAs changed significantly in leaf tissue, whereas 368 (221 up-regulated, 147 down-regulated) of the 465 miRNAs had expression levels that changed significantly in root tissue upon drought stress. Additionally, a total of 197, 221, 238 and 265 novel miRNA precursor candidates were identified from LC, LS, RC and RS libraries, respectively. Target transcripts (137 for LC, 133 for LS, 148 for RC and 153 for RS) generated significant Gene Ontology (GO) terms related to DNA binding and catalytic activities. Genome-wide miRNA expression analysis of peach by deep sequencing approach helped to expand our understanding of miRNA function in response to drought stress in peach and Rosaceae. A set of differentially expressed miRNAs could pave the way for developing new strategies to alleviate the adverse effects of drought stress on plant growth and development.

  11. Genome-wide identification of miRNAs responsive to drought in peach (Prunus persica by high-throughput deep sequencing.

    Directory of Open Access Journals (Sweden)

    Vahap Eldem

    Full Text Available Peach (Prunus persica L. is one of the most important worldwide fresh fruits. Since fruit growth largely depends on adequate water supply, drought stress is considered as the most important abiotic stress limiting fleshy fruit production and quality in peach. Plant responses to drought stress are regulated both at transcriptional and post-transcriptional level. As post-transcriptional gene regulators, miRNAs (miRNAs are small (19-25 nucleotides in length, endogenous, non-coding RNAs. Recent studies indicate that miRNAs are involved in plant responses to drought. Therefore, Illumina deep sequencing technology was used for genome-wide identification of miRNAs and their expression profile in response to drought in peach. In this study, four sRNA libraries were constructed from leaf control (LC, leaf stress (LS, root control (RC and root stress (RS samples. We identified a total of 531, 471, 535 and 487 known mature miRNAs in LC, LS, RC and RS libraries, respectively. The expression level of 262 (104 up-regulated, 158 down-regulated of the 453 miRNAs changed significantly in leaf tissue, whereas 368 (221 up-regulated, 147 down-regulated of the 465 miRNAs had expression levels that changed significantly in root tissue upon drought stress. Additionally, a total of 197, 221, 238 and 265 novel miRNA precursor candidates were identified from LC, LS, RC and RS libraries, respectively. Target transcripts (137 for LC, 133 for LS, 148 for RC and 153 for RS generated significant Gene Ontology (GO terms related to DNA binding and catalytic activities. Genome-wide miRNA expression analysis of peach by deep sequencing approach helped to expand our understanding of miRNA function in response to drought stress in peach and Rosaceae. A set of differentially expressed miRNAs could pave the way for developing new strategies to alleviate the adverse effects of drought stress on plant growth and development.

  12. Identification of Known and Novel microRNAs and Their Targets in Peach (Prunus persica) Fruit by High-Throughput Sequencing

    Science.gov (United States)

    2016-01-01

    MicroRNAs (miRNAs) are a group of non-coding RNAs that have functions in post-transcriptional gene regulation in plants. Although the most important economic component of peach trees (Prunus persica) is the fruit, not much is known about miRNAs in this organ. In this study, miRNAs and their targets were identified and characterized from libraries of small RNAs of peach fruit through Solexa based-sequencing and bioinformatics approaches. A total of 557 known peach miRNAs belonging to 34 miRNA families were identified, and some of these miRNAs were found to be highly conserved in at least four other plant species. Using the most current criteria for miRNA annotation, 275 putative novel miRNAs were predicted, and the sequencing frequencies of these novel miRNAs were less than those of the conserved miRNAs. In total, 3959 and 1614 target genes for 349 known and 193 novel miRNAs, respectively, were predicted with the criteria that a single target gene can be targeted by different miRNAs and that a single miRNA can also have a large number of target genes. Three targets were even found to be targeted by 13 novel miRNAs that contained the same complete miRNA sequence at different locations and had different scaffolds. The proteins predicted to be targeted by the miRNAs identified in this study encompass a wide range of transcription factors and are involved in many biological processes and pathways, including development, metabolism, stress responses and signal transduction. A total of 115 and 101 target genes were identified to be cleaved by 60 known miRNAs and 27 novel miRNAs through degradome sequencing, respectively. These miRNAs induce cleavage of their targets precisely at the position between nucleotides 10 and 11 of the miRNA sequences from the 5’ to the 3’ end. Thirty conserved miRNAs and 19 novel miRNAs exhibited differential expression profiles in the peach, and the expression patterns of some miRNAs appeared to be tissue- or developmental stage

  13. Dinâmica populacional e incidência de moscas-das-frutas e parasitoides em cultivares de pessegueiros (Prunus Persica L. Batsch no município de presidente prudente-sp Population dynamic and occurrence of fruit flies and their parasitoids in peach cultivars (Prunus persica L. Batsch in presidente prudente municipality, sp

    Directory of Open Access Journals (Sweden)

    Sônia Maria Nalesso Marangoni Montes

    2011-06-01

    Full Text Available Esta pesquisa teve como objetivos avaliar a dinâmica populacional e registrar a diversidade de moscas-das-frutas (Diptera: Tephritoidea em cultivares de pessegueiro Tropical, Talismã, Aurora 2, Aurora 1, Dourado 2 e Doçura 2, enxertadas sobre os porta-enxertos 'Okinawa' e Umê, em Presidente Prudente-SP. Foram realizadas as correlações da dinâmica populacional com a temperatura e a precipitação, e também a infestação com as características químicas dos frutos, Sólidos Solúveis e Acidez Titulável. No período de julho de 2004 a dezembro de 2006, a dinâmica populacional de moscas-das-frutas foi obtida através de coletas semanais de moscas-das-frutas em armadilhas McPhail, e a incidência foi determinada através da coleta de 30 frutos/planta/cultivar. O delineamento estatístico adotado foi o inteiramente casualizado, com cinco repetições. Ceratitis capitata foi predominante nas cultivares de pessegueiros estudadas. Não foi observada correlação significativa entre população de moscas-das-frutas e as variáveis de temperatura e precipitação, e sólidos solúveis e ácidez titulável. Entre as cultivares de pêssego, Aurora 2 apresentou maior infestação por C. capitata, da ordem de 22 e 23% nos anos 2004 e 2006, respectivamente. Também foi registrada a incidência de Neosilba spp. em frutos de pêssego. Doryctobracon areolatus (Braconidae, Tetrastichus giffardianus (Eulophidae e Pachycrepoideus vindemmiae (Pteromalidae foram recuperados de pupários de Tephritidae.The objectives of this research were evaluate the population dynamic and diversity of fruit flies (Diptera: Tephritoidea on peach cultivars Tropical, Talisma, Aurora 2, Aurora 1, Dourado 2 and Doçura 2, under the rootstocks 'Okinawa' and Umê, in Presidente Prudente, São Paulo, Brazil. The dynamic population of fruit flies was correlated with temperature and precipitation. The fruit fly infestation was correlated with chemical characteristics of fruits. During July 2004 to December 2006, the fruit fly population was monitored weekly using McPhail traps. The natural infestation was estimated from 30 fruits of each cultivar collected per year. The experiment was conducted under randomized design with five replications. Ceratitis capitata was dominant on peach cultivars for the both rootstocks. No significant correlations were detected between the fruit fly densities and the temperature and precipitation, and the variables soluble solids and titratable acidity. Among peach cultivars, Aurora 2 presented the highest infestation by C. capitata, reaching 22% and 23%, in 2004 and 2006, respectively. Neosilba spp. (Lonchaeidae was also recovered from peaches. Doryctobracon areolatus (Braconidae, Tetrastichus giffardianus (Eulophidae and Pachycrepoideus vindemmiae (Pteromalidae were recovered from Tephritidae pulparium.

  14. Controle da infestação natural de ceratitis capitata (Wied., 1824 (Diptera, Tephritidae em pêssegos(Prunus persica através das radiações gama Control of naturally infested peaches (Prunus persica by mediterranean fruit fly (Ceratitis capitata through the use of gamma radiation

    Directory of Open Access Journals (Sweden)

    V. Arthur

    1993-12-01

    Full Text Available Determinou-se a dose desinfestante de radiações gama para pêssegos, Prunus persica, infestados com larvas da mosca do Mediterrâneo, Ceratitis capitata. Utilizaram-se frutas de procedência conhecida no campo fazendo-se uma amostragem prévia, constatando-se que cada fruta continha em média nove larvas do último ínstar da mosca praga. As frutas foram irradiadas em uma fonte de Cobalto-60 com as seguintes doses de radiação gama: 0 (test., 25, 50, 100, 200, 400, 600, 800, 1000 e 1200 Gy, sob uma taxa de 58 Gy por minuto. Após a irradiação as frutas foram colocadas em câmaras climatizadas com a temperatura variando entre 23 e 27°C e a umidade relativa variando entre 65 e 75%. Aguardou-se que as larvas deixassem as frutas e se transformassem em pupas e adultos. A dose letal para larvas, pelos resultados obtidos no experimento, concluiu-se ser de 600 Gy. A dose letal para pupas provenientes de larvas irradiadas dentro das frutas foi de 50 Gy, impedindo totalmente a emergência de adultos.Determination of the dose of gamma radiation to disinfest peaches, Prunus pérsica infested with larvae of Ceratitis capitata (Wied., 1824 was made. Fruits were collected in the field, each one holding about nine larvae of the last instar of the fruit-fly. The fruits were irradiated with Cobalt-60 gamma radiation source at the following doses: 0 (control, 25, 50, 100, 200, 400, 600, 800, 1000 and 1200 Gy; at a dose rate of 58 Gy per minute. After irradiation the fruits were kept in a climatic chamber with the temperature adjusted between 23 and 27°C, and relative humidity between 65 and 75 percent, until the larvae left the fruits and were transformed into pupae and adults. It was concluded that the lethal dose of gamma radiation for larvae at the last instar, in naturally infested peaches, was 600 Gy and the dose of 50 Gy inhibited completely the emergency of adults.

  15. Lesser peachtree borer (Lepidoptera: Sesiidae) oviposition on Prunus germplasm.

    Science.gov (United States)

    Cottrell, T E; Beckman, T G; Horton, D L

    2011-12-01

    The lesser peachtree borer, Synanthedon pictipes (Grote and Robinson) (Lepidoptera: Sesiidae), is a serious pest of peach, Prunus persica (L.) Batsch, across the southeastern United States. We examined oviposition by S. pictipes on field-grown Prunus scion and rootstock cultivars and two endemic Prunus spp. when sawn limbs, not roots, were assayed in the laboratory. A choice test compared oviposition on the peach scion 'Harvester', peach rootstock 'Guardian', plum×peach hybrid rootstock 'MP-29', and the plum hybrid rootstock 'Sharpe'. A significantly lower percentage of eggs occurred on limbs of Sharpe rootstock than other choices. A choice test using two endemic hosts, black cherry (P. serotina Ehrh.) and Chickasaw plum (P. angustifolia Marsh.), along with Sharpe rootstock, found a lower percentage of eggs on limbs of Sharpe than either endemic host. However, when only limbs of Sharpe and a decoy were used, almost all eggs were laid on Sharpe. Interestingly, when Harvester and Sharpe limbs were paired side by side, a higher percentage of eggs were recovered from the Harvester limb than from the Sharpe limb. An analysis of volatiles from Sharpe may identify why fewer eggs were laid on it. Because S. pictipes attacks host trees above ground and Sharpe rootstock on grafted trees grows below ground, this rootstock might be a management option against the congeneric, root-attacking peachtree borer, S. exitiosa (Say). Our results suggest that high budding a peach scion onto Sharpe rootstock, thus allowing the rootstock to serve as the trunk, warrants further investigation against S. exitiosa under orchard conditions.

  16. A simple model to predict the probability of a peach (Prunus persicae tree bud to develop as a long or short shoot as a consequence of winter pruning intensity and previous year growth.

    Directory of Open Access Journals (Sweden)

    Daniele Bevacqua

    Full Text Available In many woody plants, shoots emerging from buds can develop as short or long shoots. The probability of a bud to develop as a long or short shoot relies upon genetic, environmental and management factors and controlling it is an important issue in commercial orchard. We use peach (Prunus persicae trees, subjected to different winter pruning levels and monitored for two years, to develop and calibrate a model linking the probability of a bud to develop as a long shoot to winter pruning intensity and previous year vegetative growth. Eventually we show how our model can be used to adjust pruning intensity to obtain a desired proportion of long and short shoots.

  17. Caracterização de três genótipos de umezeiro (Prunus mume Sieb. et Zucc. por marcadores RAPD Characterization of three mume genotypes (Prunus mume Sieb. et Zucc. by RAPD markers

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2008-12-01

    Full Text Available Um projeto de pesquisa visando à utilização de clones de umezeiro (Prunus mume Sieb. et Zucc. como porta-enxertos para pessegueiro [Prunus persica (L. Batsch] está sendo conduzido na FCAV/UNESP, Câmpus de Jaboticabal-SP, com promissoras perspectivas de sucesso. Três genótipos de umezeiro foram selecionados de acordo com características agronômicas desejáveis para esta finalidade. A distinção dos três genótipos entre si, baseada exclusivamente em características morfológicas, apresenta limitações. Dessa forma, o objetivo do presente trabalho foi identificar marcadores RAPD capazes de diferenciar e caracterizar os Clones 05, 15 e a cv. Rigitano (Clone 10 de umezeiro, utilizando-se das cultivares Aurora-1 e Okinawa de pessegueiro como outgroup. Dos 220 primers testados, foram selecionados 42, que amplificaram todos os cinco genótipos. Verificou-se que os marcadores RAPD permitiram a distinção entre o Clone 05, o Clone 15 e a cv. Rigitano de umezeiro, demonstrando a existência de variabilidade genética entre os mesmos. Dentre os três genótipos de umezeiro estudados, constatou-se que a similaridade genética é maior entre o Clone 05 e o Clone 15.A research project with the objective do develop mume clones (Prunus mume Sieb. et Zucc., to be used as rootstocks for peach tree [Prunus persica (L. Batsch] is been carried out at the Faculdade de Ciências Agrárias e Veterinárias (FCAV/UNESP, Jaboticabal Campus, São Paulo State, Brazil. These project showed promising perspectives of success, with three clones that were selected according to their characteristics for peach rootstock. But the distinction of the three clones among them, based only in morphologic characteristics, has presented limitations. The objective of the present research was to identify RAPD markers able to characterize and differentiate the 05 and 15 Clones and Rigitano mume cultivar, using Aurora-1 and Okinawa peach tree as outgroup. Among the 220 tested

  18. Prunus domestica, Prunus persica and Prunus avium extracts ...

    African Journals Online (AJOL)

    water emulsions. DPPH (2, 2-diphenyl-1-picrylhydrazyl) ... Test formulations containing fruit extracts (6%) showed good stability compared to control formulations and pH and conductivity were found as desired. Formulations were studied for patch ...

  19. Characterization of polymorphic SSRs among Prunus chloroplast genomes

    Science.gov (United States)

    An in silico mining process yielded 80, 75, and 78 microsatellites in the chloroplast genome of Prunus persica, P. kansuensis, and P. mume. A and T repeats were predominant in the three genomes, accounting for 67.8% on average and most of them were successful in primer design. For the 80 P. persica ...

  20. Lesser peachtree borer (Lepidoptera: Sesiidae) oviposition on Prunus germplasm

    Science.gov (United States)

    Synanthedon pictipes (Grote and Robinson) (Lepidoptera: Sesiidae) was used as an oviposition surrogate for the congeneric S. exitiosa (Say) to examine possible preference for Prunus germplasm. We assayed limbs of a peach cultivar (Prunus persica), peach rootstocks, plum-peach hybrid rootstocks, the...

  1. Expressional regulation of PpDAM5 and PpDAM6, peach (Prunus persica) dormancy-associated MADS-box genes, by low temperature and dormancy-breaking reagent treatment.

    Science.gov (United States)

    Yamane, Hisayo; Ooka, Tomomi; Jotatsu, Hiroaki; Hosaka, Yukari; Sasaki, Ryuta; Tao, Ryutaro

    2011-06-01

    The present study investigated the expressional regulation of PpDAM5 and PpDAM6, two of the six peach (Prunus persica) dormancy-associated MADS-box genes, in relation to lateral bud endodormancy. PpDAM5 and PpDAM6 were originally identified as homologues of Arabidopsis SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 identified in the EVERGROWING locus of peach. Furthermore, PpDAM5 and PpDAM6 have recently been suggested to be involved in terminal bud dormancy. In this study, seasonal expression analyses using leaves, stems, and lateral buds of high-chill and low-chill peaches in field conditions indicated that both genes were up-regulated during the endodormancy period and down-regulated with endodormancy release. Controlled environment experiments showed that the expression of both PpDAM5 and PpDAM6 were up-regulated by ambient cool temperatures in autumn, while they were down-regulated by the prolonged period of cold temperatures in winter. A negative correlation between expression levels of PpDAM5 and PpDAM6 and bud burst percentage was found in the prolonged cold temperature treatment. Application of the dormancy-breaking reagent cyanamide to endo/ecodormant lateral buds induced early bud break and down-regulation of PpDAM5 and PpDAM6 expression at the same time. These results collectively suggest that PpDAM5 and PpDAM6 may function in the chilling requirement of peach lateral buds through growth-inhibiting functions for bud break.

  2. Dinâmica populacional e incidência de moscas-das-frutas e parasitoides em cultivares de pessegueiros (Prunus Persica L. Batsch no município de presidente prudente-sp

    Directory of Open Access Journals (Sweden)

    Sônia Maria Nalesso Marangoni Montes

    2011-06-01

    Full Text Available Esta pesquisa teve como objetivos avaliar a dinâmica populacional e registrar a diversidade de moscas-das-frutas (Diptera: Tephritoidea em cultivares de pessegueiro Tropical, Talismã, Aurora 2, Aurora 1, Dourado 2 e Doçura 2, enxertadas sobre os porta-enxertos 'Okinawa' e Umê, em Presidente Prudente-SP. Foram realizadas as correlações da dinâmica populacional com a temperatura e a precipitação, e também a infestação com as características químicas dos frutos, Sólidos Solúveis e Acidez Titulável. No período de julho de 2004 a dezembro de 2006, a dinâmica populacional de moscas-das-frutas foi obtida através de coletas semanais de moscas-das-frutas em armadilhas McPhail, e a incidência foi determinada através da coleta de 30 frutos/planta/cultivar. O delineamento estatístico adotado foi o inteiramente casualizado, com cinco repetições. Ceratitis capitata foi predominante nas cultivares de pessegueiros estudadas. Não foi observada correlação significativa entre população de moscas-das-frutas e as variáveis de temperatura e precipitação, e sólidos solúveis e ácidez titulável. Entre as cultivares de pêssego, Aurora 2 apresentou maior infestação por C. capitata, da ordem de 22 e 23% nos anos 2004 e 2006, respectivamente. Também foi registrada a incidência de Neosilba spp. em frutos de pêssego. Doryctobracon areolatus (Braconidae, Tetrastichus giffardianus (Eulophidae e Pachycrepoideus vindemmiae (Pteromalidae foram recuperados de pupários de Tephritidae.

  3. Caracterización morfológica y molecular de aislamientos de Monilinia fructicola obtenidos de frutos de durazno [Prunus persica (L.) Batsch] en México y pruebas de agresividad sobre durazno, pera y manzana.

    OpenAIRE

    Robles Yerena, Leticia

    2010-01-01

    Existen tres especies de Monilinia reportadas como causantes de la pudrición café de los frutos de hueso: M. fructigena y M. laxa de origen Europeo y M. fructicola de origen Americano. En este trabajo 50 cultivos monospóricos de Monilinia spp. de frutos de durazno provenientes de los Estados de Aguascalientes, Chihuahua, Michoacán, Morelos y Zacatecas, México colectados durante el 2008-2009. La caracterización molecular se hizo mediante PCR e ITS y se confirmó a Monilinia fructicola con base ...

  4. DIAGNOSTICS OF VIRUS PHYTOPATHOGENS FRUIT TREE PLUM POX VIRUS, PRUNUS NECROTIC RINGSPOT VIRUS AND PRUNUS DWARF VIRUS BY BIOLOGICAL AND MOLECULAR DIAGNOSTICS

    Directory of Open Access Journals (Sweden)

    Július Rozák

    2013-02-01

    Full Text Available The aim of this study was to determine the incidence of viral phytopathogen Plum pox virus, Prunus necrotic ringspot virus and Prunus dwarf virus in selected localities of Slovakia and diagnose them using a molecular and biological methods. Forty samples of fruit trees of the genus Prunus, twenty samples from intensive plantings and twenty samples from wild subject were analysed. Biological diagnostic by using biological indicators Prunus persica cv. GF 305, Prunus serrulata cv. Schirofugen and molecular diagnostic by mRT-PCR were applied. Five samples with Plum pox virus were infected. The two samples positive for Prunus necrotic ringspot virus and one sample for Prunus dwarf virus were confirmed. The two samples were found to be infected with two viruses Prunus necrotic ringspot virus and Prunus dwarf virus. This work focuses on two techniques, their application to the diagnosis of stone fruit viruses and their routinely used for sanitary and certification programmes.

  5. Current-year and Subsequent-year Effects of Crop-load Manipulation and Epicormic-shoot Removal on Distribution of Long, Short and Epicormic Shoot Growth in Prunus persica

    Science.gov (United States)

    Gordon, D.; Dejong, T. M.

    2007-01-01

    Background and Aims The distribution of canopy growth among different shoot types such as epicormic, long and short shoots is not well understood in the peach tree. In this experiment, the effects of crop load and early epicormic sprout removal on current and subsequent-year distribution of vegetative growth among epicormic, long and short shoots was investigated in Prunus persica. Methods Field trials were conducted in Winters, California, in 2003–2004. Crop load was manipulated with fruit thinning in 2003 to produce trees that were de-fruited, commercially thinned or full crop, and half of the trees in each cropping treatment had all current year epicormic sprouts removed at the time of fruit thinning. Yield was recorded and trunk and root carbohydrates were sampled to confirm the effect of 2003 crop load differences on tissue carbohydrate concentration. All current-season vegetative-shoot extension growth was harvested from half of the trees in each treatment in the autumn of 2003 and from the other half in the autumn of 2004. Epicormic, long and short shoots were separately evaluated for dry weight, node number and leaf-stem parameters. Key Results In 2003, long-shoot dry weight and node number were significantly affected by crop load; however, short-shoot dry weight and node number were not significantly affected. The 2003 crop-load treatments did not affect 2004 vegetative growth of any shoot type. Some re-growth of epicormic shoots followed early epicormic sprout removal: by the end of the 2003 season, trees in the early shoot-removal treatment had approximately one-third of the epicormic-shoot dry weight as unpruned trees. Conclusions Fruit thinning promoted distribution of growth similar to that of de-fruited trees. While thinning was effective in increasing fruit size, it exacerbated the problem of epicormic sprouting. Early epicormic sprout removal did not stimulate the excessive epicormic re-growth in the same or subsequent year relative to previously

  6. Evaluation of salt tolerance in almond [Prunus dulcis (L.) Batsch ...

    African Journals Online (AJOL)

    user

    2012-07-12

    Jul 12, 2012 ... stone fruit trees and almond are sensitive to salt stresses and their productivity gradually reduces at salt concen- ... order to improve stone fruit and almond rootstocks through hybridization between peach × almond, apricot × ..... J. Forest Poplar Res. 11(1): p. 202. Ranjbar A, Lemeur R, Damme P (2005).

  7. Evaluation of salt tolerance in almond [ Prunus dulcis (L.) Batsch ...

    African Journals Online (AJOL)

    The majority of the plant's responses to the high salinity levels (6 and 9 dSm-1) were significant with no deleterious effects observed on plant growth triggered by lower salt concentrations of 1.5 and 3 dSm-1. A significant decrease in total chlorophyll and chlorophyll b content was also found at the high salinity levels but no ...

  8. Evaluation of salt tolerance in almond [Prunus dulcis (L.) Batsch ...

    African Journals Online (AJOL)

    user

    2012-07-12

    Jul 12, 2012 ... al., 2006; Jafarzadeh and Aliasgarzad, 2007). Woody plants are usually relatively salt-tolerant during the seed germination stage but much more sensitive during the young seedling stage and progressively more tolerant with increasing age through the reproductive stage (Najafian et al., 2008). Temperate ...

  9. Activities of sucrose and sorbitol metabolizing enzymes in vegetative sinks of peach and correlation with sink growth rate

    Science.gov (United States)

    Riccardo Lo Bianco; Mark Rieger; Shi-Jean S. Sung

    1999-01-01

    Terminal portions of 'Flordaguard' peach roots (Prunus persica ((L.) Batsch) were divided into six segments and the activities of NAD+-dependent sorbitol dehydrogenase (SDH), sorbitol oxidase (SOX), sucrose synthase (SS), soluble acid invertase (AI),...

  10. Caracterización de genes codificantes de glicosidasas de pared celular relacionadas al crecimiento y a la maduración de prunoideas

    OpenAIRE

    Di Santo, Mariana Carolina

    2011-01-01

    La arabinosa es el prinicipal azúcar neutro no celulósico de la pared celular de durazno (Prunus persica (L.) Batsch) y de ciruela japonesa (Prunus salicina Lindl), observándose una pérdida neta de arabinosa tanto durante la maduración y el ablandamiento como en etapas previas a dicho proceso. Las α-L-arabinofuranosidasas y α-L-arabinofuranosidasas/β-D-xilosidasas son enzimas responsables de estas modificaciones en la pared celular de Prunus persica (L.) Batsch y de Prunus salicina Lindl. Se...

  11. Role of Myzus persicae (Hemiptera: Aphididae) and its secondary hosts in plum pox virus propagation.

    Science.gov (United States)

    Manachini, B; Casati, P; Cinanni, L; Bianco, P

    2007-08-01

    Plum pox virus (family Potyviridae, genus Potyvirus, PPV) is one of the most important viral pathogens of plants in the genus Prunus, particularly Prunus persica L. The role of the Myzus persicae (Sulzer) (Hemiptera: Aphididae) as a vector of PPV-M, and its role in spreading PPV-M, was investigated. PPV-M-infected peach trees were used as inoculum sources, and transmission to 15 herbaceous species commonly present in and around peach orchards was evaluated. The presence of PPV-M in secondary hosts after aphid transmission was verified by reverse transcription-polymerase chain reaction tests. The results indicate that Saponaria ocymoides L., Pisum sativum L., Trifolium repens L., Trifolium pratense L., Lepidium sativum L., Matricaria chamomilla L., Centaurea cyanus L., Bellis perennis L., Papaver rhoeas L., and Zinnia elegans L. became infected. Although Lupinus polyphyllus Lindley, Taraxacum officinale L., Achillea millefolium L., Amaranthus retroflexus L., and Linum rubrum L. did not become infected, they are hosts of M. persicae. Among the 10 positive species that were infected, the species most common in peach orchards, T. pratense, T. repens, B. perennis, and M. chamomilla, were used as source plants for the transmission studies to the peach tree. Our study reveals the ability of M. persicae to transmit PPV-M from herbaceous hosts to peach trees, describes PPV-M symptoms in herbaceous species, and discusses the role of M. persicae and its hosts as a source of PPV-M in peach orchards.

  12. Prunus hybrids rootstocks for flat peach

    Directory of Open Access Journals (Sweden)

    Pilar Legua

    2012-02-01

    Full Text Available Peach (Prunus persica L. is the most important stone fruit tree grown in Spain and is the second most important fruit crop in Europe. The influence of eight Prunus rootstocks (GF-677, Krymsk® 86, PADAC 97-36, PADAC 99-05, PADAC 9912-03, PADAC 0024-01, PAC 0021-01 and PAC 0022-01 on vigor, yield and fruit quality traits of 'UFO 3' flat peach cultivar was studied. The highest trunk cross sectional area was exhibited by GF-677 and the lowest by PADAC 99-05, while intermediate values were found on the other rootstocks. The highest yield efficiency was found on PADAC 99-05, PAC 0021-01, PAC 0022-01 and PADAC 0024-01 and the lowest was shown on Krymsk® 86. The fruit quality parameters measured were color, fruit and stone weights, equatorial diameter, pulp thickness, pulp yield, firmness, pH, soluble solids content and titratable acidity. 'UFO 3' grafted on GF-677 resulted in the largest fruit weight, while the smallest was on PADAC 99-05. Fruits of 'UFO 3' showed a tendency to have higher firmness, higher red colored skin and RI when grafted on PADAC 99-05.

  13. A fruit quality gene map of Prunus

    Directory of Open Access Journals (Sweden)

    Bliss Fredrick A

    2009-12-01

    Full Text Available Abstract Background Prunus fruit development, growth, ripening, and senescence includes major biochemical and sensory changes in texture, color, and flavor. The genetic dissection of these complex processes has important applications in crop improvement, to facilitate maximizing and maintaining stone fruit quality from production and processing through to marketing and consumption. Here we present an integrated fruit quality gene map of Prunus containing 133 genes putatively involved in the determination of fruit texture, pigmentation, flavor, and chilling injury resistance. Results A genetic linkage map of 211 markers was constructed for an intraspecific peach (Prunus persica progeny population, Pop-DG, derived from a canning peach cultivar 'Dr. Davis' and a fresh market cultivar 'Georgia Belle'. The Pop-DG map covered 818 cM of the peach genome and included three morphological markers, 11 ripening candidate genes, 13 cold-responsive genes, 21 novel EST-SSRs from the ChillPeach database, 58 previously reported SSRs, 40 RAFs, 23 SRAPs, 14 IMAs, and 28 accessory markers from candidate gene amplification. The Pop-DG map was co-linear with the Prunus reference T × E map, with 39 SSR markers in common to align the maps. A further 158 markers were bin-mapped to the reference map: 59 ripening candidate genes, 50 cold-responsive genes, and 50 novel EST-SSRs from ChillPeach, with deduced locations in Pop-DG via comparative mapping. Several candidate genes and EST-SSRs co-located with previously reported major trait loci and quantitative trait loci for chilling injury symptoms in Pop-DG. Conclusion The candidate gene approach combined with bin-mapping and availability of a community-recognized reference genetic map provides an efficient means of locating genes of interest in a target genome. We highlight the co-localization of fruit quality candidate genes with previously reported fruit quality QTLs. The fruit quality gene map developed here is a

  14. A fruit quality gene map of Prunus

    Science.gov (United States)

    2009-01-01

    Background Prunus fruit development, growth, ripening, and senescence includes major biochemical and sensory changes in texture, color, and flavor. The genetic dissection of these complex processes has important applications in crop improvement, to facilitate maximizing and maintaining stone fruit quality from production and processing through to marketing and consumption. Here we present an integrated fruit quality gene map of Prunus containing 133 genes putatively involved in the determination of fruit texture, pigmentation, flavor, and chilling injury resistance. Results A genetic linkage map of 211 markers was constructed for an intraspecific peach (Prunus persica) progeny population, Pop-DG, derived from a canning peach cultivar 'Dr. Davis' and a fresh market cultivar 'Georgia Belle'. The Pop-DG map covered 818 cM of the peach genome and included three morphological markers, 11 ripening candidate genes, 13 cold-responsive genes, 21 novel EST-SSRs from the ChillPeach database, 58 previously reported SSRs, 40 RAFs, 23 SRAPs, 14 IMAs, and 28 accessory markers from candidate gene amplification. The Pop-DG map was co-linear with the Prunus reference T × E map, with 39 SSR markers in common to align the maps. A further 158 markers were bin-mapped to the reference map: 59 ripening candidate genes, 50 cold-responsive genes, and 50 novel EST-SSRs from ChillPeach, with deduced locations in Pop-DG via comparative mapping. Several candidate genes and EST-SSRs co-located with previously reported major trait loci and quantitative trait loci for chilling injury symptoms in Pop-DG. Conclusion The candidate gene approach combined with bin-mapping and availability of a community-recognized reference genetic map provides an efficient means of locating genes of interest in a target genome. We highlight the co-localization of fruit quality candidate genes with previously reported fruit quality QTLs. The fruit quality gene map developed here is a valuable tool for dissecting the

  15. Growth and Yield of Peaches on Rootstocks of Prunus tomentosa and Prunus persica

    OpenAIRE

    中野, 幹夫; 島村, 和夫

    1983-01-01

    モモ栽培の省力化を目的に台木及び仕立方を異にした低木・密植栽培を試みた. すなわち,ユスラウメ台を用いた主幹仕立,共台を用いた架線仕立と平行並列仕立である. ユスラウメ台樹の生育は品種及び個体により大きく変異したが,共台に比べ強くわい化した. 収穫期は早く,果実の品質も良かった. 収量はほぼ生育と一致し,品種及び個体により大きく変異したが,生育の良い場合には共台樹より多収であった. したがって,台木の系統選抜などにより健全で均一な生育が得られれば,有望な栽培様式となりえよう. 共台樹では平行並列仕立の方が架線仕立より収量,品質とも優れた. その原因は,平行並列仕立の方が目標樹冠面積が大きく,自由に生長させられたのに対し,架線仕立樹はそれが狭く,しかも,主枝を早くから低く誘引したため,樹勢が強すぎ,徒長的な側枝が多発し,過繁茂となったためであろう。...

  16. 'Candidatus Phytoplasmas pruni', a novel taxon associated with X-disease of stone fruits, Prunus spp.: multilocus characterization based on 16S rRNA, secY, and ribosomal protein genes

    Science.gov (United States)

    X-disease is one of the most serious diseases known in peach (Prunus persica). Based on RFLP analysis of 16S rRNA gene sequences, peach X-disease phytoplasma strains from eastern and western United States and eastern Canada were classified in 16S rDNA RFLP group 16SrIII, subgroup A. Phylogenetic a...

  17. Identification of the Population Structure of Myzus persicae (Hemiptera: Aphididae) on Peach Trees in China Using Microsatellites.

    Science.gov (United States)

    Li, Jie; Cao, Jinjun; Niu, Jianqun; Liu, Xiaoxia; Zhang, Qingwen

    2015-01-01

    In this study, we characterized the genetic structure of Myzus persicae (Sulzer) (Hemiptera: Aphididae) populations in China using microsatellites. We expected that these data will reveal the genetic relationships among various populations of M. persicae and will be of value in the development of better methods for pest control. Four hundred sixty individuals from 23 areas over 13 provinces were collected in the early spring of 2010, all from their primary host, Prunus persicae. The markers analyzed were highly polymorphic, as demonstrated by the expected heterozygosity value (He = 0.861) and the Polymorphism Information Content (PIC = 0.847), which indicated that M. persicae maintains a high level of genetic diversity. Analysis of molecular variance revealed an intermediate level of population differentiation among M. persicae populations (F(ST) = 0.1215). Geographic isolation existed among these populations, and, consequently, the genetic structure of the populations was split into a southern group and a northern group divided by the Yangtse River. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  18. Blossom thinning in apple and peach with an essential oil

    Science.gov (United States)

    A series of experiments were conducted with apple (Malus xdomestica) and peach [Prunus persica (L.) Batsch] from 2003-2008 to evaluate the flower thinning efficacy of eugenol and a eugenol-based essential oil. Flower thinning effects by hand defoliation and alternative chemical agents were compared...

  19. MP-29, a clonal interspecific hybrid rootstock for peach

    Science.gov (United States)

    MP-29 rootstock has been jointly released for grower trial by the U.S. Department of Agriculture, Agricultural Research Service (Byron, GA) and Florida Agricultural Experiment Station. MP-29 is suggested for trial as a rootstock for peach (Prunus persica L. Batsch) varieties on Armillaria root rot ...

  20. Where are we now as we merge genomics into plant breeding and what are our limitations? Experiences from RosBREED

    Science.gov (United States)

    The complete genomic sequences of apple (Malus × domestica Borkh), peach (Prunus persica (L.) Batsch), and diploid strawberry (Fragaria vesca L.) – one member of each of the three main fruit-producing branches of the Rosaceae family tree – were available in 2010. Despite this achievement, virtually ...

  1. Increasing chilling reduces heat requirement for floral budbreak in peach

    Science.gov (United States)

    Response to chilling temperatures is a critical factor in the suitability of peach [Prunus persica (L.) Batsch] cultivars to moderate climates such as in the southeastern United States. Time of bloom depends on the innate chilling requirement of the cultivar as well as the timing and quantity of co...

  2. Peach is an occasional host for Rhagoletis pomonella (Walsh, 1867) (Diptera: Tephritidae) larvae in Western Washington State, USA

    Science.gov (United States)

    Peach, Prunus persica (L.) Batsch (Rosaceae), has been reported to be a host of the apple maggot fly, Rhagoletis pomonella (Walsh), 1867 (Diptera: Tephritidae), an important quarantine pest of apple (Malus domestica Borkhausen) (Rosaceae) in the western U.S.A. However, all reports of peach as a hos...

  3. Progress in developing Armillaria resistant rootstocks for use with peach

    Science.gov (United States)

    GuardianTM (BY520-9) peach seedling rootstock was released in 1993 to provide a rootstock with superior resistance to peach tree short life (PTSL) which at the time was the number one cause of premature death of peach (Prunus persica L. [Batsch]) trees in the southeastern US. Since that time Guardi...

  4. Progress in the management of peach fungal gummosis (Botryosphaeria dothidea) in the Southeastern U.S. peach industry

    Science.gov (United States)

    Peach fungal gummosis, incited by Botryosphaeria dothidea (Moug.:Fr.) Ces. & De Not., has been shown to be capable of reducing growth and yield by up to 40% on susceptible peach [Prunus persica (L.) Batsch] cultivars. Initial field screens demonstrated that several important peach cultivars utilize...

  5. Integrated QTL detection for key breeding traits in multiple peach progenies

    NARCIS (Netherlands)

    Hernández Mora, José R.; Micheletti, Diego; Bink, Marco; Weg, Van de Eric; Cantín, Celia; Nazzicari, Nelson; Caprera, Andrea; Dettori, Maria Teresa; Micali, Sabrina; Banchi, Elisa; Campoy, José Antonio; Dirlewanger, Elisabeth; Lambert, Patrick; Pascal, Thierry; Troggio, Michela; Bassi, Daniele; Rossini, Laura; Verde, Ignazio; Quilot-Turion, Bénédicte; Laurens, François; Arús, Pere; Aranzana, Maria José

    2017-01-01

    Background: Peach (Prunus persica (L.) Batsch) is a major temperate fruit crop with an intense breeding activity. Breeding is facilitated by knowledge of the inheritance of the key traits that are often of a quantitative nature. QTLs have traditionally been studied using the phenotype of a single

  6. INFRARED CANOPY TEMPERATURE OF PEACH TREES UNDER DEFICIT IRRIGATION

    Science.gov (United States)

    An early-season peach, “Crimson Lady” (Prunus persica (L.) Batsch), is generally harvested in late May to early June in central California. To reduce water use, regulated deficit irrigation may be applied to these trees for the remaining and also most water demanding season (mid June to November). ...

  7. Grass competition may benefit high density peach orchards

    Science.gov (United States)

    Previous research demonstrated that grass competition dwarfed and reduced the yield of individual peach trees [Prunus persica (L.) Batsch] grown in narrow vegetation free areas (VFA). In this report, the area-based yield of two peach cultivars, 'Redskin' and 'Jersey Dawn' on 'Lovell', was estimated...

  8. QTL mapping and breeding value estimation through pedigree-based analysis of fruit size and weight in four diverse peach breeding programs

    NARCIS (Netherlands)

    Fresnedo-Ramírez, Jonathan; Frett, Terrence J.; Sandefur, Paul J.; Bink, Marco C.A.M.; Weg, van de Eric

    2016-01-01

    The narrow genetic base of peach (Prunus persica L. Batsch) challenges efforts to accurately dissect the genetic architecture of complex traits. Standardized phenotypic assessment of pedigree-linked breeding germplasm and new molecular strategies and analytical approaches developed and conducted

  9. Adaptation to nicotine feeding in Myzus persicae.

    Science.gov (United States)

    Ramsey, John S; Elzinga, Dezi A; Sarkar, Pooja; Xin, Yi-Ran; Ghanim, Murad; Jander, Georg

    2014-08-01

    Lineages of the generalist hemipteran herbivore Myzus persicae (green peach aphid) that have expanded their host range to include tobacco often have elevated nicotine tolerance. The tobacco-adapted M. persicae lineage used in this study was able to reproduce on nicotine-containing artificial diets at concentrations that were 15-fold higher than those that were lethal to a non-adapted M. persicae lineage. Fecundity of the nicotine-tolerant M. persicae lineage was increased by 100 μM nicotine in artificial diet, suggesting that this otherwise toxic alkaloid can serve as a feeding stimulant at low concentrations. This lineage also was pre-adapted to growth on tobacco, exhibiting no drop in fecundity when it was moved onto tobacco from a different host plant. Although growth of the non-tobacco-adapted M. persicae lineage improved after three generations on tobacco, this higher reproductive rate was not associated with increased nicotine tolerance. Myzus persicae gene expression microarrays were used to identify transcripts that are up-regulated in response to nicotine in the tobacco-adapted lineage. Induced expression was found for CYP6CY3, which detoxifies nicotine in M. persicae, other genes encoding known classes of detoxifying enzymes, and genes encoding secreted M. persicae salivary proteins.

  10. Protein (Viridiplantae): 939130 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Prunus persica MGFHLPLIVAILSLAAVALANNAAQPAPQLYWNSVLPNTQMPRSISELLHPDSTNEEKSKPENIPL...ARSGYSRKRYGGGPPPSDEGKPESIPLRNSGYQRKNYGGRPPPSDEGKPESIPLRNSGYQRKNYGGRPPPSDEGKPESIPLRNSGYQRKNYGGRPPPSDEGKPESIPL...RNSGYQRKNYGGRPPPSDEGKPESIPLRNSGYQRKNYGGRPPPSDEEKPESIPLRNSGYQRKNYGGRPPPSDEGKPESIPLRNSGYQRKNYGGRPPPSDEGKPESVP

  11. Identification and expression analysis of the SQUAMOSA promoter-binding protein (SBP)-box gene family in Prunus mume.

    Science.gov (United States)

    Xu, Zongda; Sun, Lidan; Zhou, Yuzhen; Yang, Weiru; Cheng, Tangren; Wang, Jia; Zhang, Qixiang

    2015-10-01

    SQUAMOSA promoter-binding protein (SBP)-box family genes encode plant-specific transcription factors that play crucial roles in plant development, especially flower and fruit development. However, little information on this gene family is available for Prunus mume, an ornamental and fruit tree widely cultivated in East Asia. To explore the evolution of SBP-box genes in Prunus and explore their functions in flower and fruit development, we performed a genome-wide analysis of the SBP-box gene family in P. mume. Fifteen SBP-box genes were identified, and 11 of them contained an miR156 target site. Phylogenetic and comprehensive bioinformatics analyses revealed that different groups of SBP-box genes have undergone different evolutionary processes and varied in their length, structure, and motif composition. Purifying selection has been the main selective constraint on both paralogous and orthologous SBP-box genes. In addition, the sequences of orthologous SBP-box genes did not diverge widely after the split of P. mume and Prunus persica. Expression analysis of P. mume SBP-box genes revealed their diverse spatiotemporal expression patterns. Three duplicated SBP-box genes may have undergone subfunctionalization in Prunus. Most of the SBP-box genes showed high transcript levels in flower buds and young fruit. The four miR156-nontargeted genes were upregulated during fruit ripening. Together, these results provide information about the evolution of SBP-box genes in Prunus. The expression analysis lays the foundation for further research on the functions of SBP-box genes in P. mume and other Prunus species, especially during flower and fruit development.

  12. Flavonoids from Prunus serotina Ehrh.

    Science.gov (United States)

    Olszewska, Monika

    2005-01-01

    In the course of chemotaxonomic study of the genus Prunus, seven flavonol glycosides were isolated from the leaves of Prunus serotina Ehrh., characterized by UV and NMR spectroscopy, and identified finally as three quercetin monosides: hyperoside, avicularin, reynoutrin, three quercetin biosides: 3-O-(6"-O-alpha-L-rhamnopyranosyl)-beta-D-glucopyranoside, 3-O-(2"-O-alpha-L-rhamnopyranosyl)-beta-D-glucopyranoside and 3-O-(2"-O-alpha-L-rhamnopyranosyl)-beta-D-galactopyranoside as well isorhamnetin 3-O-(6"-O-alpha-L-rhamnopyranosyl)-beta-D-glucopyranoside. The presence of determined flavonoids in the flowers was confirmed by TLC.

  13. Carbohydrate-free peach (Prunus persica and plum (Prunus domestica juice affects fecal microbial ecology in an obese animal model.

    Directory of Open Access Journals (Sweden)

    Giuliana D Noratto

    Full Text Available BACKGROUND: Growing evidence shows the potential of nutritional interventions to treat obesity but most investigations have utilized non-digestible carbohydrates only. Peach and plum contain high amounts of polyphenols, compounds with demonstrated anti-obesity effects. The underlying process of successfully treating obesity using polyphenols may involve an alteration of the intestinal microbiota. However, this phenomenon is not well understood. METHODOLOGY/PRINCIPAL FINDINGS: Obese Zucker rats were assigned to three groups (peach, plum, and control, n = 10 each, wild-type group was named lean (n = 10. Carbohydrates in the fruit juices were eliminated using enzymatic hydrolysis. Fecal samples were obtained after 11 weeks of fruit or control juice administration. Real-time PCR and 454-pyrosequencing were used to evaluate changes in fecal microbiota. Over 1,500 different Operational Taxonomic Units at 97% similarity were detected in all rats. Several bacterial groups (e.g. Lactobacillus and members of Ruminococcacea were found to be more abundant in the peach but especially in the plum group (plum juice contained 3 times more total polyphenolics compared to peach juice. Principal coordinate analysis based on Unifrac-based unweighted distance matrices revealed a distinct separation between the microbiota of control and treatment groups. These changes in fecal microbiota occurred simultaneously with differences in fecal short-chain acids concentrations between the control and treatment groups as well as a significant decrease in body weight in the plum group. CONCLUSIONS: This study suggests that consumption of carbohydrate-free peach and plum juice has the potential to modify fecal microbial ecology in an obese animal model. The separate contribution of polyphenols and non-polyphenols compounds (vitamins and minerals to the observed changes is unknown.

  14. Convergent evolution at the gametophytic self-incompatibility system in Malus and Prunus.

    Directory of Open Access Journals (Sweden)

    Bruno Aguiar

    Full Text Available S-RNase-based gametophytic self-incompatibility (GSI has evolved once before the split of the Asteridae and Rosidae. This conclusion is based on the phylogenetic history of the S-RNase that determines pistil specificity. In Rosaceae, molecular characterizations of Prunus species, and species from the tribe Pyreae (i.e., Malus, Pyrus, Sorbus revealed different numbers of genes determining S-pollen specificity. In Prunus only one pistil and pollen gene determine GSI, while in Pyreae there is one pistil but multiple pollen genes, implying different specificity recognition mechanisms. It is thus conceivable that within Rosaceae the genes involved in GSI in the two lineages are not orthologous but possibly paralogous. To address this hypothesis we characterised the S-RNase lineage and S-pollen lineage genes present in the genomes of five Rosaceae species from three genera: M. × domestica (apple, self-incompatible (SI; tribe Pyreae, P. persica (peach, self-compatible (SC; Amygdaleae, P. mume (mei, SI; Amygdaleae, Fragaria vesca (strawberry, SC; Potentilleae, and F. nipponica (mori-ichigo, SI; Potentilleae. Phylogenetic analyses revealed that the Malus and Prunus S-RNase and S-pollen genes belong to distinct gene lineages, and that only Prunus S-RNase and SFB-lineage genes are present in Fragaria. Thus, S-RNase based GSI system of Malus evolved independently from the ancestral system of Rosaceae. Using expression patterns based on RNA-seq data, the ancestral S-RNase lineage gene is inferred to be expressed in pistils only, while the ancestral S-pollen lineage gene is inferred to be expressed in tissues other than pollen.

  15. Convergent Evolution at the Gametophytic Self-Incompatibility System in Malus and Prunus

    Science.gov (United States)

    Cunha, Ana E.; Fonseca, Nuno A.; Iezzoni, Amy; van Nocker, Steve; Vieira, Cristina P.

    2015-01-01

    S-RNase-based gametophytic self-incompatibility (GSI) has evolved once before the split of the Asteridae and Rosidae. This conclusion is based on the phylogenetic history of the S-RNase that determines pistil specificity. In Rosaceae, molecular characterizations of Prunus species, and species from the tribe Pyreae (i.e., Malus, Pyrus, Sorbus) revealed different numbers of genes determining S-pollen specificity. In Prunus only one pistil and pollen gene determine GSI, while in Pyreae there is one pistil but multiple pollen genes, implying different specificity recognition mechanisms. It is thus conceivable that within Rosaceae the genes involved in GSI in the two lineages are not orthologous but possibly paralogous. To address this hypothesis we characterised the S-RNase lineage and S-pollen lineage genes present in the genomes of five Rosaceae species from three genera: M. × domestica (apple, self-incompatible (SI); tribe Pyreae), P. persica (peach, self-compatible (SC); Amygdaleae), P. mume (mei, SI; Amygdaleae), Fragaria vesca (strawberry, SC; Potentilleae), and F. nipponica (mori-ichigo, SI; Potentilleae). Phylogenetic analyses revealed that the Malus and Prunus S-RNase and S-pollen genes belong to distinct gene lineages, and that only Prunus S-RNase and SFB-lineage genes are present in Fragaria. Thus, S-RNase based GSI system of Malus evolved independently from the ancestral system of Rosaceae. Using expression patterns based on RNA-seq data, the ancestral S-RNase lineage gene is inferred to be expressed in pistils only, while the ancestral S-pollen lineage gene is inferred to be expressed in tissues other than pollen. PMID:25993016

  16. Application of GFP-tagged Plum pox virus to study Prunus-PPV interactions at the whole plant and cellular levels.

    Science.gov (United States)

    Lansac, M; Eyquard, J P; Salvador, B; Garcia, J A; Le Gall, O; Decroocq, V; Schurdi-Levraud Escalettes, V

    2005-11-01

    The Sharka disease caused by the potyvirus Plum pox virus (PPV) is one of the most serious viral diseases affecting stone fruit trees. The study of PPV/Prunus interaction under greenhouse controlled conditions is space, time, labor consuming. While the PPV/Prunus interactions are now quite well known at the whole plant level, few data however are available on the interactions between the virus and the Prunus host plants at the cellular level. Using a green fluorescent protein (GFP)-tagged M type PPV strain, combined to an in vitro inoculation procedure, we developed a novel tool to track PPV invasion in Prunus persica (peach) cv. GF305 and Prunus armeniaca (apricot) cv. Screara susceptible hosts. Different graft combinations were performed using in vitro-maintained healthy or GFP-tagged PPV infected 'GF305' and 'Screara'. Contact for 30 days in grafts between the inoculum and the genotype to be tested were found sufficient to allow the systemic spread of the recombinant virus: fluorescence from GFP-tagged PPV could easily be detected in the entire plant under a binocular microscope allowing quick and reliable sorting of infected plants. Using a fluorescence stereomicroscopy or confocal microscopy, GFP could also be observed in stem cross-sections especially in epidermis and pith cells. In vitro grafting inoculation with GFP-tagged PPV provides a new and powerful tool to facilitate mid-term virus maintenance. Moreover, this tool will be of special importance in the study of PPV infection dynamics in Prunus, allowing as well precise observations of cellular events related to PPV/Prunus interactions.

  17. Bioassay-guided isolation and identification of an antibacterial compound from Ferula persica var. persica roots

    Directory of Open Access Journals (Sweden)

    Ahmad-Reza Shahverdi

    2005-01-01

    Full Text Available The antibacterial activities of the chloroform and water extracts of Ferula persica var. persica (Apiaceaeroots were studied by the disk diffusion method. While the chloroform extract of F. persica roots showed antibacterial activity, the water extract of the roots at the concentrations that tested did not show any activity. By bioassay-guided fractionation of the chloroform extract of the roots by preparative thin layer chromatography (PTLC a compound was found which was active against some bacteria. By conventional spectroscopy methods the active fraction was identified as umbelliprenin. This coumarin was mostly active against B. subtillis, B. cereus, E. coli, K. ponumoniae, S. typhi, S. aureus, and S. epidermilis.

  18. Genome-wide association links candidate genes to resistance to Plum Pox Virus in apricot (Prunus armeniaca).

    Science.gov (United States)

    Mariette, Stéphanie; Wong Jun Tai, Fabienne; Roch, Guillaume; Barre, Aurélien; Chague, Aurélie; Decroocq, Stéphane; Groppi, Alexis; Laizet, Yec'han; Lambert, Patrick; Tricon, David; Nikolski, Macha; Audergon, Jean-Marc; Abbott, Albert G; Decroocq, Véronique

    2016-01-01

    In fruit tree species, many important traits have been characterized genetically by using single-family descent mapping in progenies segregating for the traits. However, most mapped loci have not been sufficiently resolved to the individual genes due to insufficient progeny sizes for high resolution mapping and the previous lack of whole-genome sequence resources of the study species. To address this problem for Plum Pox Virus (PPV) candidate resistance gene identification in Prunus species, we implemented a genome-wide association (GWA) approach in apricot. This study exploited the broad genetic diversity of the apricot (Prunus armeniaca) germplasm containing resistance to PPV, next-generation sequence-based genotyping, and the high-quality peach (Prunus persica) genome reference sequence for single nucleotide polymorphism (SNP) identification. The results of this GWA study validated previously reported PPV resistance quantitative trait loci (QTL) intervals, highlighted other potential resistance loci, and resolved each to a limited set of candidate genes for further study. This work substantiates the association genetics approach for resolution of QTL to candidate genes in apricot and suggests that this approach could simplify identification of other candidate genes for other marked trait intervals in this germplasm. © 2015 INRA, UMR 1332 BFP New Phytologist © 2015 New Phytologist Trust.

  19. Supercritical fluid extraction of peach (Prunus persica) almond oil: process yield and extract composition.

    Science.gov (United States)

    Mezzomo, Natália; Mileo, Bruna R; Friedrich, Maria T; Martínez, Julian; Ferreira, Sandra R S

    2010-07-01

    Peach kernels are industrial residues from the peach processing, contain oil with important therapeutic properties and attractive nutritional aspects because of the high concentration of oleic and linoleic acids. The extraction method used to obtain natural compounds from raw matter is critical for product quality definition. Thus, the aim of this work was to compare peach almond extraction yields obtained by different procedures: soxhlet extractions (Sox) with different solvents; hydrodistillation (HD); ethanolic maceration (Mac) followed by fractionation with various solvents, and supercritical fluid extraction (SFE) at 30, 40 and 50 degrees C and at 100, 200 and 300bar, performed with pure CO(2) and with a co-solvent. The extracts were evaluated with respect to fatty acid composition (FAC), fractionated chemical profile (FCP) and total phenolic content (TPC). The Sox total yields were generally higher than those obtained by SFE. The crossover pressure for SFE was between 260 and 280bar. The FAC results show oleic and linoleic acids as main components, especially for Sox and SFE extracts. The FCP for samples obtained by Sox and Mac indicated the presence of benzaldehyde and benzyl alcohol, components responsible for almond flavor and with important industrial uses, whereas the SFE extracts present a high content of a possible flavonoid. The higher TPC values were obtained by Sox and Mac with ethanol. In general, the maximum pressure in SFE produced the highest yield, TPC and oleic acid content. The use of ethanol at 5% as co-solvent in SFE did not result in a significant effect on any evaluated parameter. The production of peach almond oil through all techniques is substantially adequate and SFE presented advantages, with respect to the quality of the extracts due to the high oleic acid content, as presented by some Sox samples. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  20. Identification and validation of potential conserved microRNAs and their targets in peach (Prunus persica).

    Science.gov (United States)

    Gao, Zhihong; Luo, Xiaoyan; Shi, Ting; Cai, Bin; Zhang, Zhen; Cheng, Zongming; Zhuang, Weibing

    2012-09-01

    MicroRNAs are a class of small, endogenous, non-coding RNA molecules that negatively regulate gene expression at the transcriptional or the post-transcriptional level. Although a large number of miRNAs have been identified in many plant species, especially from model plants and crops, they remain largely unknown in peach. In this study, 110 potential miRNAs belonging to 37 families were identified using computational methods. A total of 43 potential targets were found for 21 families based on near-perfect or perfect complementarity between the plant miRNA and the target sequences. A majority of the targets were transcription factors which play important roles in peach development. qRT-PCR analysis of RNA samples prepared from different peach tissues for 25 miRNA families revealed that miRNAs were differentially expressed in different tissues. Furthermore, two target genes were experimentally verified by detection of the miRNA-mediated mRNA cleavage sites in peach using RNA ligase-mediated 5' rapid amplification of cDNA ends (RLM-RACE). Finally, we studied the expression pattern of the two target genes in three different tissues of peach to further understand the mechanism of the interaction between miRNAs and their target genes.

  1. Carbohydrate metabolism changes in Prunus persica gummosis infected with Lasiodiplodia theobromae.

    Science.gov (United States)

    Li, Z; Gao, L; Wang, Y T; Zhu, W; Ye, J L; Li, G H

    2014-05-01

    Peach gummosis represents a significant global disease of stone fruit trees and a major disease in the south peach production area of the Yangtze River of China. In this study, the carbohydrate composition of peach shoots during infection by Lasiodiplodia theobromae was examined. The expression of genes related to metabolic enzymes was also investigated. Control wounded and noninoculated tissue, lesion tissue, and wounded and inoculated surrounding lesion tissue of peach shoots were analyzed. Soluble sugars, glucose, mannose, arabinose, and xylose significantly increased in inoculated tissues of peach shoots compared with control tissues at different times after inoculation. Accumulation of polysaccharides was also observed by section observation and periodic acid Schiff's reagent staining during infection. Analysis using quantitative reverse-transcription polymerase chain reaction revealed that the abundance of key transcripts on the synthesis pathway of uridine diphosphate (UDP)-D-glucuronate, UDP-D-galactose, and UDP-D-arabinose increased but the synthesis of L-galactose and guanosine diphosphate-L-galactose were inhibited. After inoculation, the transcript levels of sugar transport-related genes (namely, SUT, SOT, GMT, and UGT) was induced. These changes in sugar content and gene expression were directly associated with peach gum polysaccharide formation and may be responsible for the symptoms of peach gummosis.

  2. Detection of seed dormancy QTL in three F2 families of peach (Prunus persica)

    Science.gov (United States)

    Dormancy is a condition that delays or inhibits growth in seed, vegetative buds, and floral buds. In peach, seed germination occurs when seed accumulate sufficient stratification and growing degree hours to break dormancy and begin growing. Correlations have been reported between mean seed stratifi...

  3. Response of early-peach [Prunus persica (L.)] trees to deficit irrigation

    Energy Technology Data Exchange (ETDEWEB)

    Abrisqueta, I.; Tapia, L. M.; Conejero, W.; Sanchez-Toribio, M. I.; Abrisqueta, J. M.; Vera, J.; Ruiz-Sanchez, C.

    2010-07-01

    The effect of different irrigation strategies in water relations, vegetative growth and yield of early maturing peach trees, growing in Murcia, (Spain) was studied during two years. Treatments consisted on: a control T1, full irrigated (150% of ETc); T2, continuous deficit irrigation at 50% of ETc; T3, regulated deficit irrigation (RDI), irrigated at 100% of ETc only during stage III of fruit growth and 25% the rest of the growing season; and T4, with automatic control of irrigation based on capacitance FDR-type probe data, varying threshold values. The results indicated that irrigation deficits in T2 and T3 treatments induced the lowest soil water content and stem water potential(?stem) values during the post harvest period (e.g {psi}{sub s}tem up to -1.8 MPa in T3 during summer 2008); thus, a reduction in trunk growth and pruning weight, respect to control treatment values, was noted in both years. Also, peach yield was significantly reduced in both deficit irrigated treatments. The greatest irrigation water saving in T3 treatment (=60%) caused the higher water use efficiency values in this treatment. For these reasons, water deficit during the post harvest periods (extended in the early maturing varieties) must be limited if fruit yield is not to be reduced. Irrigation scheduling based on capacitance probes have become a useful tool in the control of soil water content. When threshold values were precisely defined, the slight water deficits limited only vegetative growth while maintaining similar peach yield to that of well irrigated trees. (Author) 31 refs.

  4. Some effects of fuel oil on plants. [Lycopericum esculentum; Prunus persica

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, G.D.; Leadbeater, M.R.

    1935-01-01

    Commercial fuel oil has a harmful effect on plants when brought into contact with their roots, through the soil. The effect becomes fatal when the quantity is raised above the critical point for a species. The effect may or may not be due to penetration. If the oil has penetrated the tissues, it is most commonly found in the primary xylem; to a lesser extent it enters the secondary xylem, and the intercellular spaces of the pith and cortex. Contact does not seem to be a primary cause of death.

  5. Genome-wide analysis of the AP2/ERF superfamily in peach (Prunus persica).

    Science.gov (United States)

    Zhang, C H; Shangguan, L F; Ma, R J; Sun, X; Tao, R; Guo, L; Korir, N K; Yu, M L

    2012-10-17

    We identified 131 AP2/ERF (APETALA2/ethylene-responsive factor) genes in material from peach using the gene sequences of AP2/ERF amino acids of Arabidopsis thaliana (Brassicaceae) as probes. Based on the number of AP2/ERF domains and individual gene characteristics, the AP2/ERF superfamily gene in peach can be classified broadly into three families, ERF (ethylene-responsive factor), RAV (related to ABI3/VP1), and AP2 (APETALA2), containing 104, 5, and 21 members, respectively, along with a solo gene (ppa005376m). The 104 genes in the ERF family were further divided into 11 groups based on the group classification made for Arabidopsis. The scaffold localizations of the AP2/ERF genes indicated that 129 AP2/ERF genes were all located on scaffolds 1 to 8, except for two genes, which were on scaffolds 17 and 10. Although the primary structure varied among AP2/ERF superfamily proteins, their tertiary structures were similar. Most ERF family genes have no introns, while members of the AP2 family have more introns than genes in the ERF and RAV families. All sequences of AP2 family genes were disrupted by introns into several segments of varying sizes. The expression of the AP2/ERF superfamily genes was highest in the mesocarp; it was far higher than in the other seven tissues that we examined, implying that AP2/ERF superfamily genes play an important role in fruit growth and development in the peach. These results will be useful for selecting candidate genes from specific subgroups for functional analysis.

  6. The molecular basis for tree growth habit in Prunus persica (peach)

    Science.gov (United States)

    The large size and spreading growth habit of trees requires excessive labor, land space, and pesticides. Genetically improving tree shapes so they can be planted at higher density and/or more readily adapted to mechanization would increase productivity and be more environmentally friendly. Current...

  7. Analysis of basic leucine zipper genes and their expression during bud dormancy in peach (Prunus persica).

    Science.gov (United States)

    Sun, Ming-Yue; Fu, Xi-Ling; Tan, Qiu-Ping; Liu, Li; Chen, Min; Zhu, Cui-Ying; Li, Ling; Chen, Xiu-De; Gao, Dong-Sheng

    2016-07-01

    Dormancy is a biological characteristic developed to resist the cold conditions in winter. The bZIP transcription factors are present exclusively in eukaryotes and have been identified and classified in many species. bZIP proteins are known to regulate numerous biological processes, however, the role of bZIP in bud dodormancy has not been studied extensively. In total, 50 PpbZIP transcription factor-encoding genes were identified and categorized them into 10 groups (A-I and S). Similar intron/exon structures, additional conserved motifs, and DNA-binding site specificity supported our classification scheme. Additionally, chromosomal distribution and collinearity analyses suggested that expansion of the PpbZIP transcription factor family was due to segment/chromosomal duplications. We also predicted the dimerization properties based on characteristic features of the leucine zipper and classified PpbZIP proteins into 23 subfamilies. Furthermore, qRT-PCR results indicated that PpbZIPs genes may be involved in regulating dormancy. The same gene of different species might participate in different regulating networks through interactions with specific partners. Our expression profiling results complemented the microarray data, suggesting that co-expression patterns of bZIP transcription factors during dormancy differed among deciduous fruit trees. Our findings further clarify the molecular characteristics of the PpbZIP transcription factor family, including potential gene functions during dormancy. This information may facilitate further research on the evolutionary history and biological functions of bZIP proteins in peach and other rosaceae plants. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  8. Whole genome sequencing of peach (Prunus persica L.) for SNP identification and selection.

    Science.gov (United States)

    Ahmad, Riaz; Parfitt, Dan E; Fass, Joseph; Ogundiwin, Ebenezer; Dhingra, Amit; Gradziel, Thomas M; Lin, Dawei; Joshi, Nikhil A; Martinez-Garcia, Pedro J; Crisosto, Carlos H

    2011-11-22

    The application of next generation sequencing technologies and bioinformatic scripts to identify high frequency SNPs distributed throughout the peach genome is described. Three peach genomes were sequenced using Roche 454 and Illumina/Solexa technologies to obtain long contigs for alignment to the draft 'Lovell' peach sequence as well as sufficient depth of coverage for 'in silico' SNP discovery. The sequences were aligned to the 'Lovell' peach genome released April 01, 2010 by the International Peach Genome Initiative (IPGI). 'Dr. Davis', 'F8, 1-42' and 'Georgia Belle' were sequenced to add SNPs segregating in two breeding populations, Pop DF ('Dr. Davis' × 'F8, 1-42') and Pop DG ('Dr. Davis' × 'Georgia Belle'). Roche 454 sequencing produced 980,000 total reads with 236 Mb sequence for 'Dr. Davis' and 735,000 total reads with 172 Mb sequence for 'F8, 1-42'. 84 bp × 84 bp paired end Illumina/Solexa sequences yielded 25.5, 21.4, 25.5 million sequences for 'Dr. Davis', 'F8, 1-42' and 'Georgia Belle', respectively. BWA/SAMtools were used for alignment of raw reads and SNP detection, with custom PERL scripts for SNP filtering. Velvet's Columbus module was used for sequence assembly. Comparison of aligned and overlapping sequences from both Roche 454 and Illumina/Solexa resulted in the selection of 6654 high quality SNPs for 'Dr. Davis' vs. 'F8, 1-42' and 'Georgia Belle', distributed on eight major peach genome scaffolds as defined from the 'Lovell' assembly. The eight scaffolds contained about 215-225 Mb of peach genomic sequences with one SNP/~ 40,000 bases. All sequences from Roche 454 and Illumina/Solexa have been submitted to NCBI for public use in the Short Read Archive database. SNPs have been deposited in the NCBI SNP database.

  9. Modelling of Peach Tree (Prunus persica) Full Blooming Dates Using APCC MME Seasonal Forecasts

    Science.gov (United States)

    Chun, Jong; Kim, Sung; Lee, Hyojin; Han, Hyun-Hee; Son, In-Chang; Cho, Kyung Hwa

    2016-04-01

    Due to global warming, recently, bud-burst and flowering dates of fruit crops have become earlier and the abnormal climate increases the variabilities of temperature in spring, suggesting that the risk of frost damage has increased. However, the full blooming date prediction model for peach tree used by the Rural Developmental Administration (RDA) were developed using only one cultivar (Youmyeong) and observations from a station (Suwon). This model might not adequately reflect the characteristics of peach cultivars or local orchards. the objectives of this study were to develops the site-and cultivar-specific blooming date prediction models for major peach cultivation regions and cultivars and presents a framework for applications of the APEC Climate Center Multimodel Ensemble (APCC MME) seasonal datasets.Developmental rate (DVR), and Sequential dormancy models (Chill day, New chill day, and fraction-time models) were used to develop the locally tailored full blooming date prediction models for major peach cultivars. For the development of these models, bud-burst and full blooming dates of peach tree for 5 cultivars (Cheonhong, Youmyeong, Changbangjosaeng, Cheonjoongdo, and Janghowon) were collected from the 6 major peach cultivation sites: Chuncheon, Suwon, Cheongwon, Cheongdo, Naju, and Jinju. For the chill day model, those measures for the entire dataset regardless the location and cultivar were 2.31%, 0.79, and 3.36 day for MAPE, R2, RMSE, respectively. For the new chill day model, those values (2.19%, 0.82, and 3.16 day for MAPE, R2, RMSE, respectively) were slightly better than those of the chill day model. The model results showed that the new chill day model was found slightly highest performance than others. Based on the considerations of the predictability of the statistical downscaling method and the observed periods of the full blooming dates at each site, we determined that the APCC MME seasonal datasets were applied for the new chill day model for the Changbangjosaeng and Youmyeong cultivars at the Suwon site. The values of the goodness-of-fit measures using the selected synthetic daily maximum and minimum temperatures reflecting APCC MME seasonal datasets and selected were worse than those using those collected from the Suwon station. It is concluded that further work was recommended that the predictability of APCC MME seasonal forecasts should be improved to reduce the prediction errors of full blooming dates of peach trees.

  10. Incidence and phylogenetic analyses of Armillaria spp. associated with root disease in peach orchards in the State of Mexico, Mexico

    Science.gov (United States)

    R. D. Elias-Roman; R. A. Guzman-Plazola; N. B. Klopfenstein; D. Alvarado-Rosales; G. Calderon-Zavala; J. A. Mora-Aguilera; M.-S. Kim; R. Garcia-Espinosa

    2013-01-01

    Incidence of peach [Prunus persica (L.) Batsch] tree mortality attributed to Armillaria root disease was assessed from 2009 to 2011 in 15 orchards in the State of Mexico, Mexico. Incidence increased gradually every year of assessment, reaching average values of 9.7, 15.3 and 20.3% tree mortality and 23.2, 24.7 and 28.3% disease-impacted area of the orchards during 2009...

  11. Effects of Fe-chlorosis on the stomatal behaviour and water relations of field-grown peach leaves

    OpenAIRE

    Eichert, Thomas; Peguero-Pina, Jose J.; Gil-Pelegrin, Eustaquio; Fernández, Victoria

    2009-01-01

    We investigated the effects of Fe nutrition on the stomatal behaviour and water relations of peach leaves (Prunus persica (L.) Batsch, cv. Miraflores), under field conditions. Transpiration rates, net photosynthesis and water use efficiency were significantly lower in chlorotic leaves than in healthy green leaves. In the course of the day, the water potentials in healthy leaves strongly declined to –2.0 MPa, whereas in chlorotic leaves the minimum water potential was only -1.0 MPa. The hydrau...

  12. Época e ciclo de maturação de pêssegos e nectarinas no estado de São Paulo Ripening season of peaches and nectarines in the state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Wilson Barbosa

    1990-01-01

    Full Text Available Na Estação Experimental de Jundiaí (23°08'S, do Instituto Agronômico (IAC, controlou-se o número de dias entre a antese e a maturação dos frutos de vinte cultivates de pêssegos (Prvnus persica L. Batsch e nectarinas (P. persica L. Batsch var. nucipersica. Com base nos resultados obtidos, elaborou-se nova tabela classificatória para ciclos de frutificação, da qual constam, respectivamente, a faixa de maturação, o número de dias entre a flora da e a colheita dos frutos e os cultivares: ultraprecoce,181 dias (Bolão.Twenty peach (Prunus persica L. Batsch and nectarine (P. persica L. Batsch var. nucipersica cultivars were evaluated for ripening season over seven years at Jundiaí (23°08'S, State of São Paulo, Brazil. A new classification table was elaborated for the Institute Agronômico cultiva rs. It contains, respectively, maturation period, days between full bloom and fruit maturity and cultivars: ultra-early, 181 days (Bolão.

  13. Taxonomy Icon Data: peach [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available g Prunus_persica_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Prunus+persica&t=L http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Prunus+persica&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Prunus...+persica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Prunus+persica&t=NS ...

  14. Early growth performances of various seed sources of black (Prunus ...

    African Journals Online (AJOL)

    Early growth performances of various seed sources of black (Prunus serotina Erhr.) and wild cherry ( Prunus avium L.) seedlings on low and high elevation sites in the western Black Sea Region of Turkey.

  15. Using Perls Staining to Trace the Iron Uptake Pathway in Leaves of a Prunus Rootstock Treated with Iron Foliar Fertilizers.

    Science.gov (United States)

    Rios, Juan J; Carrasco-Gil, Sandra; Abadía, Anunciación; Abadía, Javier

    2016-01-01

    The aim of this study was to trace the Fe uptake pathway in leaves of Prunus rootstock (GF 677; Prunus dulcis × Prunus persica) plants treated with foliar Fe compounds using the Perls blue method, which detects labile Fe pools. Young expanded leaves of Fe-deficient plants grown in nutrient solution were treated with Fe-compounds using a brush. Iron compounds used were the ferrous salt FeSO4, the ferric salts Fe2(SO4)3 and FeCl3, and the chelate Fe(III)-EDTA, all of them at concentrations of 9 mM Fe. Leaf Fe concentration increases were measured at 30, 60, 90 min, and 24 h, and 70 μm-thick leaf transversal sections were obtained with a vibrating microtome and stained with Perls blue. In vitro results show that the Perls blue method is a good tool to trace the Fe uptake pathway in leaves when using Fe salts, but is not sensitive enough when using synthetic Fe(III)-chelates such as Fe(III)-EDTA and Fe(III)-IDHA. Foliar Fe fertilization increased leaf Fe concentrations with all Fe compounds used, with inorganic Fe salts causing larger leaf Fe concentration increases than Fe(III)-EDTA. Results show that Perls blue stain appeared within 30 min in the stomatal areas, indicating that Fe applied as inorganic salts was taken up rapidly via stomata. In the case of using FeSO4 a progression of the stain was seen with time toward vascular areas in the leaf blade and the central vein, whereas in the case of Fe(III) salts the stain mainly remained in the stomatal areas. Perls stain was never observed in the mesophyll areas, possibly due to the low concentration of labile Fe pools.

  16. Investigation on the pollen morphology of traditional cultivars of Prunus species in Sicily

    Directory of Open Access Journals (Sweden)

    Anna Geraci

    2012-08-01

    Full Text Available In this study pollen grains of 13 cultivars and 3 rootstocks belonging to 5 species (P. armeniaca, P. domestica, P. dulcis, P. persica, P. avium of the genus Prunus collected from North-East Sicily were examined for the micromorphological characterization through the scanning electron microscopy (SEM. The length of polar axis (P and the equatorial diameter (E of grain, P/E ratio, the length of colpi (C, diameter of perforations (DP and the number of perforations in 25 μm2 (PN, the width of muri (WM, the distance between muri (DM and their number in 25 μm2 (MN, the width of grooves (WG were measured and their variation was compared among studied taxa. Moreover multivariate statistical analysis was carried out to distinguish morphometric information from measured parameters. All pollen grains are trizonocolpate, isopolar, medium-large sized and their shape varies from prolate to perprolate. Regarding outline pollen grains are subtriangular in polar view and elliptic in equatorial view. Exine sculpturing is striate with perforations on grain surface. The arrangement of ridges appears roughly parallel but too sloped (sometimes curved compared to polar axis, or branched and oriented in different directions, or perfectly parallel or more irregular with bifurcated ridges often sinuous. The analyses showed a great variability (particularly in P. domestica cultivars related in some cases to the diversity in the morphological features of the leaves and the fruits of the investigated entities.

  17. Silvical characteristics of black cherry (Prunus serotina)

    Science.gov (United States)

    Ashbel F. Hough

    1960-01-01

    Black cherry (Prunus serotina Ehrh.) is the largest of the native cherry trees of the United States. It may grow to more than 100 feet in height, and to as much as 5 feet in diameter. It is the only species of its genus that provides lumber for commerce. And this lumber, because of its stability and its superior working qualities, is one of the most...

  18. Transcription of densovirus endogenous sequences in the Myzus persicae genome.

    Science.gov (United States)

    Clavijo, Gabriel; van Munster, Manuella; Monsion, Baptiste; Bochet, Nicole; Brault, Véronique

    2016-04-01

    Integration of non-retroviral sequences in the genome of different organisms has been observed and, in some cases, a relationship of these integrations with immunity has been established. The genome of the green peach aphid, Myzus persicae (clone G006), was screened for densovirus-like sequence (DLS) integrations. A total of 21 DLSs localized on 10 scaffolds were retrieved that mostly shared sequence identity with two aphid-infecting viruses, Myzus persicae densovirus (MpDNV) and Dysaphis plantaginea densovirus (DplDNV). In some cases, uninterrupted potential ORFs corresponding to non-structural viral proteins or capsid proteins were found within DLSs identified in the aphid genome. In particular, one scaffold harboured a complete virus-like genome, while another scaffold contained two virus-like genomes in reverse orientation. Remarkably, transcription of some of these ORFs was observed in M. persicae, suggesting a biological effect of these viral integrations. In contrast to most of the other densoviruses identified so far that induce acute host infection, it has been reported previously that MpDNV has only a minor effect on M. persicae fitness, while DplDNV can even have a beneficial effect on its aphid host. This suggests that DLS integration in the M. persicae genome may be responsible for the latency of MpDNV infection in the aphid host.

  19. Arsenic Removal from Aqueous Solutions by Salvadora persica Stem Ash

    Directory of Open Access Journals (Sweden)

    Ferdos Kord Mostafapour

    2013-01-01

    Full Text Available Arsenic is a naturally occurring metalloid, which is widely distributed in nature and is regarded as the largest mass poisoning in history. In the present study, the adsorption potential of Salvadora persica (S. persica stem ash in a batch system for the removal of As(V from aqueous solutions was investigated. Isotherm studies were carried out to evaluate the effect of contact time (20–240 min, pH (2–11, initial arsenic concentration (50–500 μg/L, and adsorbent dose on sorption efficiency. Maximum removal efficiency of 98.33% and 99.32% was obtained at pH 6, adsorbent dosage 3.5 g/L, initial As(V concentration 500 μg/L, and contact time 80 and 60 min for S. persica stem ash at 300 °C and 500 °C, respectively. Also, the adsorption equilibriums were analyzed by the Langmuir and Freundlich isotherm models. Such equilibriums showed that the adsorption data was well fitted with the Freundlich isotherm model for S. persica stem ash at both 300 °C and 500 °C (R2=0.8983 and 0.9274, resp.. According to achieved results, it was defined that S. persica stem ash can be used effectively for As(V removal from the aqueous environment.

  20. Carbohydrate-Free Peach (Prunus persica) and Plum (Prunus salicina) [corrected] Juice Affects Fecal Microbial Ecology in an Obese Animal Model.

    Science.gov (United States)

    Noratto, Giuliana D; Garcia-Mazcorro, Jose F; Markel, Melissa; Martino, Hercia S; Minamoto, Yasushi; Steiner, Jörg M; Byrne, David; Suchodolski, Jan S; Mertens-Talcott, Susanne U

    2014-01-01

    Growing evidence shows the potential of nutritional interventions to treat obesity but most investigations have utilized non-digestible carbohydrates only. Peach and plum contain high amounts of polyphenols, compounds with demonstrated anti-obesity effects. The underlying process of successfully treating obesity using polyphenols may involve an alteration of the intestinal microbiota. However, this phenomenon is not well understood. Obese Zucker rats were assigned to three groups (peach, plum, and control, n = 10 each), wild-type group was named lean (n = 10). Carbohydrates in the fruit juices were eliminated using enzymatic hydrolysis. Fecal samples were obtained after 11 weeks of fruit or control juice administration. Real-time PCR and 454-pyrosequencing were used to evaluate changes in fecal microbiota. Over 1,500 different Operational Taxonomic Units at 97% similarity were detected in all rats. Several bacterial groups (e.g. Lactobacillus and members of Ruminococcacea) were found to be more abundant in the peach but especially in the plum group (plum juice contained 3 times more total polyphenolics compared to peach juice). Principal coordinate analysis based on Unifrac-based unweighted distance matrices revealed a distinct separation between the microbiota of control and treatment groups. These changes in fecal microbiota occurred simultaneously with differences in fecal short-chain acids concentrations between the control and treatment groups as well as a significant decrease in body weight in the plum group. This study suggests that consumption of carbohydrate-free peach and plum juice has the potential to modify fecal microbial ecology in an obese animal model. The separate contribution of polyphenols and non-polyphenols compounds (vitamins and minerals) to the observed changes is unknown.

  1. Interspecific hybridizations in ornamental flowering cherries (Prunus species)

    Science.gov (United States)

    Flowering cherries belong to the genus Prunus L., consisting primarily of species native to Asia. Despite the popularity of ornamental cherry trees in the landscape, most ornamental Prunus planted in the U.S. are derived from a limited genetic base of Japanese flowering cherry taxa. Controlled cross...

  2. A molecular phylogeny of selected species of Genus Prunus L ...

    African Journals Online (AJOL)

    In the present study, the genus Prunus was studied in detail to find out the phylogenetic relationship among the 12 species of Prunus selected from different regions of Pakistan and GenBank using the maximum parsimony analysis of sequence polymorphism in chloroplast TRN-L and TRN-F spacer DNA. The results for the ...

  3. A molecular phylogeny of selected species of Genus Prunus L ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... Sorbus L. (mountain ash) and Spiraea L. (bridal wreath). (Potter, 2003). According to Rehder (1940), Prunus has nearly 200 species, mostly in ... DNA was extracted from the fresh and herbarium samples of. Prunus by the method of Doyle and Doyle (1987). For the polymerase chain reaction (PCR) analysis ...

  4. Enraizamento de estacas herbáceas de quatro clones de umezeiro (Prunus mume Sieb. et Zucc. durante o inverno ameno, em Jaboticabal-SP Rooting of herbaceous cuttings of four mume clones (Prunus mume Sieb. et Zucc. during soft winter, in Jaboticabal, São Paulo state, Brazil

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2003-12-01

    Full Text Available Estudos realizados no Brasil com o umezeiro (Prunus mume Sieb. et Zucc. relatam promissoras perspectivas de utilização desta espécie como porta-enxerto para pessegueiro e nectarineira, em função de sua rusticidade, adaptação ao inverno brando, compatibilidade com Prunus persica, redução do vigor das plantas e melhoria da qualidade dos frutos. Entretanto, em função da propagação por sementes, tem sido observadas diferenças de vigor entre as plantas, resultando em pomares muito heterogêneos. Assim, o presente estudo teve por objetivo estudar o enraizamento de estacas herbáceas de quatro clones de umezeiro (Clones 02, 05, 10 e 15 durante o inverno ameno, em Jaboticabal-SP. O experimento foi conduzido entre os meses de junho e agosto, sendo avaliado aos 70 dias após a estaquia. Pelos resultados obtidos, foi possível concluir que é viável a propagação dos clones estudados por enraizamento de estacas herbáceas durante o inverno. Foram observadas diferenças entre os clones quanto à porcentagem de enraizamento, porcentagem de estacas com calo, número e comprimento das raízes. No conjunto das variáveis analisadas, os melhores resultados foram obtidos com os Clones 10 e 15.Studies developed in Brazil with the mume (Prunus mume Sieb. et Zucc. have shown promising perspectives of using this species as rootstock for peach and nectarine trees, in function of its rusticity, adaptation to soft winter, compatibility with Prunus persica, plant vigor reduction and improvement of the fruit quality. However, due to seed propagation, vigor differences have been observed among plants, resulting in very heterogeneous orchards. Thus, the present study had the objective of studying the rooting of herbaceous cuttings of four mume clones (Clones 02, 05, 10 and 15 in intermittent mist during the soft winter, in Jaboticabal, São Paulo State, Brazil. The experiment was carried out between June and August, being evaluated 70 days after the cutting

  5. Haemangiosarcoma in a captive Asiatic lion ( Panthera leo persica ...

    African Journals Online (AJOL)

    Although these tumours mainly appear to be occurring in older cats, they are sometimes observed in younger animals, as in the present case. This is the first description of haemangiosarcoma in a young Asiatic lion. Keywords: Asiatic lion, Haemangiosarcoma, Histopathology, Neoplasia, Panthera leo persica ...

  6. The antibacterial activity of traditionally used Salvadora Persica L ...

    African Journals Online (AJOL)

    Background: Nowadays there is a need to find naturally occurring substances from plants with antimicrobial activity as an alternative to available used antibiotics. Materials and Methods: Salvadora persica (miswak) and Commiphora gileadensis were collected, dried and extracted with either methanol or warm water and the ...

  7. Antibacterial potential of extracts of leaves of Parrotia persica

    African Journals Online (AJOL)

    SERVER

    2007-11-19

    Nov 19, 2007 ... persica. Mohammad Ahanjan1, Mohana, D. C1, Raveesha, K. A.1* and M. Azadbakht2. 1Microbiology laboratory, Department of studies in Botany and Microbiology, University of Mysore, Manasagangotri,. Mysore 570 006, India. 2Faculty of Pharmacy, University of Mazandaran Medical Sciences, Sary, Iran.

  8. Carotenoids, Phenolic Profile, Mineral Content and Antioxidant Properties in Flesh and Peel of Prunus persica Fruits during Two Maturation Stages.

    Science.gov (United States)

    Dabbou, Samia; Maatallah, Samira; Castagna, Antonella; Guizani, Monia; Sghaeir, Wala; Hajlaoui, Hichem; Ranieri, Annamaria

    2017-03-01

    Carotenoids and phenolic profile, antioxidant activity as well as concentrations of selected macronutrients (K, N, Mg, Ca and Na) and micronutrients (Zn, Cu and Mn) in flesh and peel of peach fruit were recorded at two harvest dates. Predominant mineral was potassium, followed by calcium, magnesium and sodium. The concentration of most micronutrients was greater in the peel than in the flesh especially in early season. The concentration of most elements in flesh and peel decreased during fruit maturation. Total carotenoids content varied with respect to the cultivar. β-cryptoxanthin and β-carotene were the major carotenoids in both tissues and flesh contain the lowest amounts. Neochlorogenic acid, chlorogenic acid, catechin, epicatechin, gallic acid, rutin, quercetin-3-O-galactoside, cyanidin-3-O-glucoside, cyanidin-3-O-rutinoside, were detected in both peel and flesh, with chlorogenic acid and catechin being the predominant components. Peel extracts showed markedly higher antioxidant activities, when estimated by ABTS or DPPH assays, than the flesh counterparts, consistent with the observed higher phenolic content. Overall, total phenolics levels increased at full ripening stage in both peel and flesh. The results found herein provide important data on carotenoids, phenolic and macro- and micronutrient changes during fruit growth, and emphases peach fruit as a potential functional food.

  9. Occupational Allergy to Peach (Prunus persica) Tree Pollen and Potential Cross-Reactivity between Rosaceae Family Pollens.

    Science.gov (United States)

    Jiang, Nannan; Yin, Jia; Mak, Philip; Wen, Liping

    2015-10-01

    Orchard workers in north China are highly exposed to orchard pollens, especially peach and other Rosaceae family pollens during pollination season. The aim of this study was to investigate whether occupational allergy to peach tree pollen as a member of Rosaceae family is IgE-mediated and to evaluate the cross-reactivity among Rosaceae family pollens. Allergen skin test and conjunctival challenge test were performed; enzyme linked immune-sorbent assay (ELISA), inhibiting ELISA, western immunoblotting and inhibiting western immunoblotting were done with Rosaceae family orchard pollens, including peach, apricot, cherry, apple and pear tree pollens. Mass spectrometry was also performed to probe the main allergen component and cross-reactive protein. Sensitizations to peach pollen were found in both skin test and conjunctival challenge in the patients. Serum specific IgE to three pollens (peach, apricot and cherry) were detected through ELISA. When peach pollen used as solid phase, ELISA inhibition revealed other four kinds of pollens capable of inducing partial to strong inhibitions (45% to 87%), with the strongest inhibition belonging to apricot pollen (87%). Western blotting showed predominant IgE binding to a 20 KD protein among these pollens, which appeared to be a cross-reactive allergen component through western blotting inhibition. It was recognized as a protein homologous to glutathione s-transferase 16 from Arabidopsis thaliana. Peach and other Rosaceae family tree pollen may serve as a potential cause of IgE mediated occupational respiratory disease in orchard workers in north China.

  10. Genome-wide identification and analysis of FK506-binding protein gene family in peach (Prunus persica).

    Science.gov (United States)

    Zhang, Yanping; Han, Jan; Liu, Dan; Wen, Xicheng; Li, Yu; Tao, Ran; Peng, Yongbin; Fang, Jinggui; Wang, Chen

    2014-02-25

    The FKBP protein family has prolyl isomerase activity and is related in function to cyclophilins. FKBPs are known to be involved in many biological processes including hormone signaling, plant growth, and stress responses through a chaperone or an isomerization of proline residues during protein folding. The availability of complete peach genome sequences allowed the identification of 21 FKBP genes by HMMER and BLAST analyses. Scaffold locations of these FKBP genes in the peach genome were determined and the protein domain and motif organization of peach FKBPs were analyzed. The phylogenetic relationships between peach FKBPs were also assessed. The expression profiles of peach FKBP gene results revealed that most peach FKBPs were expressed in all tissues, while a few peach FKBPs were specifically expressed in some of the tissues. This data could contribute to better understanding of the complex regulation of the peach FKBP gene family, and also provide valuable information for further research in peach functional genomics. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Potassium contributes to zinc stress tolerance in peach (Prunus persica) seedlings by enhancing photosynthesis and the antioxidant defense system.

    Science.gov (United States)

    Song, Z Z; Duan, C L; Guo, S L; Yang, Y; Feng, Y F; Ma, R J; Yu, M L

    2015-07-27

    Zinc (Zn) is considered to be a major industrial pollutant because excessive amounts can impair plant growth. In this paper, we found that peach 'Yoshihime' seedlings are promising Zn tolerant plants. However, heavy Zn toxicity (2 mM) damaged plant performance by disrupting biochemical processes, including photosynthesis, proline production, and K(+) nutrition. Notably, elevated external K(+) supply (10 mM) alleviated peach seedlings from Zn toxicity, evidenced by enhanced photosynthesis, antioxidant defense systems, and plant K(+) nutritional status. Moreover, the transcript levels of KUP (K(+) uptake) genes involved in K(+) acquisition, transport, and homeostasis were significantly upregulated following supply of sufficient K(+) upon Zn toxicity. In general, K(+) favorably contributes to improvements in internal K(+) homeostasis, via the help of K(+) transporters, further protecting plant photosynthesis and the antioxidative defense system. Our findings further benefit the study of the mechanisms underpinning heavy metal tolerance in woody plants.

  12. Genome-Wide Identification and Analysis of the Type-B Authentic Response Regulator Gene Family in Peach (Prunus persica).

    Science.gov (United States)

    Zeng, Jingjue; Zhu, Xudong; Haider, Muhammad S; Wang, Xicheng; Zhang, Cheng; Wang, Chen

    2017-01-01

    The type-B authentic response regulator (ARR-B) family members serve as DNA-binding transcriptional regulators, whose activities are probably regulated by phosphorylation/dephosphorylation, resulting in the rapid induction of type-A ARR genes. Type-B ARRs are believed to be involved in many biological processes, including cytokinin signaling, plant growth, and stress responses through a chaperone or by isomerization of proline residues during protein folding. The public availability of complete peach genome sequences allows the identification of 23 ARR-B genes by HMMER and blast analysis. Scaffold locations of these genes in the peach genome were determined, and the protein domain and motif organization of peach type-B ARRs were analyzed. The phylogenetic relationships between peach type-B ARRs were also assessed. The expression profiles of peach ARR-B genes revealed that most of the type-B ARRs showed high expression levels in tissues undergoing rapid cell division and may engage more cytokinins, like half-opened flowers, fruits at expansion stages, and young leaves. These findings not only contribute to a better understanding of the complex regulation of the peach ARR-B gene family, but also provide valuable information for future research in peach functional genomics. © 2017 S. Karger AG, Basel.

  13. Gamma irradiation induced enhancement of phenylalanine ammonia-lyase (PAL) and antioxidant activity in peach ( Prunus persica Bausch, Cv. Elberta)

    Science.gov (United States)

    Hussain, Peerzada R.; Wani, Ali M.; Meena, Raghuveer S.; Dar, Mohd A.

    2010-09-01

    Effect of medium dose gamma irradiation on PAL and antioxidant activity of peach fruit was investigated. Peach fruit after harvest at commercial maturity was irradiated in the dose range 1.0-2.0 kGy, stored under refrigerated conditions (3±1 °C, RH 80%) and evaluated at intervals of 7 days. The antioxidant activity as determined by DPPH and FRAP methods revealed significant ( p≤0.05) increase particularly in the dose range 1.6-2.0 kGy. During storage, maximum increase in both PAL and antioxidant activity was observed after 21 days. Positive correlation ( r=0.75) existed between antioxidant activity and total phenols. EC 50 values as obtained from DPPH and FRAP experiments were significantly ( p≤0.05) lower in irradiated fruits compared to control.

  14. Studies on enhancing the keeping quality of peach ( Prunus persica Bausch) Cv. Elberta by gamma-irradiation

    Science.gov (United States)

    Hussain, P. R.; Meena, R. S.; Dar, M. A.; Wani, A. M.

    2008-04-01

    The effect of gamma-irradiation on keeping quality of peach fruit was studied. The fruit, after harvesting at proper maturity stage, was irradiated in the dose range of 1.0-2.0 kGy, stored under ambient (temp. 25±2 °C, RH 70%) and refrigerated (temp. 3±1 °C, RH 80%) conditions and evaluated periodically for firmness, total soluble solids (TSS), anthocyanins, water-soluble pectic fractions, loss in weight and decay percentage. The anthocyanin evaluation of the fruits revealed that irradiation enhanced the colour development under both the storage conditions. The gamma-irradiation dose range of 1.2-1.4 kGy proved effective in maintaining higher TSS concentration, reducing weight loss and significantly ( p⩽0.05) delaying the decaying of the fruit by 6 days under ambient conditions and by 20 days under refrigerated storage conditions.

  15. Genome-wide analysis of the homeodomain-leucine zipper (HD-ZIP) gene family in peach (Prunus persica).

    Science.gov (United States)

    Zhang, C H; Ma, R J; Shen, Z J; Sun, X; Korir, N K; Yu, M L

    2014-04-08

    In this study, 33 homeodomain-leucine zipper (HD-ZIP) genes were identified in peach using the HD-ZIP amino acid sequences of Arabidopsis thaliana as a probe. Based on the phylogenetic analysis and the individual gene or protein characteristics, the HD-ZIP gene family in peach can be classified into 4 subfamilies, HD-ZIP I, II, III, and IV, containing 14, 7, 4, and 8 members, respectively. The most closely related peach HD-ZIP members within the same subfamilies shared very similar gene structure in terms of either intron/exon numbers or lengths. Almost all members of the same subfamily shared common motif compositions, thereby implying that the HD-ZIP proteins within the same subfamily may have functional similarity. The 33 peach HD-ZIP genes were distributed across scaffolds 1 to 7. Although the primary structure varied among HD-ZIP family proteins, their tertiary structures were similar. The results from this study will be useful in selecting candidate genes from specific subfamilies for functional analysis.

  16. The study of a SPATULA-like bHLH transcription factor expressed during peach (Prunus persica) fruit development.

    Science.gov (United States)

    Tani, Eleni; Tsaballa, Aphrodite; Stedel, Catalina; Kalloniati, Chrissanthi; Papaefthimiou, Dimitra; Polidoros, Alexios; Darzentas, Nikos; Ganopoulos, Ioannis; Flemetakis, Emmanouil; Katinakis, Panagiotis; Tsaftaris, Athanasios

    2011-06-01

    Extensive studies on the dry fruits of the model plant arabidopsis (Arabidopsis thaliana) have revealed various gene regulators of the development and dehiscence of the siliques. Peach pericarp is analogous to the valve tissues of the arabidopsis siliques. The stone (otherwise called pit) in drupes is formed through lignification of the fruit endocarp. The lignified endocarp in peach can be susceptible to split-pit formation under certain genetic as well as environmental factors. This phenomenon delays processing of the clingstone varieties of peach and causes economical losses for the peach fruit canning industry. The fruitfull (FUL) and shatterproof (SHP) genes are key MADS-box transcription protein coding factors that control fruit development and dehiscence in arabidopsis by promoting the expression of basic helix-loop-helix (bHLH) transcription factors like Spatula (SPT) and Alcatraz (ALC). Results from our previous studies on peach suggested that temporal regulation of PPERFUL and PPERSHP gene expression may be involved in the regulation of endocarp margin development. In the present study a PPERSPATULA-like (PPERSPT) gene was cloned and characterized. Comparative analysis of temporal regulation of PPERSPT gene expression during pit hardening in a resistant and a susceptible to split-pit variety, suggests that this gene adds one more component to the genes network that controls endocarp margins development in peach. Taking into consideration that no ALC-like genes have been identified in any dicot plant species outside the Brassicaceae family, where arabidopsis belongs, PPERSPT may have additional role(s) in peach that are fulfilled in arabidopsis by ALC. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  17. Complete nucleotide sequences of two isolates of cherry green ring mottle virus from peach (Prunus persica) in China.

    Science.gov (United States)

    Wang, Lihui; Jiang, Dongmei; Niu, Feiqing; Lu, Meiguang; Wang, Hongqing; Li, Shifang

    2013-03-01

    Two complete nucleotide sequences of cherry green ring mottle virus (CGRMV) isolated from peach in Hebei (Hs10) and Fujian (F9) Provinces, China, were determined. Five open reading frames (ORFs) were found in the genomes of both isolates. The F9 and Hs10 isolates shared 82.2 % and 83.4-94.4 % nucleotide sequence identity, respectively, with two CGRMV isolates from cherry. Analysis of the nucleotide and amino acid sequences from the five ORFs of both isolates showed that Hs10 shares the greatest sequence identity with P1A (GenBank AJ291761) from cherry. Phylogenetic analysis indicated that CGRMV isolates from peach and cherry are closely related to members of the genus Foveavirus.

  18. Studies on enhancing the keeping quality of peach (Prunus persica Bausch) Cv. Elberta by gamma-irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Hussain, P.R.; Meena, R.S.; Dar, M.A. [Nuclear Research Laboratory, Bhabha Atomic Research Centre, Zakura, Srinagar-190006 (India); Wani, A.M. [Nuclear Research Laboratory, Bhabha Atomic Research Centre, Zakura, Srinagar-190006 (India)], E-mail: alimwani@yahoo.co.uk

    2008-04-15

    The effect of gamma-irradiation on keeping quality of peach fruit was studied. The fruit, after harvesting at proper maturity stage, was irradiated in the dose range of 1.0-2.0 kGy, stored under ambient (temp. 25{+-}2 deg. C, RH 70%) and refrigerated (temp. 3{+-}1 deg. C, RH 80%) conditions and evaluated periodically for firmness, total soluble solids (TSS), anthocyanins, water-soluble pectic fractions, loss in weight and decay percentage. The anthocyanin evaluation of the fruits revealed that irradiation enhanced the colour development under both the storage conditions. The gamma-irradiation dose range of 1.2-1.4 kGy proved effective in maintaining higher TSS concentration, reducing weight loss and significantly (p{<=}0.05) delaying the decaying of the fruit by 6 days under ambient conditions and by 20 days under refrigerated storage conditions.

  19. The Impact of Maturity Stage on Cell Membrane Integrity and Enzymatic Browning Reactions in High Pressure Processed Peaches (Prunus persica).

    Science.gov (United States)

    Techakanon, Chukwan; Gradziel, Thomas M; Zhang, Lu; Barrett, Diane M

    2016-09-28

    Fruit maturity is an important factor associated with final product quality, and it may have an effect on the level of browning in peaches that are high pressure processed (HPP). Peaches from three different maturities, as determined by firmness (M1 = 50-55 N, M2 = 35-40 N, and M3 = 15-20 N), were subjected to pressure levels at 0.1, 200, and 400 MPa for 10 min. The damage from HPP treatment results in loss of fruit integrity and the development of browning during storage. Increasing pressure levels of HPP treatment resulted in greater damage, particularly in the more mature peaches, as determined by shifts in transverse relaxation time (T2) of the vacuolar component and by light microscopy. The discoloration of peach slices of different maturities processed at the same pressure was comparable, indicating that the effect of pressure level is greater than that of maturity in the development of browning.

  20. Gamma irradiation induced enhancement of phenylalanine ammonia-lyase (PAL) and antioxidant activity in peach (Prunus persica Bausch, Cv. Elberta)

    Energy Technology Data Exchange (ETDEWEB)

    Hussain, Peerzada R., E-mail: hussainpr@rediffmail.co [Nuclear Research Laboratory, Bhabha Atomic Research Centre, Zakura, Srinagar 190006, Kashmir (India); Wani, Ali M.; Meena, Raghuveer S.; Dar, Mohd A. [Nuclear Research Laboratory, Bhabha Atomic Research Centre, Zakura, Srinagar 190006, Kashmir (India)

    2010-09-15

    Effect of medium dose gamma irradiation on PAL and antioxidant activity of peach fruit was investigated. Peach fruit after harvest at commercial maturity was irradiated in the dose range 1.0-2.0 kGy, stored under refrigerated conditions (3{+-}1 {sup o}C, RH 80%) and evaluated at intervals of 7 days. The antioxidant activity as determined by DPPH and FRAP methods revealed significant (p{<=}0.05) increase particularly in the dose range 1.6-2.0 kGy. During storage, maximum increase in both PAL and antioxidant activity was observed after 21 days. Positive correlation (r=0.75) existed between antioxidant activity and total phenols. EC{sub 50} values as obtained from DPPH and FRAP experiments were significantly (p{<=}0.05) lower in irradiated fruits compared to control.

  1. Responses of canopy transpiration and canopy conductance of peach (Prunus persica) trees to alternate partial root zone drip irrigation

    Science.gov (United States)

    Gong, Daozhi; Kang, Shaozhong; Zhang, Jianhua

    2005-08-01

    We investigated canopy transpiration and canopy conductance of peach trees under three irrigation patterns: fixed 1/2 partial root zone drip irrigation (FPRDI), alternate 1/2 partial root zone drip irrigation (APRDI) and full root zone drip irrigation (FDI). Canopy transpiration was measured using heat pulse sensors, and canopy conductance was calculated using the Jarvis model and the inversion of the Penman-Monteith equation. Results showed that the transpiration rate and canopy conductance in FPRDI and APRDI were smaller than those in FDI. More significantly, the total irrigation amount was greatly reduced, by 34.7% and 39.6%, respectively for APRDI and FPRDI in the PRDI (partial root zone drip irrigation) treatment period. The daily transpiration was linearly related to the reference evapotranspiration in the three treatments, but daily transpiration of FDI is more than that of APRDI and FPRDI under the same evaporation demand, suggesting a restriction of transpiration water loss in the APRDI and FPRDI trees. FDI needed a higher soil water content to carry the same amount of transpiration as the APRDI and FPRDI trees, suggesting the hydraulic conductance of roots of APRDI and FPRDI trees was enhanced, and the roots had a greater water uptake than in FDI when the average soil water content in the root zone was the same. By a comparison between the transpiration rates predicted by the Penman-Monteith equation and the measured canopy transpiration rates for 60 days during the experimental period, an excellent correlation along the 1:1 line was found for all the treatments (R2 > 0.80), proving the reliability of the methodology.

  2. Acyl-CoA oxidase 1 is involved in γ-decalactone release from peach (Prunus persica) fruit.

    Science.gov (United States)

    Zhang, Liping; Li, Haiyan; Gao, Ling; Qi, Yujie; Fu, Wanyi; Li, Xiongwei; Zhou, Xiang; Gao, Qikang; Gao, Zhongshan; Jia, Huijuan

    2017-06-01

    γ-Decalactone accumulation in peach mesocarp was highly correlated with ACX enzyme activity and natural PpACX1 content. Adding the purified recombinant PpACX1 induced γ-decalactone biosynthesis in cultured mesocarp discs in vitro. Previous gene expression studies have implied that acyl coenzyme A oxidase (ACX) is related to lactones synthesis, the characteristic aroma compounds of peach. Here, we analysed the correlation between γ-decalactone content and ACX enzyme activity in mesocarp of five different types of fully ripe peach varieties. Furthermore, 'Hu Jing Mi Lu' ('HJ') and 'Feng Hua Yu Lu' ('YL'), which have strong aroma among them, at four ripening stages were selected to study the role of ACX in lactone biosynthesis. The result showed that γ-decalactone was the most abundant lactone compound. γ-Decalactone accumulation was highly correlated with ACX enzyme activity. Mass spectrometry (MS) showed that PpACX1 was the most abundant PpACX protein in fully ripe mesocarp of cv. 'HJ'. To further elucidate the function of the PpACX1 protein, the PpACX1 gene was heterologously expressed in a bacterial system and characterized in vitro. MS identification gave the molecular weight of the recombinant PpACX1 as 94.44 kDa and the coverage rate of the peptide segments was 47.3%. In cultured mesocarp discs in vitro, adding the purified recombinant PpACX1 and C16-CoA substrate induced the expected γ-decalactone biosynthesis. Using a sandwich ELISA based on mixed mono- and polyclonal antibodies against recombinant PpACX1, PpACX1 content in mesocarp was found to be highly correlated with γ-decalactone accumulation in mesocarp of five fully ripe varieties and four ripening stages of 'HJ' and 'YL'. This study revealed the vital function of PpACX1 in γ-decalactone biosynthesis in peach fruit.

  3. Transcriptomic analysis of fruit stored under cold conditions using controlled atmosphere in Prunus persica cv. ‘Red Pearl’

    Directory of Open Access Journals (Sweden)

    Dayan eSanhueza

    2015-09-01

    Full Text Available Cold storage (CS can induce a physiological disorder known as chilling injury (CI in nectarine fruits. The main symptom is mealiness that is perceived as non-juicy fruit by consumers. Postharvest treatments such as controlled atmosphere (CA; a high CO2 concentration and low O2 have been used under cold conditions to avoid this disorder. With the objective of exploring the mechanisms involved in the CA effect on mealiness prevention, we analyzed transcriptomic changes under six conditions of ‘Red Pearl’ nectarines by RNA-Seq. Our analysis included just harvested nectarines, juicy non-stored fruits, fruits affected for CI after CS and fruits stored in a combination of CA plus CS without CI phenotype. Nectarines stored in cold conditions combined with CA treatment resulted in less mealiness; we obtained 21.6% of juice content compared with just CS fruits (7.7%; mealy flesh. RNA-Seq data analyses were carried out to study the gene expression for different conditions assayed. During ripening, we detected that nectarines exposed to CA treatment expressed a similar number of genes compared with fruits that were not exposed to cold conditions. Firm fruits have more differentially expressed genes than soft fruits, which suggest that most important changes occur during CS. On the other hand, gene ontology analysis revealed enrichment mainly in metabolic and cellular processes. Differentially expressed genes analysis showed that low O2 concentrations combined with cold conditions slows the metabolic processes more than just the cold storage, resulting mainly in the suppression of primary metabolism and cold stress response. This is a significant step toward unraveling the molecular mechanism that explains the effectiveness of CA as a tool to prevent CI development on fruits.

  4. Dehydrogenase isoenzyme polymorphism in genus Prunus, subgenus Cerasus

    Directory of Open Access Journals (Sweden)

    Čolić Slavica

    2012-01-01

    Full Text Available Dehydrogenase polymorphism was studied in 36 sour cherry (Prunus cerasus L., sweet cherry (Prunus avuim L., mahaleb (Prunus mahaleb L., ground cherry (Prunus fruticosa Pall., duke cherry (Prunus gondounii Redh., Japanese flowering cherry (Prunus serrulata Lindl. and four iterspecific hybrids (standard cherry rootstocks ‘Gisela 5’, ‘Gisela 6’, ‘Max Ma’ and ‘Colt’. Inner bark of one-year-old shoots, in dormant stage, was used for enzyme extraction. Vertical PAGE was used for isoenzyme analysis: alcohol dehydrogenase (ADH, formate dehydrogenase (FDH, glutamate dehydrogenase (GDH, isocitrate dehydrogenaze (IDH, malate dehydrogenase (MDH, phosphogluconate dehydrogenase (PGD, and shikimate dehydrogenase (SDH. All studied systems were polymorphic at 10 loci: Adh -1 (3 genotypes and Adh-2 (5 genotypes, Fdh-1 (2 genotypes, Gdh-1 (3 genotypes, Idh-1 (4 genotypes i Idh -2 (5 genotypes, Mdh-1 (3 genotypes, Pgd-1 (4 genotypes, Sdh-1 (1 genotype i Sdh-2 (3 genotypes. Cluster analysis was used to construct dendrogram on which four groups of similar genotypes were separated. Obtained results indicate that studied enzyme systems can be used for determination of genus Prunus, subgenus Cerasus. Among studied enzyme systems ADH, IDH and SDH were the most polymorphic and most useful to identify genetic variability. Polymorphism of FDH and GDH in genus Prunus, subgenus Cerasus was described first time in this work. First results for dehydrogenase variability of Oblačinska indicate that polymorphism of loci Idh-2 and Sdh-2 can be useful for discrimination of different clones.

  5. Phenology and reproductive traits of peaches and nectarines in Central-East Argentina

    OpenAIRE

    Norberto Francisco Gariglio; Marisa Mendow; Marcela Emilce Weber; María Alejandra Favaro; Diego Esteban González-Rossia; Rubén Andrés Pilatti

    2009-01-01

    In Santa Fe, the central-east area of Argentina, the expansion of fruit tree crops requires the introduction and evaluation of low chilling varieties. The aims of this study was to characterize the phenological behaviour and the reproductive traits of peach (Prunus persica L. Batsch) and nectarine varieties with chilling requirements ranging from 150 to 650 chilling hours (CH). Low chilling varieties (< 450 CH) had higher flower density (22.0-56.5 flowers m-1), fruit set (26.0-56.7%), fruit y...

  6. Influencia de las coberturas vegetales sobre el comportamiento del cultivo del duraznero y sobre los atributos del suelo

    OpenAIRE

    Ciacci, María Belén

    2014-01-01

    Las coberturas vegetales se caracterizan por tener multi-propósitos, las cuales incluyen la conservación del suelo y del agua. Se pretendió obtener información del aporte de las coberturas vegetales sobre la evolución de la materia orgánica, el estado hídrico y diferentes indicadores físicos del suelo, y sobre el comportamiento vegetativo y reproductivo del duraznero (Prunus persica L. Batsch) en la zona sur de Mendoza (San Rafael). Se utilizaron plantas de la variedad Cristalino de 14 años d...

  7. Postharvest Sensory and Phenolic Characterization of ‘Elegant Lady’ and ‘Carson’ Peaches Caracterización Fenólica y Sensorial en Poscosecha de Duraznos ‘Elegant Lady’ y ‘Carson’

    OpenAIRE

    Rodrigo Infante; Loreto Contador; Pía Rubio; Danilo Aros; Álvaro Peña-Neira

    2011-01-01

    High quality fruits are increasingly demanded along with the need to ensure this attribute to consumers. Thus, this study was aimed at characterizing a melting (‘Elegant Lady’) and a non-melting flesh (‘Carson’) peach (Prunus persica (L.) Batsch) varieties by considering both their bioactive compound contribution and their sensory quality in ripe fruit at harvest and after a prolonged period of cold storage. Cultivars were evaluated at harvest (F0) and after 30 d of cold storage (F30), as wel...

  8. Numerical Discrimination of Persicae Semen and Armeniacae Semen

    OpenAIRE

    TADATO, TANI; TADAHISA, KATSUKI; MICHINORI, KUBO; SHIGERU, ARICHI; The Research Institute of Oriental Medicine, Kinki University

    1986-01-01

    Multivariate analysis of the eight numerical characteristics (weight, three ratios of length, width, thickness, and angle of the pointed end and the three color characteristics of the seed coat) of commercially available Persicae Semen and Armeniacae Semen (eleven samples, each) was performed to identify their original plant species. It was found that by means of principal component analysis, the first principal component consisting of shape factors is considered to have discriminatory value ...

  9. Pengaruh Larutan Kumur Ekstrak Siwak (Salvadora Persica) Terhadap Ph Saliva

    OpenAIRE

    Kusumasari, Nila; Santoso, Oedijani

    2012-01-01

    Latar belakang : pH saliva merupakan salah satu komponen yang memberikan kontribusi terhadap pH mulut. Bakteri patogen dalam rongga mulut memfermentasi gula menjadi asam laktat yang akan menurunkan keasaman mulutsehingga menyebabkan demineralisasi email gigi. Untuk mencegah penurunan pH saliva dapat dilakukan secara kimiawi. Pada penelitian ini digunakan larutan ekstrak siwak (Salvadora persica) sebagai obat kumur karena terdapat fitokemikal yang mampu mencegah penurunan pH saliva dengan cara...

  10. Effectiveness of Salvadora persica extracts against common oral pathogens.

    Science.gov (United States)

    Balto, Hanan; Al-Sanie, Ibrahim; Al-Beshri, Sultan; Aldrees, Abdullah

    2017-01-01

    The purpose of this study was to evaluate the antibacterial activity of ethanol and hexane extracts of Salvadora persica against common oral pathogens. Well diffusion, Minimum Inhibition Concentration (MIC), Minimum Bactericidal Concentration (MBC), and Broth microdilution tests were used to determine the optimum antimicrobial concentrations of S. persica extracts against Streptococcus mutans (S. mutans), Streptococcus sanguis (S. sanguis), and Streptococcus salivarius (S. salivarius) over 1, 3, 6, 12, and 24 h. Chlorhexidine (CHX) 0.2% was used as a positive control. The findings showed that the microbial activity of both extracts was concentration-dependent. Ethanol extract of S. persica at 25, 50, and 100 mg/ml had more growth inhibitory effect against all isolates compared to hexane extract. In addition, ethanol extract at 8 mg/ml (MBC value) was able to eradicate the growth of all isolates. S. sanguis and S. salivarius were very sensitive to hexane extract and required 4 mg/ml (MBC value) for their eradication while S. mutans was the most resistant (MBC = 8 mg/ml).The statistical findings of CFU counts showed no significant difference (p = 1.000) in antibacterial effectiveness between the two extracts against all isolates. A significant decline overtime in CFU counts was noted, except at 12 h and 24 h where no significant difference (p = 0.793) was observed and was comparable to CHX. Ethanol and hexane extracts of S. persica were found to exhibit maximum antimicrobial activity against S. mutans, S. sanguis and S. salivarius at high concentrations.

  11. Host Plant Resistance to Green Peach Aphid, Myzus persicae (Sulzar), by Some Wild Types of Watermelon

    Science.gov (United States)

    The green peach aphid, Myzus persicae (Sulzar), is an important pest of many vegetable crops. It damages crops by feeding and vectoring viruses. Potential sources of plant resistance against M. persicae were examined for watermelon. A multiple choice experiment was conducted with leaves of six wi...

  12. Gene flow in Prunus species in the context of novel trait risk assessment.

    Science.gov (United States)

    Cici, S Zahra H; Van Acker, Rene C

    2010-01-01

    Prunus species are important commercial fruit (plums, apricot, peach and cherries), nut (almond) and ornamental trees cultivated broadly worldwide. This review compiles information from available literature on Prunus species in regard to gene flow and hybridization within this complex of species. The review serves as a resource for environmental risk assessment related to pollen mediated gene flow and the release of transgenic Prunus. It reveals that Prunus species, especially plums and cherries show high potential for transgene flow. A range of characteristics including; genetic diversity, genetic bridging capacity, inter- and intra-specific genetic compatibility, self sterility (in most species), high frequency of open pollination, insect assisted pollination, perennial nature, complex phenotypic architecture (canopy height, heterogeneous crown, number of flowers produced in an individual plant), tendency to escape from cultivation, and the existence of ornamental and road side Prunus species suggest that there is a tremendous and complicated ability for pollen mediated gene movement among Prunus species. Ploidy differences among Prunus species do not necessarily provide genetic segregation. The characteristics of Prunu s species highlight the complexity of maintaining coexistence between GM and non-GM Prunus if there were commercial production of GM Prunus species. The results of this review suggest that the commercialization of one GM Prunus species can create coexistence issues for commercial non-GM Prunus production. Despite advances in molecular markers and genetic analysis in agroecology, there remains limited information on the ecological diversity, metapopulation nature, population dynamics, and direct measures of gene flow among different subgenera represented in the Prunus genus. Robust environmental impact, biosafety and coexistence assessments for GM Prunus species will require better understanding of the mechanisms of gene flow and hybridization

  13. Chemical composition and antiprolifrative activity of Artemisia persica Boiss. and Artemisia turcomanica Gand. essential oils.

    Science.gov (United States)

    Nikbakht, M R; Sharifi, S; Emami, S A; Khodaie, L

    2014-01-01

    Essential oils obtained from aerial parts of Artemisia persica and Artemisia turcomanica were analyzed by GC/MS. While 28 components representing 91.01 % of A. persica were identified, the identity of 50 components, constituting 81.93 % of the total oil, was confirmed in A. turcomanica. β-thujone was the main compound (75.23%) in A. persica while the major identified phytochemicals in A. turcomanica were 1,8-cineol (19.23%), camphor (15.55%) and filifolone (15.53%). Both of the essential oils were predominantly made up of monoterpenes. Time- and dose-dependent cytotoxic effects of A. persica and A. turcomanica on MCF-7 cell line evaluated by MTT assay at 24, 48 and 72 h, showed that the highest cytotoxic effect of A. persica and A. turcomanica were appeared at 72 h incubation. At that incubation period, CI50 of A. persica was found to be 0.15 μg/ml, while that of A. turcomanica was 0.1 μg/ml. Thus, cytotoxicity of A. turcomanica was slightly higher than A. persica which could be attributed to the higher content of sesquiterpene present in A. turcomanica. As a conclusion, these volatile oils could have chemotherapeutic potentials.

  14. Chemical composition and antiprolifrative activity of Artemisia persica Boiss. and Artemisia turcomanica Gand. essential oils

    Science.gov (United States)

    Nikbakht, M.R.; Sharifi, S.; Emami, S.A.; Khodaie, L.

    2014-01-01

    Essential oils obtained from aerial parts of Artemisia persica and Artemisia turcomanica were analyzed by GC/MS. While 28 components representing 91.01 % of A. persica were identified, the identity of 50 components, constituting 81.93 % of the total oil, was confirmed in A. turcomanica. β-thujone was the main compound (75.23%) in A. persica while the major identified phytochemicals in A. turcomanica were 1,8-cineol (19.23%), camphor (15.55%) and filifolone (15.53%). Both of the essential oils were predominantly made up of monoterpenes. Time- and dose-dependent cytotoxic effects of A. persica and A. turcomanica on MCF-7 cell line evaluated by MTT assay at 24, 48 and 72 h, showed that the highest cytotoxic effect of A. persica and A. turcomanica were appeared at 72 h incubation. At that incubation period, CI50 of A. persica was found to be 0.15 μg/ml, while that of A. turcomanica was 0.1 μg/ml. Thus, cytotoxicity of A. turcomanica was slightly higher than A. persica which could be attributed to the higher content of sesquiterpene present in A. turcomanica. As a conclusion, these volatile oils could have chemotherapeutic potentials. PMID:25657784

  15. Vasorelaxant effect of Prunus yedoensis bark

    Directory of Open Access Journals (Sweden)

    Lee Kyungjin

    2013-02-01

    Full Text Available Abstract Background Prunus yedoensis Matsum. is used as traditional medicine—‘Yaeng-Pi’ or ‘Hua-Pi’—in Japan and Korea. However, no studies have examined the pharmacological activities of the P. yedoensis bark. Only the antioxidant and antiviral activities of P. yedoensis fruit and the anti-hyperglycaemic effect of P. yedoensis leaf have been investigated. While studying the antihypertensive effects of several medicinal plants, we found that a methanol extract of P. yedoensis bark (MEPY had distinct vasorelaxant effects on rat aortic rings. Methods The aortic rings were removed from Sprague–Dawley rats and suspended in organ chambers containing 10 ml Krebs-Henseleit solution. The aortic rings were placed between 2 tungsten stirrups and connected to an isometric force transducer. Changes in tension were recorded via isometric transducers connected to a data acquisition system. Results MEPY relaxed the contraction induced by phenylephrine (PE both in endothelium-intact and endothelium-denuded aortic rings concentration dependently. However, the vasorelaxant effects of MEPY on endothelium-denuded aortic rings were lower than endothelium-intact aortic rings. The vasorelaxant effects of MEPY on endothelium-intact aortic rings were reduced by pre-treatment with l-NAME, methylene blue, or ODQ. However, pre-treatment with indomethacin, atropine, glibenclamide, tetraethylammonium, or 4-aminopyridine had no affection. In addition, MEPY inhibited the contraction induced by extracellular Ca2+ in endothelium-denuded rat thoracic aorta rings pre-contracted by PE (1 μM or KCl (60 mM in Ca2+-free solution. Conclusions Our results suggest that MEPY exerts its vasorelaxant effects via the activation of NO formation by means of l-Arg and NO-cGMP pathways and via the blockage of extracellular Ca2+ channels.

  16. Enraizamento in vitro de porta-enxertos de Prunus In vitro rooting of Prunus rootstocks

    Directory of Open Access Journals (Sweden)

    Marcelo Rogalski

    2003-08-01

    Full Text Available Na micropropagação de Prunus sp., o enraizamento tem sido considerado uma fase crítica, pois determina a sobrevivência das plantas durante a aclimatização. Dentre os fatores importantes ao enraizamento in vitro, destacam-se o genótipo e as auxinas por serem determinantes na indução e na formação de raízes. O objetivo deste trabalho foi avaliar o efeito de diferentes concentrações de IBA no enraizamento in vitro dos porta-enxertos de espécies do gênero Prunus: cultivares Capdeboscq e GF677, e seleções VP411 e VP417. Para o enraizamento in vitro, brotos com 2-3cm de comprimento foram introduzidos em meio de Lepoivre suplementado com 0,1; 0,5; 1,0 e 2,0 mg.L-1 IBA. Observou-se que o porta-enxerto 'Capdeboscq' apresentou maior taxa de enraizamento e maior número de raízes in vitro, sendo superior aos demais genótipos quanto a estas características. O nível de 1,0 mg.L-1 de IBA esteve associado à maior taxa média de enraizamento (100%, 64% e 64,0%, respectivamente para os porta-enxertos 'Capdeboscq', 'GF677' e VP411. O nível de 2,0 mg.L-1 de IBA foi superior para a seleção VP417 com taxa de 64% de enraizamento. Para os porta-enxertos 'Capdeboscq' e 'GF677', o número máximo de raízes foi de 9,6 e 5,2 raízes por broto, respectivamente, em resposta ao nível de 2,0 mg.L-1 de IBA, enquanto as seleções VP411 e VP417 apresentaram o maior número de raízes (3,6 e 3,9, respectivamente em resposta ao nível de 1,0 mg.L-1 de IBA.In Prunus sp. micropropagation of rooting is considered a critical stage, since it determines the plant survival during the acclimatization. Among important factors associated with rooting, the genotype and the auxins are considered important in the induction and formation of roots. The objective of the present work was to evaluate the effect of different IBA on the in vitro rooting of Prunus rootstocks Capdeboscq and GF677, and the selections VP411 and VP417. For the in vitro rooting stage, shoots of

  17. Otostegia persica extraction on healing process of burn wounds

    Directory of Open Access Journals (Sweden)

    Amin Ganjali

    2013-06-01

    Full Text Available PURPOSE: To investigate if the methanolic extract of the Otostegia persica can accelerating healing process of burn wound because of its anti-inflammatory and antioxidant effects. METHODS:Forty eight male Wistar rats were randomized into three study groups of 16 rats each. Burn wounds were created on dorsal part of shaved rats using a metal rod. In group I the burn wound was left without any treatment. Group was treated with topical silver sulfadiazine pomade. In group III, ointment containing the OP extract was administered. Skin biopsies were harvested from burn area on the 3rd, 5th, 14th and 21st days after burn and examined histologically. RESULTS: Re-epithelialization in the control group and in group II was lower than in group III. Re-epithelialization in groups II and III was significantly different from that in the control group. On the 5th day of the experiment, we assessed lower inflammation in the burn area compared to control group. This means that the inflammation was suppressed by methanolic extract of OP. From day 5 to 14; the fibroblast proliferation peaked and was associated with increased collagen accumulation. It was obvious that angiogenesis improved more in the groups II and III, which facilitated re-epithelialisation. CONCLUSION:Methanolic extract of Otostegia persica exhibited significant healing activity when topically applied on rats. OP is an effective treatment for saving the burn site.

  18. A molecular phylogeny of selected species of genus Prunus L ...

    African Journals Online (AJOL)

    USER

    2010-08-02

    Aug 2, 2010 ... For the out groups, Sorbaria sorbifolia and Spiraea canto- niensis, were selected which have been proposed as the sister to Prunus in past studies e.g. Spiraea and Sorbaria which were supported by data from PGIP and Mat-K, separately and combined (Potter et al., 1999). ITS analysis. The aligned ITS ...

  19. Molecular characterization of the plum collection [Prunus domestica ...

    African Journals Online (AJOL)

    Eight Random Amplified Microsatellite markers (RAMs) were used to characterize the genetic diversity found in 14 Prunus materials belonging to the deciduous collection of the Pedagogical and Technological University of Colombia. A total of 121 bands were generated: they range from nine for the GT primer to 26 for the ...

  20. Novel Phaeoacremonium species associated with necrotic wood of Prunus trees

    NARCIS (Netherlands)

    Damm, U.; Mostert, L.; Crous, P.W.; Fourie, P.H.

    2008-01-01

    The genus Phaeoacremonium is associated with opportunistic human infections, as well as stunted growth and die-back of various woody hosts, especially grapevines. In this study, Phaeoacremonium species were isolated from necrotic woody tissue of Prunus spp. (plum, peach, nectarine and apricot) from

  1. A molecular phylogeny of selected species of genus Prunus L ...

    African Journals Online (AJOL)

    Prunus is found in all four provinces of Pakistan, that is, Punjab, NWFP, Sindh and Baluchistan including Azad Kashmir region. Studies on the family Rosaceae is scanty in the Flora of Pakistan and there is a lot of taxonomic work yet to be done, for the proper classification and placement of different genera under different ...

  2. ( Prunus avium L.) as affected by training system

    African Journals Online (AJOL)

    Modern intensive production of sweet cherry (Prunus avium L.) tends to planting of high quality cultivars on the dwarfing rootstocks in high density orchards. The most productive training system is used, providing an ideal condition for undisturbed growth and yield. The main objective of this study was to determine the best ...

  3. Cryopreservation of in vitro -grown shoot tips of apricot ( Prunus ...

    African Journals Online (AJOL)

    In vitro grown apricot (Prunus armeniaca L.) cv. El-Hamawey shoot tips were successfully cryopreserved using an encapsulation-dehydration procedure. Shoot tips were encapsulated in calcium-alginate beads before preculture on woody plant (WP) medium supplemented with different sucrose concentrations; 0.1, 0.3, 0.5, ...

  4. Agrobacterium-mediated genetic transformation of Prunus salicina

    Science.gov (United States)

    We report Agrobacterium tumefaciens-mediated transformation from hypocotyls slices of two Prunus salicina varieties, 'Angeleno' and 'Larry Anne', using a modification of the technique previously described for P. domestica. Regeneration rates on thidiazuron (TDZ) and indole-3-butyric acid (IBA) supp...

  5. Kweker kan zelf toetsen op Xanthomonas in Prunus

    NARCIS (Netherlands)

    Doorn, van J.; Martin, W.S.; Kuik, van A.J.; Beckhoven, van J.R.C.M.; Raaij, van H.M.G.

    2011-01-01

    Prime Diagnostics uit Wageningen heeft een methode ontwikkeld waarmee kwekers eenvoudig kunnen bepalen of Prunus is aangetast door de bacterie Xanthomonas arboricola pv pruni. Voor een officiële uitslag is nog steeds wel een test uitgevoerd door de nVWA of Naktuinbouw nodig.

  6. Slaat Xanthomonas dit jaar weer toe in Prunus laurocerasus

    NARCIS (Netherlands)

    Doorn, van J.; Dalfsen, van P.; Pham, K.T.K.

    2012-01-01

    Een diagnostische test moet duidelijk maken of er sprake is van Xanthomonas in Prunus laurocerasus. De bacterieziekte is namelijk makkelijk te verwarren met andere ziekten. Onderzoek, gefinancierd door het Productschap Tuinbouw, richt zich op het toetsen van moerplanten voordat hier van gestekt gaat

  7. Procyanidins in fruit from Sour cherry (Prunus cerasus) differ strongly in chainlength from those in Laurel cherry (Prunus lauracerasus) and Cornelian cherry (Cornus mas)

    NARCIS (Netherlands)

    Capanoglu, E.; Boyacioglu, D.; Vos, de R.C.H.; Hall, R.D.; Beekwilder, M.J.

    2011-01-01

    Sour cherry (Prunus cerasus), Laurel cherry (Prunus lauracerasus), and Cornelian cherry (Cornus mas) fruits are widely used in Turkey, both as food and as traditional medicines. The phytochemical composition and antioxidant capacities of these three cherry types were compared. Fruit flesh was

  8. Differential protein expression in the susceptible and resistant Myzus persicae (Sulzer) to imidacloprid.

    Science.gov (United States)

    Meng, JianYu; Zhang, ChangYu; Chen, XingJiang; Cao, Yi; Shang, ShengHua

    2014-10-01

    Myzus persicae, a serious economic agricultural pest, has developed resistance to imidacloprid (IMI), which was widely used to control this aphid worldwide. To gain a better understanding of the mechanisms of IMI resistance in M. persicae, we carried out a comparative proteomic analysis. Total proteins of the IMI-susceptible and resistant strains were extracted and separated by two-dimensional gel electrophoresis. More than 1300 protein spots were reproducibly detected, including 14 that were more abundant and 14 less abundant. Mass spectrometry analysis and database searching helped us to identify 25 differentially abundant proteins. The identified proteins were categorized into several functional groups including signal transduction, RNA processing, protein processing, transport processing, stress response, metabolisms, and cytoskeleton structure, etc. This study is the first analysis of differentially expressed proteins in IMI-susceptible and resistant M. Persicae, and gives new insights into the mechanisms of IMI resistance in M. persicae. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. Efeito do comprimento de estacas herbáceas de dois clones de umezeiro (Prunus mume Sieb & Zucc. no enraizamento adventício Effect of the length of herbaceous cuttings of two clones of japanese apricot (Prunus mume Sieb & Zucc. in adventicious rooting

    Directory of Open Access Journals (Sweden)

    NEWTON ALEX MAYER

    2002-08-01

    Full Text Available O umezeiro (Prunus mumeSieb & Zucc. é uma rosácea de folhas caducas, nativa da China, cujos frutos e flores são muito apreciados pelos povos orientais. No Brasil, alguns estudos foram realizados visando a sua utilização como porta-enxerto para pessegueiro e nectarineira, dadas as suas características de adaptação, rusticidade, redução do porte da planta e compatibilidade com algumas cultivares de Prunus persica. O presente estudo foi conduzido em câmara de nebulização sob ripado, pertencente ao Departamento de Produção Vegetal da FCAV/UNESP, Câmpus de Jaboticabal-SP. Objetivou-se verificar a influência de quatro comprimentos de estacas herbáceas no enraizamento de dois clones de umezeiro. O material vegetal, identificado como Clone 10 e Clone 15, foi oriundo do Programa de Melhoramento Genético do Instituto Agronômico de Campinas-SP. O experimento foi constituido de fatorial 2 x 4, em blocos casualizados, sendo o fator clone em 2 níveis (Clone 10 e Clone 15 e o fator comprimento de estaca em 4 níveis (12; 15; 18 e 25cm. Pelos resultados observados, verificou-se diferença entre os clones somente na porcentagem de estacas brotadas e número de raízes por estaca. O comprimento da estaca influenciou na porcentagem de enraizamento e na mortalidade das estacas, sendo que estacas maiores tenderam a apresentar maiores porcentagens de enraizamento e menores de mortalidade. As estacas com 12cm, embora apresentando menor número de raízes por estaca, são recomendadas por permitirem a obtenção de um maior número de estacas por planta-matriz. Houve efeito significativo da interação entre os fatores para número e comprimento de raízes.The japanese apricot (Prunus mume Sieb & Zucc. is a Rosaceae of falling leaves, native of China, whose fruits and flowers are quite appreciated by the oriental people. In Brazil, some studies were accomplished seeking its use as rootstock for peach and nectarine trees, due its adaptation

  10. The occurrence of the cicada Cicadatra persica on apple trees, Malus domestica, in Erneh, Syria.

    Science.gov (United States)

    Dardar, Marah A; Belal, Hamzeh M R; Basheer, Abedlnabi M

    2013-01-01

    An infestation of Cicadatra persica KirKaldy (Hemiptera: Cicadidae) on apple trees, Malus domestica Borkhausen (Rosales: Rosaceae), was reported for the first time in the apple fruit orchards of Erneh, Syria. Nymphs, adults, exuvia, and exit holes in the soil were observed. The species was identified as C. persica based on morphological characters. Some biological observations and an acoustic analysis of the male's songs were also achieved.

  11. Genomic resources for Myzus persicae: EST sequencing, SNP identification, and microarray design

    Directory of Open Access Journals (Sweden)

    Malloch Gaynor

    2007-11-01

    Full Text Available Abstract Background The green peach aphid, Myzus persicae (Sulzer, is a world-wide insect pest capable of infesting more than 40 plant families, including many crop species. However, despite the significant damage inflicted by M. persicae in agricultural systems through direct feeding damage and by its ability to transmit plant viruses, limited genomic information is available for this species. Results Sequencing of 16 M. persicae cDNA libraries generated 26,669 expressed sequence tags (ESTs. Aphids for library construction were raised on Arabidopsis thaliana, Nicotiana benthamiana, Brassica oleracea, B. napus, and Physalis floridana (with and without Potato leafroll virus infection. The M. persicae cDNA libraries include ones made from sexual and asexual whole aphids, guts, heads, and salivary glands. In silico comparison of cDNA libraries identified aphid genes with tissue-specific expression patterns, and gene expression that is induced by feeding on Nicotiana benthamiana. Furthermore, 2423 genes that are novel to science and potentially aphid-specific were identified. Comparison of cDNA data from three aphid lineages identified single nucleotide polymorphisms that can be used as genetic markers and, in some cases, may represent functional differences in the protein products. In particular, non-conservative amino acid substitutions in a highly expressed gut protease may be of adaptive significance for M. persicae feeding on different host plants. The Agilent eArray platform was used to design an M. persicae oligonucleotide microarray representing over 10,000 unique genes. Conclusion New genomic resources have been developed for M. persicae, an agriculturally important insect pest. These include previously unknown sequence data, a collection of expressed genes, molecular markers, and a DNA microarray that can be used to study aphid gene expression. These resources will help elucidate the adaptations that allow M. persicae to develop compatible

  12. Use of Genetic Diversity of the Genus Prunus L. in Selection of Clonal Rootstocks for Stone Fruit Crops and Features of Their Reproduction

    Directory of Open Access Journals (Sweden)

    Eremin Gennadiy V.

    2017-06-01

    Full Text Available On the basis of diversity of wild types of the genus Prunus L. (P. cerasifera, P. armeniaca, P. persica, P. fruticosa, P. lannesiana, P. maackii, P. tomentosa, P. pumila, and P. incana in the collection of the Krymsk Experiment Breeding Station, highly adaptive, medium or weak vigour clonal rootstocks for stone fruit crops with good compatibility with grafted cultivars were selected: for plum, apricot and peach - Kuban 86, VVA-1, Evrika 99, Zarevo (Glow, Alab 1, Speaker, Best, VSV-1; and for sweet cherries and sour cherries - L-2, LC-52, VSL-1, VSL-2, and RVL-9. Part of the rootstocks were tested and successfully used in different parts of Russia and some near and far countries. The applied integration of tissue culture in vitro in the selection process at the station considerably promoted the rapid introduction of new rootstocks into world production. Technologies were developed for microclonal reproduction, and green and woody cuttings. The revealed light rooting of woody cuttings of stocks Kuban 86, Evrika 99, Zarevo, Best, VSL-1, RVL-9 (50-80% allowed to develop technology for growing of young plants on these rootstocks directly in the first field of the nursery.

  13. Life cycle variation of Myzus persicae (Hemiptera: Aphididae) in Greece.

    Science.gov (United States)

    Margaritopoulos, J T; Tsitsipis, J A; Goudoudaki, S; Blackman, R L

    2002-08-01

    During the years 1995-1999 the life cycle category of 2797 clones of Myzus persicae (Sulzer) was examined. The clones originated from primary and secondary hosts from different localities of North and Central Greece and the island of Crete in the south. Four different overwintering life cycle strategies were found that have also been described for M. persicae and other heteroecious species previously. A geographical variation was found in the proportion of holocyclic clones from tobacco and other secondary hosts associated with the abundance of the primary host in the sampling regions. In Central Macedonia, around the main peach-growing regions, the proportion of holocyclic clones was mostly above 50% and in some cases reached 100%. In localities of East Macedonia, holocyclic clones were also frequent. On the other hand, further south or in north-eastern Greece, where peach is not common, the proportion of holocyclic clones varied between 0 and 33%. Fifty seven percent of examined anholocyclic clones produced males under short day conditions, suggesting that androcyclic clones in Greece represent an important factor of genetic variability. Intermediate clones were sampled from all host-plants but at low frequencies (3.6% of total examined clones and 6.9% of non-holocyclic ones). Moreover, a regional variation was found in different colour forms feeding on tobacco plants. Red clones were predominant in regions where aphids overwinter parthenogenetically on weeds or winter crops. However, almost all clones from the primary host were green. The ecological aspects of life cycle variation are discussed.

  14. In vitro anti-biofilm activity of Quercus brantii subsp. persica on human pathogenic bacteria

    Directory of Open Access Journals (Sweden)

    Z. Bahar

    2017-01-01

    Full Text Available Background and objectives: Quercus brantii subsp. persica is used in folk medicine to treat infections in Iran. There is not available report on the anti-biofilm activity of Quercus brantii subsp.  persica. The aim of the present study was to investigate the effects of Quercus brantii subsp. persica against bacterial biofilms. Methods: Eighty biofilm producing strains of Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli and Pseudomonas aeruginosa were collected. Quercus brantii subsp. persica fruits aqueous extraction (QBAE was prepared though maceration method. Chemical analysis to distinguish the main components of the QBAE was carried out using thin-layer chromatography. The antibacterial effects of QBAE on bacterial isolates were determined by the Kirby-Bauer and broth microdilution methods. The antibiofilm effects of QBAE on bacterial isolates were determined using a microtiter assay. Results: The Quercus brantii subsp. persica exhibited bacterial growth inhibition and bactericidal activity on the majority of the strains at concentrations between 0.2 and 1.2 mg/mL. The average of biofilm formation inhibition by Quercus brantii subsp. persica at a minimum inhibitory concentration MIC50 in Pseudomonas aeruginosa, Escherichia coli, Staphylococcus epidermidis and Staphylococcus aureus strains were 35%, 45%, 57% and 61%, respectively. coumarins, phenols, terpenes and steroids were found in the QBAE by TLC. Conclusion: The results showed that Quercus brantii subsp. persica aqueous extraction was effective against the tested microorganisms and showed anti-biofilm activity which can be a basis for future studies to investigate for new anti-biofilm drugs.

  15. Susceptibility, Oviposition Preference, and Biology of Grapholita molesta (Lepidoptera: Tortricidae) in Prunus Spp. Rootstock Genotypes.

    Science.gov (United States)

    Bernardi, D; Lazzari, J C; Andreazza, F; Mayer, N A; Botton, M; Nava, D E

    2017-08-01

    Studying the susceptibility of peach trees to Grapholita molesta (Busck) is one of the major steps in the development of pest-resistant peach varieties. This work evaluated the susceptibility of 55 genotypes of the "Prunus Rootstock Collection" ("Coleção Porta-enxerto de Prunus") of Embrapa Temperate Climate (Pelotas, Rio Grande do Sul, Brazil) to the natural infestation of G. molesta, assessed the oviposition preference of G. molesta in choice and no-choice bioassays, and estimated the biological parameters and the fertility life table on different Prunus spp. genotypes in the laboratory. Genotypes Prunus kansuensis (Rehder), I-67-52-9, and I-67-52-4 were the most susceptible to G. molesta infestation in the field (>60% of branches infested), while 'Sharpe' (Prunus angustifolia x Prunus spp.) and Prunus sellowii (Koehne) were the least infested (0% of branches infested). In choice and no-choice bioassays, G. molesta preferred to oviposit on P. kansuensis when compared with Sharpe. The Sharpe genotype also showed an antibiosis effect, resulting in negative effects on the fertility life table parameters when compared with the genotypes P. kansuensis and 'Capdeboscq.' The results found in the present study can provide information to initiate a long-term breeding program moving desired G. molesta resistance traits from the rootstock into the Prunus spp. cultivars. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Genomic analysis reveals candidate genes for PPV resistance in apricot (Prunus armeniaca L.)

    Science.gov (United States)

    Sharka disease, caused by Plum pox virus (PPV), is the most important disease affecting Prunus species. A major PPV resistance locus (PPVres) was previously mapped to the upper part of apricot (Prunus armeniaca) linkage group 1. In this study, a physical map of the PPVres locus in the PPV resistan...

  17. Effects of mti-2 Transgenic Potato Plants on the Aphid Myzus persicae (Sternorrhyncha: Aphididae

    Directory of Open Access Journals (Sweden)

    Julien Saguez

    2010-01-01

    Full Text Available Overexpressed in transgenic plants, protease inhibitors showed insecticidal effects against several insect taxa. We transformed potato internodes with the mustard trypsin inhibitor mti-2 gene. Among the 35 independent transgenic potato lines obtained via Agrobacterium tumefasciens transformation, four (DM6, DM7, DM11, and DM19 were selected for their high level of MTI-2 (at least to 30% of trypsin activity inhibition. Feeding assays were carried out to evaluate their effects on the green-peach aphid, Myzus persicae (Sternorrhyncha: Aphididae. Prereproductive period, nymphal mortality, adult fecundity, and doubling time of M. persicae populations were monitored on nontransformed potato plants (NT and the four selected DM lines. Compared to NT plants, DM19 did not induce any effect on M. persicae. In contrast, DM7 and DM11 increased nymphal survival by approximately 20%. DM6 and DM11 lines slightly enhanced M. persicae daily fecundity and intrinsic rate of natural increase, leading to a reduction of the doubling time of the populations by 1 day. DM6 did not impact nymphal mortality, whereas with the DM11 almost all the nymphs survived. Potato plants transformed with the mti-2 gene variably affected the life history of M. persicae but did not show any insecticidal effect on the aphid.

  18. The morphological variation of Myzus persicae (Hemiptera: Aphididae from peach and tobacco in Serbia and Montenegro

    Directory of Open Access Journals (Sweden)

    Vučetić Anđa

    2010-01-01

    Full Text Available Multivariate morphometric analysis was used to compare nine characteristics of 47 populations of Myzus persicae (Sulzer originating from two host-plants, peach and tobacco, from 13 localities in 2004 and 34 localities in 2005, in Serbia and Montenegro. Multivariant discriminant analysis showed there to be a distinct discrimination between the populations from the peach and tobacco host-plants. The most important discrimination characteristics are the ultimate rostral segment length and processes terminalis length, which are greater in the aphids from tobacco than in those from peach. This is the first indication that in this part of Europe there are two subspecies: M. persicae (Sulzer and M. persicae nicotianae Blackman. .

  19. Determination of Resistance Levels of Myzus persicae (Sulzer by Biochemical Methods

    Directory of Open Access Journals (Sweden)

    Olivera Petrović-Obradović

    2007-01-01

    Full Text Available Peach/potato aphid Myzus persicae (Sulzer has developed three mechanisms of resistance: overproduction of one or two closely related carboxylesterases (E4 and FE4, production of modified acetylcholinesterase (MACE and knockdown resistance. Biochemicaldiagnostic methods can be used to identify levels of carboxylesterase production and sensitivity of modified acetylcholinesterase and, based on the values acquired we can classify aphids into one of the resistance cathegories. We used two tests: the total esterase activitytest and test for checking sensitivity of acetylcholinesterase (MACE. Myzus periscae persicae from peach and Myzus persicae nicotianae from tobacco were tested. The total esterase activity test showed that 65% of the aphids tested were moderately resistant and 35% were highly resistant. Resistance based on the production of modified acetylcholinesterase is less represented because 80% of the aphids tested were susceptible to pirimicarb, which was used in the experiment. Also, both tests showed that aphids from tobacco were more susceptible than aphids from peach.

  20. Sublethal Effects of Thiamethoxam on the Demographic Parameters of Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Wang, Pan; Zhou, Li-Lin; Yang, Fan; Li, Mang; Liu, Xiao-Ming; Wang, Yong; Lei, Chao-Liang; Si, Sheng-Yun

    2017-08-01

    The green peach aphid, Myzus persicae Sulzer (Hemiptera: Aphididae), is an important sap-sucking pest of many crops, including Chinese cabbage, Brassinca oleracea L. The neonicotinoid insecticide thiamethoxam has been used as an effective insecticide to control M. persicae in cabbage fields. In this study, we assessed the effects of sublethal concentrations of thiamethoxam on demographic parameters of M. persicae. In leaf-dip bioassays, thiamethoxam showed a relatively high toxicity against M. persicae with an LC50 of 6.80 mg liter-1. The duration of the preadult stage was not significantly affected in the sublethal bioassay. Additionally, the longevity and adult preoviposition period were not significantly affected by sublethal thiamethoxam. However, sublethal thiamethoxam significantly increased fecundity (LC10) and prolonged the total preoviposition period (LC40). Consequently, the finite rate of increase (λ) and the intrinsic rate of increase (rm) of aphids exposed to the LC40 were significantly lower than those of control aphids, whereas the net reproductive rate (R0) was higher, and the generation time (T) and the population doubling time (DT) were longer in the treated group. Based on these results, hormesis was induced by sublethal thiamethoxam in M. persicae, with the population growth of M. persicae negatively affected at higher sublethal concentrations of thiamethoxam. Therefore, our study indicated that the possible effects of thiamethoxam on aphids require further study to develop optimized integrated pest management strategies. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Desenvolvimento ninfal de Myzus persicae (Sulzer, 1776 (Hemiptera: Aphididae sobre berinjela em diferentes temperaturas Nymphal development of Myzus persicae (Sulzer, 1776 (Hemiptera: Aphididae on eggplant at different temperatures

    Directory of Open Access Journals (Sweden)

    Norton Rodrigues Chagas Filho

    2005-01-01

    Full Text Available Este trabalho teve como objetivo avaliar o efeito de diferentes temperaturas no desenvolvimento ninfal de Myzus persicae sobre folhas de berinjela (Solanum melongena. O experimento foi desenvolvido em câmaras climatizadas, sob condições controladas de temperatura de 15, 20, 25 e 30 ± 1 ºC, umidade relativa do ar de 70% ± 10% e fotofase de 12 horas. A biologia de M. persicae foi acompanhada sobre discos foliares de berinjela (3 cm de diâmetro mantidos em placas de Petri contendo solução ágar-água a 1% geleificada. Foram estimadas as curvas mais ajustadas à duração dos estádios ninfais de M. persicae, suas equações de regressão e os respectivos coeficientes de determinação (R². O número de estádios ninfais foi afetado pela temperatura; a 15 e 20 ºC, respectivamente, em 30,4% e 4,2% das ninfas observou-se um estádio adicional. Afídeos mantidos a 30 ºC apresentaram a menor viabilidade na fase ninfal (8%. A duração da fase ninfal foi de 9,4; 7,6; 5,9 e 7,0 dias, respectivamente, a 15, 20, 25 e 30 ºC. As temperaturas de 15 e 20 ºC foram as mais favoráveis para o desenvolvimento ninfal de M. persicae sobre discos de folha de berinjela.The objective of this work was to study the nymphal development of Myzus persicae on leaves of eggplant (Solanum melongena at four constant temperatures. The experiment was carried out in the bio-control laboratory, with the following controlled conditions: temperatures (15, 20, 25 and 30 ºC ± 1 ºC; relative humidity (70% ± 10%, and photophase (12 hours. The biology of M. persicae was followed on leaf discs (3 cm diameter kept in Petri dishes containing a layer of agar-water (1%. It was evaluated the best fitted curve to the biological aspects of M. persicae, as well as their regression equations and respective determination coefficients (R². The number of nymphal stage was affected by temperature: 15 and 20 ºC, resulted in 30.4% and 4.2% of nymphs showing an 5th nymphal stage

  2. A review of the traditional and modern uses of Salvadora persica L. (Miswak): Toothbrush tree of Prophet Muhammad.

    Science.gov (United States)

    Aumeeruddy, Muhammad Zakariyyah; Zengin, Gokhan; Mahomoodally, Mohamad Fawzi

    2018-03-01

    Salvadora persica L., also known as Arak (in Arabic) and Peelu (in Urdu), is the most common traditional source of tooth or chewing stick (miswak) highly recommended by Prophet Muhammad. To date, extensive studies have probed primarily into the validation of its traditional uses in oral care. Nonetheless, there is still a dearth of updated compilation and critical analysis of other potential ethnopharmacological properties of S. persica. This review therefore aims to provide an up-to-date detailed structured description of the traditional uses of S. persica and a critical analysis of its modern uses, highlighting its phytochemistry, pharmacological properties, and bioapplications. Various databases (Science Direct, PubMed, Wiley Online Library, and Google Scholar), books, and relevant primary sources were probed, surveyed, analysed, and included in this review. The literature cited in this review dated from 1979 to 2017. S. persica was found to possess a plethora of bioactive compounds and broad pharmacological properties, including antimicrobial, antioxidant, enzyme inhibitory activity, antiulcer, anticonvulsant, sedative, analgesic, anti-inflammatory, hypoglycemic, hypolipidemic, antiosteoporosis, and antitumor activities. Studies also revealed the potential use of S. persica as a natural food preservative and a novel functional food ingredient. In addition, improvement in growth and reproductive performances have been observed by the introduction of S. persica in animal feed. Lastly, S. persica has also been used in the green synthesis of nanoparticles showing potential biotechnological applications. S. persica showed a wide scope of application and its uses have been extended far beyond the initial traditional uses of its roots, stems, and twigs in oral care. We found a number of other ethnopharmacological uses and potential bioapplications of different parts of S. persica that warrants further investigations. Though widely studied using several in vitro and in

  3. Evaluación en pérdidas de durazno (Prunus persica variedad rubidoux en la granja experimental Tunguavita Paipa, Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Angela Johana Lemus Cerón

    2014-12-01

    Full Text Available Boyacá es un departamento colombiano con una posición geográfica privilegiada, cuya economía se basa principalmente en la producción agropecuaria; el durazno representa un renglón importante en la economía frutícola de Boyacá, sin embargo algunas prácticas culturales y de manejo de cultivos inadecuados han generado pérdidas graduales en el proceso productivo. A fin de comparar la producción en un huerto con extensión de 4 ha, distribuido en tres lotes de durazno variedad Rubidoux, en la granja experimental Tunguavita, municipio de Paipa, Boyacá, Colombia, se seleccionó una muestra aleatoria de 150 árboles frutales, marcados de acuerdo a la distribución del huerto de durazno, los datos recopilados en campo se tomaron con base en la producción y a variables de pérdida como número de frutos totales por árbol, frutos sobremaduros, frutos caídos por accidente, frutos aptos no cosechados, frutos desechados por daño. El análisis mostró que al obtener los 3 intervalos de diferencias en cuanto al límite superior e inferior, la producción es mayor en los lotes 1 y 2 respecto al lote 3, para las variables de pérdida el porcentaje fue del 14%, y los parámetros obtenidos, no presentaron diferencias estadísticas.

  4. Ectopic expression of a novel peach (Prunus persica) CBF transcription factor in apple (Malus × domestica) results in short-day induced dormancy and increased cold hardiness.

    Science.gov (United States)

    Wisniewski, Michael; Norelli, John; Bassett, Carole; Artlip, Timothy; Macarisin, Dumitru

    2011-05-01

    Low, non-freezing temperatures and/or short daylength (SD) regulates cold acclimation and dormancy in fruit trees. Regarding cold acclimation, C-repeat binding factor (CBF/DREB) transcriptional activator genes have the well-documented ability to induce the expression of a suite of genes associated with increased cold tolerance. We isolated a full-length cDNA of a peach CBF gene, designated PpCBF1 (GenBank Accession HM992943), and constitutively expressed it using an enhanced 35S promoter in apple. Unexpectedly, constitutive overexpression of the PpCBF1 in apple resulted in strong sensitivity to short daylength. Growth cessation and leaf senescence were induced in transgenic lines exposed to SD and optimal growth temperatures of 25°C over a 4-week period. Following 1-4 weeks of SD and 25°C trees were returned to LD and 25°C in the greenhouse. Control (untransformed) plants continued to grow while transgenic lines receiving two or more weeks of SD remained dormant and began to drop leaves. Constitutive overexpression of the PpCBF1 in apple resulted in a 4-6°C increase in freezing tolerance in both the non-acclimated and acclimated states, respectively, compared with untransformed M.26 trees. This is the first instance that constitutive overexpression of a CBF gene has resulted in SD-induction of dormancy and to our knowledge the first time apple has been shown to strongly respond to short daylength as a result of the insertion of a transgene.

  5. DIVERSIDAD LOCAL Y PRÁCTICAS AGRÍCOLAS ASOCIADAS AL CULTIVO TRADICIONAL DE DURAZNOS, PRUNUS PERSICA (ROSACEAE, EN EL NOROESTE DE ARGENTINA

    Directory of Open Access Journals (Sweden)

    D. Alejandra Lambaré

    2012-01-01

    Full Text Available Este trabajo constituye una aproximación etnobotánica a la diversidad de grupos y variedades locales de duraznos y los criterios para delimitar esos etnotaxones. Además, se describen las prácticas de manejo que acompañan la conservación de este cultivo en una comunidad del noroeste argentino. Se estableció una clasificación principal, denominada grupos de cultivariedades, la cual se define como el conjunto de variedades reunidas bajo un único nombre vulgar, resultado de la suma de atributos y diversos criterios definidos localmente. Asimismo, se estableció una subcategorización en etnovariedades definidas por características particulares. Este primer acercamiento evidencia el valor trascendental que adquiere la incorporación y apropiación de un recurso foráneo como elemento representativo del paisaje y del contexto sociocultural de la comunidad, el cual se expresa en el profundo conocimiento que poseen los pobladores para diseñar una clasificación e incorporar prácticas agrícolas asociadas a este cultivo.

  6. Changes in fruit sugar concentrations in response to assimilate supply, metabolism and dilution: a modeling approach applied to peach fruit (Prunus persica)

    National Research Council Canada - National Science Library

    Génard, M; Lescourret, F; Gomez, L; Habib, R

    2003-01-01

    ...) fruit during the main stage of fruit enlargement was analyzed with the SUGAR model of Génard and Souty (1996). The model predicts the partitioning of carbon into sucrose, sorbitol, glucose and fructose in the mesocarp of peach fruit...

  7. Variation in minerals, phenolics and antioxidant activity of peel and pulp of different varieties of peach (Prunus persica L.) fruit from Pakistan

    National Research Council Canada - National Science Library

    Manzoor, Maleeha; Anwar, Farooq; Mahmood, Zahed; Rashid, Umer; Ashraf, Muhammad

    2012-01-01

    .... In this study variation of minerals and antioxidant characteristics (total phenolic contents, total flavonoid contents, reducing power, inhibition of peroxidation using linoleic acid system and DPPH free radical scavenging activity...

  8. Deciphering the interplay among genotype, maturity stage and low-temperature storage on phytochemical composition and transcript levels of enzymatic antioxidants in Prunus persica fruit.

    Science.gov (United States)

    Manganaris, George A; Drogoudi, Pavlina; Goulas, Vlasios; Tanou, Georgia; Georgiadou, Egli C; Pantelidis, George E; Paschalidis, Konstantinos A; Fotopoulos, Vasileios; Manganaris, Athanasios

    2017-10-01

    The aim of this study was to understand the antioxidant metabolic changes of peach (cvs. 'Royal Glory', 'Red Haven' and 'Sun Cloud') and nectarine fruits (cv. 'Big Top') exposed to different combinations of low-temperature storage (0, 2, 4 weeks storage at 0 °C, 90% R.H.) and additional ripening at room temperature (1, 3 and 5 d, shelf life, 20 °C) with an array of analytical, biochemical and molecular approaches. Initially, harvested fruit of the examined cultivars were segregated non-destructively at advanced and less pronounced maturity stages and qualitative traits, physiological parameters, phytochemical composition and antioxidant capacity were determined. 'Big Top' and 'Royal Glory' fruits were characterized by slower softening rate and less pronounced ripening-related alterations. The coupling of HPLC fingerprints, consisted of 7 phenolic compounds (chlorogenic, neochlorogenic acid, catechin, epicatechin, rutin, quecetin-3-O-glucoside, procyanidin B1) and spectrophotometric methods disclosed a great impact of genotype on peach bioactive composition, with 'Sun Cloud' generally displaying the highest contents. Maturity stage at harvest did not seem to affect fruit phenolic composition and no general guidelines for the impact of cold storage and shelf-life on individual phenolic compounds can be extrapolated. Subsequently, fruit of less pronounced maturity at harvest were used for further molecular analysis. 'Sun Cloud' was proven efficient in protecting plasmid pBR322 DNA against ROO attack throughout the experimental period and against HO attack after 2 and 4 weeks of cold storage. Interestingly, a general down-regulation of key genes implicated in the antioxidant apparatus with the prolongation of storage period was recorded; this was more evident for CAT, cAPX, Cu/ZnSOD2, perAPX3 and GPX8 genes. Higher antioxidant capacity of 'Sun Cloud' fruit could potentially be linked with compounds other than enzymatic antioxidants that further regulate peach fruit ripening. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  9. Ecotopic expression of a novel peach (Prunus persica) CBF transcription factor in apple (Malus x domestica) results in short-day induced dormancy and increased cold hardiness

    Science.gov (United States)

    Regulation of growth and dormancy in temperate perennials such as fruit trees is essential, as is the ability to acclimate to freezing temperatures. Depending on the species, the onset of either dormancy and or cold acclimation can be triggered to varying degrees by either or both low, non-freezing...

  10. Radiação gama na conservação pós-colheita da nectarina (Prunus persica var. Nucipersica frigoconservada

    Directory of Open Access Journals (Sweden)

    Neves Leandro Camargo

    2002-01-01

    Full Text Available O trabalho foi desenvolvido no laboratório de Frutas e Hortaliças do Departamento de Gestão e Tecnologia Agroindustrial da Faculdade de Ciências Agronômicas - UNESP - Câmpus de Botucatu, tendo como objetivo principal a caracterização do comportamento da radiação gama, na conservação pós-colheita da nectarina cv. "Sunred". Os frutos foram colhidos no início do estádio de maturação, selecionados, limpos, pré-resfriados (4masculineC por 12 horas e submetidos a diferentes doses de radiação gama, constituindo assim os tratamentos: 1 0,0 kGy, 2 - 0,2 kGy, 3 - 0,4 kGy, 4 - 0,6 kGy, 5 - 0,8 kGy, sendo após armazenados em câmara fria com temperaturas de 0masculineC e 90-95% de UR, por 28 dias. As análises foram realizadas a cada sete dias, determinando-se o aspecto visual dos frutos, a perda de massa fresca, a firmeza de polpa, a acidez total titulável (ATT, os sólidos solúveis totais (STT e a razão STT/ATT. Após 28 dias de armazenamento, verificou-se que os frutos submetidos à dose de 0,4 kGy apresentaram o melhor aspecto visual, as menores perdas de massa fresca, e a maior firmeza de polpa, não ocorrendo, entretanto, variações significativas nos teores de acidez total titulável, sólidos solúveis totais e nos valores da razão SST/ATT.

  11. Seasonal CO[sub 2] exchange patterns of developing peach (Prunus persica) fruits in response to temperature, light and CO[sub 2] concentration

    Energy Technology Data Exchange (ETDEWEB)

    Pavel, E.W.; DeJong, T.M. (Dept. of Pomology, Univ. of California, Davis, CA (United States))

    1993-01-01

    CO[sub 2] exchange rates per unit dry weight, measured in the field on attached fruits of the late-maturing Cal Red peach cultivar, at 1200 [mu]mol photons m[sup -2] s[sup -1] and in dark, and photosynthetic rates, calculated by the difference between the rates of CO[sub 2] evolution in light and dark, declined over the growing season. Photosynthetic rates per fruit increased with increasing fruit dry matter, but declined in maturing fruits, coinciding with the loss of chlorophyll. Slight net fruit photosynthetic rates were measured in midseason under optimal temperature and light conditions. Fruit photosynthetic rates increased with increasing temperatures and photon flux densities during fruit development. Dark respiration rates per unit dry weight doubled within a temperature interval of 10 deg. C; the mean seasonal Q[sub 10] value was 2.03 between 20 and 30 deg. C. Highest photosynthetic rates were measured at 35 deg. C. Fruit photosynthesis was stimulated by high internal CO[sub 2] concentrations via CO[sub 2] refixation. At 15 deg. C, fruit photosynthetic rates were saturated at about 600 [mu]mol photons m[sup -2] s[sup -1]. Young peach fruits responded to increasing ambient CO[sub 2] concentrations with decreasing net CO[sub 2] exchange rates in light, but mature fruits did not. Fruit CO[sub 2] exchange rates in the dark were uninfluenced by ambient CO[sub 2] concentrations. Photosynthetic rates of younger peach fruits approached saturation at 370 [mu]l CO[sub 2] l[sup -1]. In CO[sub 2]-free air, fruit photosynthesis was dependent on CO[sub 2] refixation. Young peach fruits were able to take up CO[sub 2] from the external atmosphere. CO[sub 2] uptake by peach fruits contributed between 28 and 16% to the fruit photosynthetic rate early in the season, whereas photosynthesis in maturing fruits was supplied entirely by CO[sub 2] refixation. (AB) (42 refs.)

  12. Polyphenolics from peach (Prunus persica var. Rich Lady) inhibit tumor growth and metastasis of MDA-MB-435 breast cancer cells in vivo.

    Science.gov (United States)

    Noratto, Giuliana; Porter, Weston; Byrne, David; Cisneros-Zevallos, Luis

    2014-07-01

    The tumor growth inhibition and anti-metastatic effects of peach polyphenolics were investigated in vivo using a xenograft model and MDA-MB-435 breast cancer cells. Results showed that tumor growth and lung metastasis were inhibited in vivo by peach polyphenolics in a dose range of 0.8-1.6 mg/day, and these effects were mediated by inhibition of metalloproteinases gene expression. Modulation of metalloproteinase-2, metalloproteinase-3 and metalloproteinase-13 gene expression may be some of the molecular targets for anti-metastatic activity of peach polyphenolics. Therefore, these compounds may constitute a novel chemopreventive tool to reduce the risk of metastasis in the combination therapy when primary cancer is diagnosed. Conversion to equivalent human intake for future clinical studies using the body surface area normalization method gave a dose of ~370.6 mg/day for a human adult of 60 kg, which can be supplied by consuming two to three peach fruit per day or alternatively using a dietary supplement peach polyphenol extract powder. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. Complete nucleotide sequences of the genomes of two isolates of apple chlorotic leaf spot virus from peach (Prunus persica) in China.

    Science.gov (United States)

    Niu, Feiqing; Pan, Song; Wu, Zujian; Jiang, Dongmei; Li, Shifang

    2012-04-01

    The complete nucleotide sequences of two isolates of apple chlorotic leaf spot virus (Z1 and Z3) collected from peach in Henan Province, China, were determined. The genomes of both Z1 and Z3 were found to contain three open reading frames (ORFs). Sequence analysis showed that genomic sequences of Z1 and Z3 isolates shared 67.4%-82.9% and 67.2%-82.6% identity, respectively, with the other eight isolates of ACLSV that have been reported previously. Based on the putative amino acid sequences of the products of the three ORFs, Z1 and Z3 isolates showed the greatest identity to isolate PBM1 (GenBank accession number AJ243438) from plum and the least identity with isolate Ta Tao5 (GenBank Accession Number: EU223295) from peach. Considering the low level of sequence identity between Z1/Z3 isolate and Ta Tao5 isolate, two types of ACLSV may exist in peach.

  14. Overexpression of a peach (Prunus persica) AP2/ERF-family transcription factor in apple (Malus x domestica) induces growth cessation in response to short photoperiod

    Science.gov (United States)

    Climate change will result in extreme swings in temperature during late fall and early spring that will have a negative impact on woody plants. Apple may be especially sensitive to the predicted weather patterns since growth cessation is regulated by low temperature rather than daylength. We have ...

  15. Roles of endoplasmic reticulum stress and unfolded protein response associated genes in seed stratification and bud endodormancy during chilling accumulation in Prunus persica.

    Science.gov (United States)

    Fu, Xi Ling; Xiao, Wei; Wang, Dong Ling; Chen, Min; Tan, Qiu Ping; Li, Ling; De Chen, Xiu; Gao, Dong Sheng

    2014-01-01

    Dormancy mechanisms in seeds and buds arrest growth until environmental conditions are optimal for development. A genotype-specific period of chilling is usually required to release dormancy, but the underlying molecular mechanisms are still not fully understood. To discover transcriptional pathways associated with dormancy release common to seed stratification and bud endodormancy, we explored the chilling-dependent expression of 11 genes involved in endoplasmic reticulum stress and the unfolded protein response signal pathways. We propose that endoplasmic reticulum stress and the unfolded protein response impact on seed as well as bud germination and development by chilling-dependent mechanisms. The emerging discovery of similarities between seed stratification and bud endodormancy status indicate that these two processes are probably regulated by common endoplasmic reticulum stress and unfolded protein response signalling pathways. Clarification of regulatory pathways common to both seed and bud dormancy may enhance understanding of the mechanisms underlying dormancy and breeding programs may benefit from earlier prediction of chilling requirements for uniform blooming of novel genotypes of deciduous fruit tree species.

  16. Roles of endoplasmic reticulum stress and unfolded protein response associated genes in seed stratification and bud endodormancy during chilling accumulation in Prunus persica.

    Directory of Open Access Journals (Sweden)

    Xi Ling Fu

    Full Text Available Dormancy mechanisms in seeds and buds arrest growth until environmental conditions are optimal for development. A genotype-specific period of chilling is usually required to release dormancy, but the underlying molecular mechanisms are still not fully understood. To discover transcriptional pathways associated with dormancy release common to seed stratification and bud endodormancy, we explored the chilling-dependent expression of 11 genes involved in endoplasmic reticulum stress and the unfolded protein response signal pathways. We propose that endoplasmic reticulum stress and the unfolded protein response impact on seed as well as bud germination and development by chilling-dependent mechanisms. The emerging discovery of similarities between seed stratification and bud endodormancy status indicate that these two processes are probably regulated by common endoplasmic reticulum stress and unfolded protein response signalling pathways. Clarification of regulatory pathways common to both seed and bud dormancy may enhance understanding of the mechanisms underlying dormancy and breeding programs may benefit from earlier prediction of chilling requirements for uniform blooming of novel genotypes of deciduous fruit tree species.

  17. DIVERSIDAD LOCAL Y PRÁCTICAS AGRÍCOLAS ASOCIADAS AL CULTIVO TRADICIONAL DE DURAZNOS, PRUNUS PERSICA (ROSACEAE), EN EL NOROESTE DE ARGENTINA

    OpenAIRE

    D. Alejandra Lambaré; M. Lelia Pochettino

    2012-01-01

    Este trabajo constituye una aproximación etnobotánica a la diversidad de grupos y variedades locales de duraznos y los criterios para delimitar esos etnotaxones. Además, se describen las prácticas de manejo que acompañan la conservación de este cultivo en una comunidad del noroeste argentino. Se estableció una clasificación principal, denominada grupos de cultivariedades, la cual se define como el conjunto de variedades reunidas bajo un único nombre vulgar, resultado de la suma de atributos y...

  18. IDENTIFICACION DE LA REGULACION TRANSCRIPCIONAL DE GENES INVOLUCRADOS EN LA RESPUESTA AL FRIO Y/O MADURACION EN FRUTOS DE PRUNUS PERSICA

    OpenAIRE

    VIZOSO LATUZ, PAULA SUSANA

    2012-01-01

    Desde el punto de vista agroindustrial chileno, el durazno es un cultivo económicamente importante. Chile está situado entre los principales exportadores de fruta fresca al hemisferio norte. El traslado de los frutos desde nuestro país hasta el consumidor final dura alrededor de 20 días, periodo en el que la calidad del fruto se ve alterada. Por esto los productores y exportadores han debido enfocarse en la búsqueda de diferentes metodologías para conservar en mejor estado los ...

  19. Aplicação de revestimentos comestíveis em pêssego (Prunus persica Use of edible coating in peaches

    Directory of Open Access Journals (Sweden)

    Giselle de Assis Jacometti

    2003-04-01

    Full Text Available O objetivo do trabalho foi avaliar a influência de revestimentos comestíveis sobre a vida-de-prateleira, perda de massa, atividade metabólica e contaminação microbiológicas em pêssegos in natura. Foram utilizados pêssegos brancos cv. Perola de Mairinque (IAC 769-8 revestidos com soluções de 1% de goma gelana (p/v e 1% goma gelana + 1% sorbitol (p/v, embalados em caixas de papelão e armazenados a 10ºC / 80-85% UR por 16 dias. Frutos sem revestimento serviram de controle. Os revestimentos à base de goma gelana e gelana+sorbitol não alteraram a atividade fisiológica dos pêssegos, medida através da taxa de respiração, teor de sólidos solúveis e acidez titulável ao longo da armazenagem. Não houve diferença entre as taxas de perda de massa, que ficaram em torno de 1,4g/100g.dia. Os revestimentos não alteraram a aceitação dos pêssegos em termos de sabor e em termos de aparência, o controle obteve notas superiores aos revestidos devida a opacidade que o revestimento conferiu aos frutos. Na contagem total de microrganismos aeróbios mesófilos e bolores e leveduras não houve diferença entre os tratamentos ao longo da armazenagem, mas em termos de microrganismos psicrotróficos os frutos revestidos apresentaram uma menor contagem em relação ao controle. Revestimentos à base de goma gelana e gelana+sorbitol não aumentaram a vida-de-prateleira de pêssegos armazenados sob refrigeração devido à composição do revestimento, que não reduziu a perda de massa nem a atividade fisiológica dos frutos.The objective of this work was to evaluate the influence of edible coatings on shelf-life, weight loss, metabolic activity and microbial contamination of peaches in natura. White peaches cv. Perola de Mairinque (IAC 769-8 were coated with 1% gelan gum (p/v and 1% gelan gum + 1% sorbitol (p/v solutions, packed in paperboard box and stored at 10ºC/80-85% RH during 16 days. No coated fruits served as control. Gelan and gelan+sorbitol coatings had no effect on physiological activity of peaches, measured by respiration rates, total soluble solid content and total titratable acidity during storage. There was no difference among weight loss rates (~1.4 g/100g.day of all treatments. Edible coatings had no influence on flavor acceptance of the peaches but control fruits had higher scores than coated ones on appearance acceptance evaluation because the opacity caused by the coating. There was no difference among treatments in total count of aerobic mesophiles microorganisms and molds and yeasts during storage but for psychotropic microorganisms, coated fruits presented lower counts than control ones. Gelan and gelan+sorbitol based coatings have not extended shelf-life of cold stored peaches due to coating composition that did not reduced the weight loss and physiological metabolism of the fruits.

  20. Expression of ABA Metabolism-Related Genes Suggests Similarities and Differences Between Seed Dormancy and Bud Dormancy of Peach (Prunus persica).

    Science.gov (United States)

    Wang, Dongling; Gao, Zhenzhen; Du, Peiyong; Xiao, Wei; Tan, Qiuping; Chen, Xiude; Li, Ling; Gao, Dongsheng

    2015-01-01

    Dormancy inhibits seed and bud growth of perennial plants until the environmental conditions are optimal for survival. Previous studies indicated that certain co-regulation pathways exist in seed and bud dormancy. In our study, we found that seed and bud dormancy are similar to some extent but show different reactions to chemical treatments that induce breaking of dormancy. Whether the abscisic acid (ABA) regulatory networks are similar in dormant peach seeds and buds is not well known; however, ABA is generally believed to play a critical role in seed and bud dormancy. In peach, some genes putatively involved in ABA synthesis and catabolism were identified and their expression patterns were studied to learn more about ABA homeostasis and the possible crosstalk between bud dormancy and seed dormancy mechanisms. The analysis demonstrated that two 9-cis-epoxycarotenoid dioxygenase-encoding genes seem to be key in regulating ABA biosynthesis to induce seed and bud dormancy. Three CYP707As play an overlapping role in controlling ABA inactivation, resulting in dormancy-release. In addition, Transcript analysis of ABA metabolism-related genes was much similar demonstrated that ABA pathways was similar in the regulation of vegetative and flower bud dormancy, whereas, expression patterns of ABA metabolism-related genes were different in seed dormancy showed that ABA pathway maybe different in regulating seed dormancy in peach.

  1. Results of primary study of the remote hybrids of nectarine (Prunus persica L. Batsh var. Nucipersica (Suckow Sc and peach (Prunus persipa L. Batsh with amygdalys ordinary (Amygdalus communis L.

    Directory of Open Access Journals (Sweden)

    Є. П. Шоферістов

    2007-12-01

    Full Text Available Created in Nikitskyi botanical garden Remote hybrids of nectarine and peach with almond ordinary can be used in Breeding of nectarine and peach fok high resistauce to fundi, as wengs for creation of varieties of nectarine with high drought resistance, sweet seed kernels, high contents of organic substance, and other important Breeding characteristics. Late blossoming hybrid forms can be used in Breeding of almond fok late time of flowering and selfcompatibility.

  2. Influence of Silicon on Resistance of Zinnia Elegans to Myzus Persicae (Hemiptera: Aphididae)

    Science.gov (United States)

    Studies were conducted to examine the effect of treating Zinnia elegans Jacq. with soluble silicon on the performance of the green peach aphid, Myzus persicae (Sulzer). Zinnia elegans plants were irrigated every 2 days throughout the duration of the experiment with a nutrient solution amended with ...

  3. Effect of Ethanolic Extract of Salvadora Persica L. and it's Chloroform ...

    African Journals Online (AJOL)

    Effect of Ethanolic Extract of Salvadora Persica L. and it's Chloroform Fraction in Experimentally Induced Hyperlipidemia in Rats. ... Blood was collected by ocular puncture 2 and 4 h after olive oil treatment and centrifuged at 3000 rpm for 20 min. Serum samples were further subjected to biochemical analysis. The study dose ...

  4. National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Myzus persicae

    Science.gov (United States)

    Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the green peach aphid, Myzus persicae, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures t...

  5. Microsatellite marker analysis of peach-potato aphids (Myzus persicae, Homoptera: Aphididae) from Scottish suction traps.

    Science.gov (United States)

    Malloch, G; Highet, F; Kasprowicz, L; Pickup, J; Neilson, R; Fenton, B

    2006-12-01

    The peach-potato aphid Myzus persicae (Sulzer) is an important vector of plant viruses. A network of suction traps collects aerial samples of this aphid in order to monitor and help predict its spatial distribution and likely impact on virus transmission in crops. A suction trap catch is thought to be a good representation of the total aphid pool. Sensitive molecular markers have been developed that determine the genetic composition of the M. persicae population. In Scotland, UK, these were applied to field collections revealing a limited number of clones. Molecular markers are less successful when applied to specimens that have been preserved in an ethanol-based trap fluid designed to preserve morphology. An assessment of different DNA extraction and PCR techniques is presented and the most efficient are used to analyse M. persicae specimens caught in the Dundee suction trap in 2001, a year when exceptionally high numbers were caught. The results reveal that the majority of the M. persicae caught belonged to two highly insecticide resistant clones. In addition, it was possible to compare the relative frequencies of genotypes caught in the trap with those collected at insecticide treated and untreated field sites in the vicinity. These results indicate that, in addition to suction trap data, the ability to sample field sites provides valuable early warning data which have implications for pest control and virus management strategies.

  6. Susceptibility of Australian Myzus persicae (Hemiptera: Aphididae) to Three Recently Registered Insecticides: Spirotetramat, Cyantraniliprole, and Sulfoxaflor.

    Science.gov (United States)

    de Little, Siobhan C; Umina, Paul A

    2017-08-01

    The green peach aphid, Myzus persicae (Sulzer), is a significant agricultural pest that has developed resistance to a large number of insecticides globally. Within Australia, resistance has previously been confirmed for multiple chemical groups, including pyrethroids, carbamates, organophosphates, and neonicotinoids. In this study, we use leaf-dip and topical bioassays to investigate susceptibility and potential cross-resistance of 12 field-collected populations of Australian M. persicae to three recently registered insecticides: sulfoxaflor, spirotetramat, and cyantraniliprole. Despite all 12 populations carrying known resistance mechanisms to carbamates, organophosphates, and pyrethroids, and two populations also exhibiting low-level metabolic resistance to neonicotinoids, we found little evidence of variation in susceptibility to sulfoxafor, spirotetramat, or cyantraniliprole. This provides further evidence that cross-resistance to spirotetramat, cyantraniliprole, and sulfoxaflor in M. persicae is not conferred by the commonly occurring resistance mechanisms MACE, super-kdr, amplification of the E4 esterase gene, or enhanced expression and copy number of the P450 gene, CYP6CY3. Importantly, this study also established toxicity baseline data that will be important for future monitoring of insecticide responses of M. persicae from both broadacre and horticultural crops. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Acquisition and transmission of potato leafroll virus by Myzus persicae : quantitative aspects

    NARCIS (Netherlands)

    Heuvel, van den J.F.J.M.

    1991-01-01

    Studying the transmission of potato leafroll virus (PLRV) by Myzus persicae from infected Physalis floridana plants, revealed that the ability of aphids to transmit the virus differed widely among individuals and strongly depended on the biotype of

  8. The site of potato leafroll virus multiplication in its vector, Myzus persicae : an anatomical study

    NARCIS (Netherlands)

    Ponsen, M.B.

    1972-01-01

    In search of the site of PLRV multiplication in its vector a detailed study was made of the anatomy of the aphid, Myzus persicae SULZ. The findings are summarized in the following lines:

    Alimentary canal

    The most anterior part of

  9. Influence of Cultivar and Industrial Processing on Polyphenols in Concentrated Sour Cherry (Prunus cerasus L.) Juice

    National Research Council Canada - National Science Library

    Maja Repajic; Danijela Bursac Kovacevic; Predrag Putnik; Verica Dragovic-Uzelac; Josipa Kust; Zrinka Cosic; Branka Levaj

    2015-01-01

      The objective of this study is to investigate the influence of cultivar and industrial processing on total polyphenols, anthocyanins, hydroxycinnamic acids and antioxidant activity in concentrated sour cherry (Prunus cerasus L., cvs...

  10. Screening of natural organic volatiles from Prunus mahaleb L. honey: coumarin and vomifoliol as nonspecific biomarkers

    National Research Council Canada - National Science Library

    Jerković, Igor; Marijanović, Zvonimir; Staver, Mladenka Malenica

    2011-01-01

    ...) were used for the analysis of Prunus mahaleb L. honey samples. Screening was focused toward chemical composition of natural organic volatiles to determine if it is useful as a method of determining honey-sourcing...

  11. Evaluation of anti-inflammatory effect of Salvadora persica in IBD-induced rat

    Directory of Open Access Journals (Sweden)

    M. Nomani*

    2017-11-01

    Full Text Available Background and objectives: Inflammatory bowel diseases (IBD are among the most prevalent diseases in developed countries. In general, IL-6 and TNF-α are considered as the main causes of tissue damage in the intestine. Salvadora persica is a domestic and abundant plant growing in some central and southern areas of Iran. The main objective of the current study was to evaluate the potential anti-inflammatory effect of the hydro-alcoholic extract of Salvadora persica in a rat model of IBD. Methods: Acute colitis was induced by intra-rectal administration of 100 mg/kg TNBS dissolved in a total volume of 0.25 mL of 50% ethanol. Twenty-four h after colitis induction, saline, S. persica extracts (25, 50 and 100 mg/kg and sulfasalazine (100 mg/kg were orally administered to the corresponding groups of animals. The dose administration was repeated daily for seven consecutive days. Aftewards, body weight changes, macroscopic and microscopic lesions were assessed by dissecting 8 cm of the distal colons of the animals. TNF-α and IL-6 mRNA expression were also evaluated by real-time PCR. Results: The obtained results showed that sulfasalazine and S. persica extracts were significantly able to reduce the body weight loss, macroscopic and microscopic lesions compared to the untreated control. Additionally, they were able to decrease the expression of TNF-α mRNA in the colon tissue. Conclusion: The findings of this study indicated that Salvadora persica extract had an acceptable anti-inflammatory effect on the induced colitis in rat, and one of its notable mechanisms could be through TNF-α pathway.

  12. Efecto de cuatro manejos del suelo sobre la densidad de raíces absorbentes en durazno [prunus pérsica (l batsch] a 10 cm de profundidad

    Directory of Open Access Journals (Sweden)

    Andrés Gómez

    2011-10-01

    Full Text Available El árbol de Durazno (P. pérsica está constituido por dos partes estructurales: una epigea, conformada por el tronco que soporta el sistema caulinar, y otra hipogea que constituye el sistema radicular. Este último, de acuerdo con la base morfoanatómica y las funciones específicas, presenta varios tipos de raíces: absorbentes, de transición y de conducción. Las absorbentes (de color blanquecino translúcido son fisiológicamente muy activas y representanentre el 80 y el 85% de la totalidad del sistema radical. Aunque las raícesde los árboles frutales se desarrollan siguiendo un patrón genético, algunas condiciones medio ambientales producen variaciones morfológicas en su desarrollo. En este trabajo se estudió la densidad del aparato radical absorbente en el cultivo de Durazno (variedad Dorado, a 10 cm de profundidad. Se empleó la técnica volumen del cilindro, en función del manejo del suelo, utilizando 2 tipos de coberturas (cobertura viva, cobertura muerta, control dearvenses con herbicida y un referente tradicional con labranza. Los resultados mostraron que la cobertura con material vegetal muerto, sobre el suelo (10 cm de profundidad bajo el diámetro de la copa del árbol (160 cm, generóun mayor desarrollo del sistema radicular, evidente en una mayor densidad.

  13. Disomic segregation of microsatellites in the tetraploid Prunus serotina Ehrh. (Rosaceae)

    OpenAIRE

    Pairon, Marie; Jacquemart, Anne-Laure

    2005-01-01

    Tetraploid black cherry (Prunus serotina) is the only Prunus L. species that has commercial importance as a timber tree in North America and is well known in Europe for its invasive behavior. Inheritance studies have never been performed and it is not known whether the species is allo or autotetraploid. Six microsatellite nuclear markers were used to test the inheritance in progenies of controlled crosses. Inheritance was proven to be disomic at all loci and a typical diploid mendelian inheri...

  14. Two Types of New Natural Materials for Fruit Vinegar in Prunus Plants

    Directory of Open Access Journals (Sweden)

    Zhao Han

    2017-01-01

    Full Text Available To increase Prunus armeniaca × P. sibirica and P. domestica × P. armeniaca added value; three natural fruit vinegars were designed. The results showed the nutrition of Prunus domestica × P. armeniaca cultivar Fengweimeigui vinegar (T1 had high minerals and microelements, especially the Ca and Mg reached to the 150.00mg/L, 85.40 mg/L, respectively; the vinegar of Prunus armeniaca × P. sibirica cultivar Zhongren No.1 (T2 not only have rich Na (2800.00 mg/L, P (123.00 mg/L, but also have plentiful amino acid that content reached to 200.08 mg/L. However, the mixture vinegar (T3 with pulps from Prunus domestica × P. armeniaca and Prunus armeniaca × P. sibirica had the middle nutrient contents, but the property was balanced. We therefore conclude that solid fermentation is a suitable method to preserve nutrients and value-added for Prunus plants fruit, and three types vinegars are suitable for different age people, and the difference nutrient contents and typical characteristic indicate that three vinegars are competitive products in market.

  15. Chemical Effectiveness of Salvadora Persica and Commercially Available Whitening Toothpaste on Preventing Tea and Chlorhexidine Stain (in Vitro Study)

    OpenAIRE

    Mahanani, Erlina Sih; Arief, Erry Mochamad; Ismail, Puteri Ezdiani Binti Mohamed

    2011-01-01

    Salvadora persica, a plant that contains a wide range of healthy components, has been used as chewing stick for ages to maintain good oral hygiene and currently has been approved to remove stains. However, its stain-preventing effect is still under investigation. This study aimed to investigate the effectiveness of Salvadora persica and commercially available whitening toothpastes on preventing tea and chlorhexidine stains. Sixty clear acrylic blocks were used and divided into 3 groups, 20 fo...

  16. The influence of nutritional history on the functional response of Geocoris pallidipennis to its prey, Myzus persicae.

    Science.gov (United States)

    Liu, F; Zeng, F

    2014-12-01

    Insect artificial diets are the foundation for mass production of insect predators. Whether there is an influence of long-term rearing with artificial diet on the control ability of predators should be considered. Here, we focused on the effect of nutritional history on the functional response of Geocoris pallidipennis to Myzus persicae. The influence of nutritional history (artificial diet versus natural prey, M. persicae) on the functional response of third to fifth instar nymphs and female G. pallidipennis was examined in the laboratory. The results showed that the functional response curve of both the nymphs and the adult female of G. pallidipennis to M. persicae reflected similar trends on both nutritional histories and confirmed the type II response. Adult female G. pallidipennis reared on either M. persicae or artificial diet produced a significantly better performance than the juvenile stages tested. We estimated that adult female G. pallidipennis can consume 141.6 (artificial diet) or 131.6 (M. persicae) aphids per day, respectively. This indicated that G. pallidipennis reared on both artificial diet and M. persicae displayed high rates of predation.

  17. Bioactivity-guided fractionation identifies amygdalin as a potent neurotrophic agent from herbal medicine Semen Persicae extract.

    Science.gov (United States)

    Yang, Chuanbin; Zhao, Jia; Cheng, Yuanyuan; Li, Xuechen; Rong, Jianhui

    2014-01-01

    Herbal medicine Semen Persicae is widely used to treat blood stasis in Chinese medicine and other oriental folk medicines. Although little is known about the effects of Semen Persicae and its active compounds on neuron differentiation, our pilot study showed that Semen Persicae extract promoted neurite outgrowth in rat dopaminergic PC12 cells. In the present study, we developed a bioactivity-guided fractionation procedure for the characterization of the neurotrophic activity of Semen Persicae extract. The resultant fractions were assayed for neurite outgrowth in PC12 cells based on microscopic assessment. Through liquid-liquid extraction and reverse phase HPLC separation, a botanical glycoside amygdalin was isolated as the active compound responsible for the neurotrophic activity of Semen Persicae extract. Moreover, we found that amygdalin rapidly induced the activation of extracellular-signal-regulated kinase 1/2 (ERK1/2). A specific ERK1/2 inhibitor PD98059 attenuated the stimulatory effect of amygdalin on neurite outgrowth. Taken together, amygdalin was identified as a potent neurotrophic agent from Semen Persicae extract through a bioactivity-guided fractional procedure. The neurotrophic activity of amygdalin may be mediated by the activation of ERK1/2 pathway.

  18. Bioactivity-Guided Fractionation Identifies Amygdalin as a Potent Neurotrophic Agent from Herbal Medicine Semen Persicae Extract

    Directory of Open Access Journals (Sweden)

    Chuanbin Yang

    2014-01-01

    Full Text Available Herbal medicine Semen Persicae is widely used to treat blood stasis in Chinese medicine and other oriental folk medicines. Although little is known about the effects of Semen Persicae and its active compounds on neuron differentiation, our pilot study showed that Semen Persicae extract promoted neurite outgrowth in rat dopaminergic PC12 cells. In the present study, we developed a bioactivity-guided fractionation procedure for the characterization of the neurotrophic activity of Semen Persicae extract. The resultant fractions were assayed for neurite outgrowth in PC12 cells based on microscopic assessment. Through liquid-liquid extraction and reverse phase HPLC separation, a botanical glycoside amygdalin was isolated as the active compound responsible for the neurotrophic activity of Semen Persicae extract. Moreover, we found that amygdalin rapidly induced the activation of extracellular-signal-regulated kinase 1/2 (ERK1/2. A specific ERK1/2 inhibitor PD98059 attenuated the stimulatory effect of amygdalin on neurite outgrowth. Taken together, amygdalin was identified as a potent neurotrophic agent from Semen Persicae extract through a bioactivity-guided fractional procedure. The neurotrophic activity of amygdalin may be mediated by the activation of ERK1/2 pathway.

  19. Development and Characterization of Microsatellite Markers in Prunus sibirica (Rosaceae

    Directory of Open Access Journals (Sweden)

    Hua-Bo Liu

    2013-03-01

    Full Text Available Premise of the study: Microsatellite loci were developed for Prunus sibirica to investigate genetic diversity, population genetic structure, and marker-assisted selection of late-blooming cultivars in the breeding of P. sibirica. Methods and Results: Using a magnetic bead enrichment strategy, 19 primer pairs were developed and characterized across 40 individuals from three P. sibirica wild populations and six individuals of P. armeniaca. The number of alleles per locus varied from three to 11 and the observed and expected heterozygosities ranged from 0.063 to 0.917 and 0.295 to 0.876, respectively, in the three P. sibirica wild populations. All primer pairs could be successfully amplified in six individuals of P. armeniaca. Conclusions: These microsatellite primer pairs should be useful for population genetics, germplasm identification, and marker-assisted selection in the breeding of P. sibirica and related species.

  20. Borrelia persica infection in dogs and cats: clinical manifestations, clinicopathological findings and genetic characterization.

    Science.gov (United States)

    Baneth, Gad; Nachum-Biala, Yaarit; Halperin, Tamar; Hershko, Yizhak; Kleinerman, Gabriela; Anug, Yigal; Abdeen, Ziad; Lavy, Eran; Aroch, Itamar; Straubinger, Reinhard K

    2016-05-10

    Relapsing fever (RF) is an acute infectious disease caused by arthropod-borne spirochetes of the genus Borrelia. The disease is characterized by recurrent episodes of fever that concur with spirochetemia. The RF borrelioses include louse-borne RF caused by Borrelia recurrentis and tick-borne endemic RF transmitted by argasid soft ticks and caused by several Borrelia spp. such as B. crocidurae, B. coriaceae, B. duttoni, B. hermsii, B. hispanica and B. persica. Human infection with B. persica is transmitted by the soft tick Ornithodoros tholozani and has been reported from Iran, Israel, Egypt, India, and Central Asia. During 2003-2015, five cats and five dogs from northern, central and southern Israel were presented for veterinary care and detected with borrelia spirochetemia by blood smear microscopy. The causative infective agent in these animals was identified and characterized by PCR from blood and sequencing of parts of the flagellin (flab), 16S rRNA and glycerophosphodiester phosphodiestrase (GlpQ) genes. All animals were infected with B. persica genetically identical to the causative agent of human RF. Phylogenetic analysis indicated that DNA sequences from these pet carnivores clustered together with B. persica genotypes I and II from humans and O. tholozani ticks and distinctly from other RF Borrelia spp. The main clinical findings in cats included lethargy, anorexia, anemia in 5/5 cats and thrombocytopenia in 4/5. All dogs were lethargic and anorectic, 4/5 were febrile and anemic and 3/5 were thrombocytopenic. Three dogs were co-infected with Babesia spp. The animals were all treated with antibiotics and the survival rate of both dogs and cats was 80 %. The cat and dog that succumbed to disease died one day after the initiation of antibiotic treatment, while survival in the others was followed by the rapid disappearance of spirochetemia. This is the first report of disease due to B. persica infection in cats and the first case series in dogs. Infection was

  1. Host generated siRNAs attenuate expression of serine protease gene in Myzus persicae.

    Science.gov (United States)

    Bhatia, Varnika; Bhattacharya, Ramcharan; Uniyal, Prem L; Singh, Rajendra; Niranjan, Rampal S

    2012-01-01

    Sap sucking hemipteran aphids damage diverse crop species. Although delivery of ds-RNA or siRNA through microinjection/feeding has been demonstrated, the efficacy of host-mediated delivery of aphid-specific dsRNA in developing aphid resistance has been far from being elucidated. Transgenic Arabidopsis expressing ds-RNA of Myzus persicae serine protease (MySP) was developed that triggered the generation of corresponding siRNAs amenable for delivery to the feeding aphids. M. persicae when fed on the transgenic plants for different time intervals under controlled growth conditions resulted in a significant attenuation of the expression of MySP and a commensurate decline in gut protease activity. Although the survivability of these aphids was not affected, there was a noticeable decline in their fecundity resulting in a significant reduction in parthenogenetic population. The study highlighted the feasibility of developing host based RNAi-mediated resistance against hemipteran pest aphids.

  2. Analysis of Agromorphological Descriptors to Differentiate between Duke Cherry (Prunus x gondouinii (Poit. & TurpinRehd. and Its Progenitors: Sweet Cherry (Prunus avium L. and Sour Cherry (Prunus cerasus L. Análisis de Descriptores Agromorfológicos para Diferenciar entre Cerezo Duke (Prunus x gondouinii (Poit. & Turpin Rehd. y sus Progenitores: Cerezo (Prunus avium L. y Guindo (Prunus cerasus L.

    Directory of Open Access Journals (Sweden)

    Rodrigo Pérez

    2010-03-01

    Full Text Available The rapid identification of the hybrids between sweet cherry (Prunus avium L. and sour cherry (Prunus cerasus L. is not easy. In order to resolve this problem, 18 Spanish sweet, sour and duke cherry cultivars were surveyed and characterized using 43 agromorphological descriptors evaluated in flowers, leaves, dormant 1-yr-old shoots, fruits, and trees during 2005 and 2006. Based on quantitative parameters, ANOVA and stepwise discriminant analysis (SDA were carried out. For qualitative descriptors, statistical comparisons were done by means of the chi-square (χ2 test. As result of the study, two quantitative (titratable acidity and number of lenticels and six qualitative descriptors (shape of the central and lateral lobes in the internal bracts of the flower fascicles, leaf shape and margin, pubescence in the veins of the lower side of the leaf, and type of sulci of the seed coat were identified as differential parameters in P. avium, P. cerasus and P. x gondouinii(Poit. & Turpin Rehd. Also, another four qualitative descriptors (petal coloration at the end of blooming, leaf stipule type, and seed shape and viability were found to be useful for easy differentiation between sour and duke cherry. None of these parameters has been employed previously to discriminate among sweet, sour and duke cherry.Los híbridos de cerezo (Prunus avium L. y guindo (Prunus cerasus L. no son fáciles de identificar. Para resolver este problema, 18 cultivares de cerezo, guindo y sus híbridos fueron prospectados y caracterizados agromorfológicamente mediante el estudio de 43 descriptores evaluados en flores, hojas, frutos, ramas de 1 año y árbol durante los años 2005 y 2006. En base a los resultados obtenidos del estudio de los diferentes parámetros cuantitativos se realizaron un ANDEVA y un análisis discriminante escalonado (SDA. Los descriptores cualitativos fueron analizados mediante el test de Chi-cuadrado (χ². Como resultado del estudio se identificaron

  3. Salvadora persica agro-ecological suitability for oil production in Argentine dryland salinity.

    Science.gov (United States)

    Falasca, Silvia; Pitta-Alvarez, Sandra; del Fresno, Carolina Miranda

    2015-12-15

    One of the major causes of crop stress is soil or water salinity. Thus, selection of the best species for cultivation in semiarid and arid climates is fundamental. Salvadora persica is an evergreen perennial halophyte that can grow under extreme conditions, from very dry environments to highly saline soils. Based on international bibliography, the authors outlined an agro-ecological zoning model to determine the potential cultivation zones for S. persica in Argentina. This model may be applied to any part of the world, using the agro-ecological limits presented in this work. All the maps were developed by the implementation of a geographic information system (GIS) that can be updated by the further incorporation of complementary information, with the consequent improvement of the original database. The overlap of the agroclimatic suitability map on the drylands' saline soils and the drylands' alkaline soils maps, determined the agro-ecological zoning. Since some areas in the agro-ecological zoning can overlap with land that is already assigned for other uses, protected areas, current land use/cover of the different zones, and urban areas maps were incorporated into the GIS and subtracted by a mask. This resulted in the delimitation of "potential cultivation zoning", thus avoiding possible conflicts surrounding the use of land and making the agro-ecological zonation more efficient. There is a broad agro-ecological zone for cultivation of S. persica that extends from Northern Argentina to approximately 41° South latitude, under dry-subhumid to semiarid climates. Lands classified with different degrees of suitability in the potential cultivation zoning could be used for production of this species for energy purposes on lands that are either unsuitable for food production or currently assigned for other purposes. This paper represents pioneering work since there are no previous studies concerning the introduction of S. persica in Argentina. Copyright © 2015 Elsevier

  4. Borrelia persica Infection in Immunocompetent Mice--A New Tool to Study the Infection Kinetics In Vivo.

    Science.gov (United States)

    Schwarzer, Sandra; Overzier, Evelyn; Hermanns, Walter; Baneth, Gad; Straubinger, Reinhard K

    2016-02-01

    Borrelia persica, a bacterium transmitted by the soft tick Ornithodoros tholozani, causes tick-borne relapsing fever in humans in the Middle East, Central Asia and the Indian peninsula. Immunocompetent C3H/HeOuJ mice were infected intradermally with B. persica at varying doses: 1 x 10(6), 1 x 10(4), 1 x 10(2) and 4 x 10(0) spirochetes/mouse. Subsequently, blood samples were collected and screened for the presence of B. persica DNA. Spirochetes were detected in all mice infected with 1 x 10(6), 1 x 10(4) and 1 x 10(2) borrelia by real-time PCR targeting the flaB gene of the bacterium. Spirochetemia developed with a one- to two-day delay when 1 x 10(4) and 1 x 10(2) borrelia were inoculated. Mice injected with only four organisms were negative in all tests. No clinical signs were observed when infected mice were compared to negative control animals. Organs (heart, spleen, urinary bladder, tarsal joint, skin and brain) were tested for B. persica-specific DNA and cultured for the detection of viable spirochetes. Compiled data show that the target organs of B. persica infections are the brain and the skin. A newly developed serological two-tiered test system (ELISA and western blot) for the detection of murine IgM, IgG and IgA antibody titers against B. persica showed a vigorous antibody response of the mice during infection. In conclusion, the infection model described here for B. persica is a platform for in vivo studies to decipher the so far unexplored survival strategies of this Borrelia species.

  5. Evaluation of the Anxiolytic Effect of Nepeta persica Boiss. in Mice

    Directory of Open Access Journals (Sweden)

    M. Rabbani

    2008-01-01

    Full Text Available The aim of the present study was to evaluate the anxiolytic effects of hydroalcoholic extract (HE of Nepeta persica Boiss. (Lamiaceae on the elevated plus-maze (EPM model of anxiety. The extract of arial parts of the plant was administered intraperitoneally to male NMRI mice, at various doses, 30 min before behavioural evaluation. The HE extract of N. persica at the dose of 50 mg kg−1 significantly increased the percentage of time spent and percentage of arm entries in the open arms of the EPM. This dose of plant extract affected neither animal's locomotor activity nor ketamine-induced sleeping time. The 50 mg kg−1 dose of the plant extract seemed to be the optimal dose in producing the anxiolytic effects, lower or higher doses of the plant produce either sedative or stimulant effects. At 100 mg kg−1, the plant extract increased the locomotor activity. These results suggested that the extract of N. persica at dose of 50 mg kg−1 possess anxiolytic effect with less sedative and hypnotic effects than that of diazepam and causes a non-specific stimulation at 100 mg kg−1.

  6. Discovery of metabolic resistance to neonicotinoids in green peach aphids (Myzus persicae) in Australia.

    Science.gov (United States)

    de Little, Siobhan C; Edwards, Owain; van Rooyen, Anthony R; Weeks, Andrew; Umina, Paul A

    2017-08-01

    Myzus persicae is a serious pest that attacks a broad range of agricultural crops. This species has developed chemical resistance to many insecticides globally, and within Australia resistance to multiple chemical groups has been identified. Resistance to neonicotinoid insecticides has been discovered in several countries, but has not previously been confirmed in Australia. We use biomolecular assays and bioassays on field-collected populations to investigate neonicotinoid resistance in M. persicae within Australia. Several geographically and genetically distinct populations showed evidence for resistance in bioassays. Genetic markers identified that the mechanism of neonicotinoid resistance in Australia is metabolic resistance through the enhanced expression of a cytochrome P450 gene, CYP6CY3. M. persicae populations in parts of Australia are now resistant to four different insecticide chemical groups, raising concerns about the long-term management of this pest. While higher copy numbers of CYP6CY3 were seen in all resistant populations, the number of gene copies was not strongly correlated with the level of resistance as determined by LD 50 values generated through bioassays. This finding sheds further light on the complexity of the P450 genes in regulating neonicotinoid resistance. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  7. Abscisic acid deficiency increases defence responses against Myzus persicae in Arabidopsis.

    Science.gov (United States)

    Hillwig, Melissa S; Chiozza, Mariana; Casteel, Clare L; Lau, Siau Ting; Hohenstein, Jessica; Hernández, Enrique; Jander, Georg; MacIntosh, Gustavo C

    2016-02-01

    Comparison of Arabidopsis thaliana (Arabidopsis) gene expression induced by Myzus persicae (green peach aphid) feeding, aphid saliva infiltration and abscisic acid (ABA) treatment showed a significant positive correlation. In particular, ABA-regulated genes are over-represented among genes that are induced by M. persicae saliva infiltration into Arabidopsis leaves. This suggests that the induction of ABA-related gene expression could be an important component of the Arabidopsis-aphid interaction. Consistent with this hypothesis, M. persicae populations induced ABA production in wild-type plants. Furthermore, aphid populations were smaller on Arabidopsis aba1-1 mutants, which cannot synthesize ABA, and showed a significant preference for wild-type plants compared with the mutant. Total free amino acids, which play an important role in aphid nutrition, were not altered in the aba1-1 mutant line, but the levels of isoleucine (Ile) and tryptophan (Trp) were differentially affected by aphids in wild-type and mutant plants. Recently, indole glucosinolates have been shown to promote aphid resistance in Arabidopsis. In this study, 4-methoxyindol-3-ylmethylglucosinolate was more abundant in the aba1-1 mutant than in wild-type Arabidopsis, suggesting that the induction of ABA signals that decrease the accumulation of defence compounds may be beneficial for aphids. © 2015 BSPP AND JOHN WILEY & SONS LTD.

  8. Temperature-Mediated Effects of Host Alternation on the Adaptation of Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Li, Dan; Zhao, Huiyan; Gao, Huanhuan; Hu, Zuqing; Hu, Xiangshun

    2015-04-01

    Local adaptation, an important phenomenon in ecological speciation, occurs in Myzus persicae (Sulzer), with the tobacco-adapted line proposed as a subspecies. Recent studies showed that temperature could alter the selection strength and direction in host-herbivore interactions. To understand the formation of host-adapted speciation and the effects of temperature on host adaptation, the parthenogenetic progeny of an M. persicae egg were conditioned on two hosts for >10 generations. Then, their life table parameters were studied after reciprocal transfer under a temperature gradient. The results showed that aphids habituated on tobacco (Nicotiana tabacum L.) and rape (Brassica napus L.) had different optimal temperatures, including different upper thresholds of development and reproduction on original and alternative hosts. After habituation for >10 generations, local adaptation of aphids on the host of origin was formed, which was observed as the better performance of the native aphids compared with the foreign ones. The M. persicae that habituated on rape appeared more generalized to the host plants than the aphids that habituated on tobacco. The adaptation patterns of green peach aphids on two hosts varied differentially according to temperature, which verified the temperature-mediated effects of host selection on herbivores, implying the presence of a demographic basis of aphid seasonal migration. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. TOKSISITAS BEBERAPA HASIL EKSTRAK DAUN TEMBAKAU TERHADAP Myzus persicae (Homoptera;Aphididae

    Directory of Open Access Journals (Sweden)

    - Sudjak

    2015-09-01

    Full Text Available Penggunaan pestisida kimia sintetik yang tidak rasional dapat menyebabkan pencemaran air, tanah, udara, produk pertanian, keracunan manusia/pekerja, resistensi/resurgensi hama, terbunuhnya hewan bermanfaat, perubahan status hama, dan ledakan hama. Untuk itu dirasa perlu mencari pestisida alternatif untuk mendukung pertanian yang berkelanjutan . Melalui kegiatan penelitian yang bertahap telah diperoleh produk pestisida yang diesktrak dari sisa-sisa tanaman tembakau rakyat di lapang yaitu ekstrak 1, ekstrak 2, ekstrak 3, dan ekstrak 4.Kegiatan penelitian ini dilaksanakan di Laboratorium Entomologi Balai Penelitian Tanaman Pemanis dan Serat, Malang mulai bulan Januari sampai dengan Desember 2011.Tujuan penelitian untuk memanfaatkan tembakau sebagai bahan aktif pembuatan pestisida nabati.Untuk tiap-tiap ekstrak di buat lima macam konsentrasi, yaitu 100%, 50%, 25%, 12,5%, 6,25%, 3,125%, dan 0 (kontrol. Serangga uji yang digunakan adalah hama pengisap daun tembakau Myzus persicae. Masing-masing ulangan dengan 20 serangga uji.Data yang diperoleh dari setiap pengamatan dianalisis menggunakan Analisis Probit. Hasil penelitian menunjukkan bahwa empat ekstrak daun tembakau yang diuji terbukti menyebabkan toksisitas pada kutu daun tembakau M. persicae. Ekstrak 3 merupakan ekstrak yang paling toksit dibanding 3 ekstrak yang lain.  LC50 ekstrak 1, ekstrak 2, ekstrak 3, dan ekstrak 4 berturut-turut 35,53%, 26,93%, 5,08%, dan 5,2%. Kata kunci: Ekstrak tembakau, pestisida botani, M. persicae.

  10. Uso de cuatro extractos organicos para el control del pulgon verde (Myzus persicae Sulz (ING

    Directory of Open Access Journals (Sweden)

    Hernán Rodríguez Navas

    2016-03-01

    Full Text Available Extracts of leaves and stems of Neurolaena lobata; leaves, stems and fruits of Momordica charantia, wood of Quassia amara and seeds of Annona muricata, were tested regarding their effectiveness for control of green peach aphid (Myzus persicae. In a first stage, groups of 10 individuals of M. persicae were placed inside petri dishes together with a small and slight piece of synthetic cloth soaked with either substance extracted. Several concentrations were used. After two hours; more than 50% of the individuals had been killed in every petri dish, which allowed all extracts to pass on to the second stage. The second stage consisted of two experiments. The first one was done in spring at a greenhouse day temperature of 10°C,  using only the first three substances, each of them diluted 1:100. The second one was conducted in Summer at about 25°C with the four substances. Distilled water acted as a control in both experiments. Tobacco plants (Nicotiana tabacum infested with M. persicae were sprayed with the solutions and survivors counted 24 and 72 hours later. In the first experiment Q amara  and M. charantia had 78% and 77% effectiveness respectively, which were statiscally (P< 0.05 higher than that of N. lobata  (63%. In the second experiment, because of the warmer weather, they improved their performance, specially N. lobata (98%. This and A. muricata were found statistically (P< 0.05 higher than the others.

  11. The evolution of insecticide resistance in the peach potato aphid, Myzus persicae.

    Science.gov (United States)

    Bass, Chris; Puinean, Alin M; Zimmer, Christoph T; Denholm, Ian; Field, Linda M; Foster, Stephen P; Gutbrod, Oliver; Nauen, Ralf; Slater, Russell; Williamson, Martin S

    2014-08-01

    The peach potato aphid, Myzus persicae is a globally distributed crop pest with a host range of over 400 species including many economically important crop plants. The intensive use of insecticides to control this species over many years has led to populations that are now resistant to several classes of insecticide. Work spanning over 40 years has shown that M. persicae has a remarkable ability to evolve mechanisms that avoid or overcome the toxic effect of insecticides with at least seven independent mechanisms of resistance described in this species to date. The array of novel resistance mechanisms, including several 'first examples', that have evolved in this species represents an important case study for the evolution of insecticide resistance and also rapid adaptive change in insects more generally. In this review we summarise the biochemical and molecular mechanisms underlying resistance in M. persicae and the insights study of this topic has provided on how resistance evolves, the selectivity of insecticides, and the link between resistance and host plant adaptation. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  12. [Pathogenicity of hyphomycet fungi to aphids Aphis gossypii Glover and Myzus persicae (Sulzer) (Hemiptera: Aphididae)].

    Science.gov (United States)

    Loureiro, Elisângela de S; oino, Alcides

    2006-01-01

    The aphids Aphis gossypii and Myzus persicae are cosmopolitan, poliphagous and damage cultivated plants. The effects of the entomopathogenic fungi Beauveria bassiana (isolate IBCB 66), Metarhizium anisopliae (isolate IBCB 121), Paecilomyces fumosoroseus (isolate IBCB 141) and Lecanicillium (= Verticillium) lecanii (isolate JAB 02) on third instar nymphs of A. gossypii and M. persicae were evaluated in the laboratory at 25 degrees C, 70 +/- 10% RH and 12h photophase. The aphids were transferred to petri dishes with a foliar disk (cotton or pepper) with a layer of 1 cm tick of agar-water. The fungi were applied in a suspension containing 1.0 x 106 to 1.0 x 108 conidia/ml. In the control treatment 1 ml of sterilized water was added to the foliar disks. The mortality of aphids was evaluated daily. B. bassiana and M. anisopliae caused 100% mortality at the seventh day after inoculation, for both species. L. lecanii was the fungus that provided mortality later in the aphids and M. persicae was more susceptible to both fungi than A. gossypii.

  13. Suppression of plant defenses by a Myzus persicae (green peach aphid) salivary effector protein.

    Science.gov (United States)

    Elzinga, Dezi A; De Vos, Martin; Jander, Georg

    2014-07-01

    The complex interactions between aphids and their host plant are species-specific and involve multiple layers of recognition and defense. Aphid salivary proteins, which are released into the plant during phloem feeding, are a likely mediator of these interactions. In an approach to identify aphid effectors that facilitate feeding from host plants, eleven Myzus persicae (green peach aphid) salivary proteins and the GroEL protein of Buchnera aphidicola, a bacterial endosymbiont of this aphid species, were expressed transiently in Nicotiana tabacum (tobacco). Whereas two salivary proteins increased aphid reproduction, expression of three other aphid proteins and GroEL significantly decreased aphid reproduction on N. tabacum. These effects were recapitulated in stable transgenic Arabidopsis thaliana plants. Further experiments with A. thaliana expressing Mp55, a salivary protein that increased aphid reproduction, showed lower accumulation of 4-methoxyindol-3-ylmethylglucosinolate, callose and hydrogen peroxide in response to aphid feeding. Mp55-expressing plants also were more attractive for aphids in choice assays. Silencing Mp55 gene expression in M. persicae using RNA interference approaches reduced aphid reproduction on N. tabacum, A. thaliana, and N. benthamiana. Together, these results demonstrate a role for Mp55, a protein with as-yet-unknown molecular function, in the interaction of M. persicae with its host plants.

  14. Effect of Natural β-Glucosidase Inhibitors in Reducing Toxicity of Amygdalin in Persicae Semen.

    Science.gov (United States)

    Liu, Chao; Li, Xia; Yang, Honggai; Mao, Xinhui; Wang, Juan; Gao, Wenyuan

    2017-05-01

    Amygdalin can be decomposed into hydrocyanic acid, which is the primary source of Persicae Semen toxicity, by gut flora. Here, the inhibitory activity of β-glucosidase for test herb extracts was first determined and compared. In turn, optimization of the ratio of substrate and inhibitor in vitro and LD50 values of extracts, serum and liver contents of amygdalin in vivo was measured. Lycii Cortex was found to be the best inhibitory activity for β-glucosidase. The ratio of amygdalin-to-Lycii Cortex extract of 7.19:8.18 (mmol L-1 /mg mL-1 ) can be relatively suitable for inhibiting β-glucosidase activity in test in vitro reaction system. After mixed with Lycii Cortex extract, the toxicity of Persicae Semen ethanol extract in mice is significantly reduced and more amygdalin can be absorbed into the bloodstream. The study provides useful information for reducing toxicity of Persicae Semen and suggests how to better use these natural β-glucosidase inhibitors in the utilization of glycosides and aglycones. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  15. Relationship between LAI of Quercus persica and Pistacia atlantica with Field Spectroscopy

    Directory of Open Access Journals (Sweden)

    N. Poorghasemi

    2016-09-01

    Full Text Available Leaf area index (LAI is a key variable in primary production and carbon cycling in ecosystems. It is used as an important predictor to explain the processes of forest ecology, forest management, and remote sensing studies. Most of the remote sensing instruments such as LAI-2000 and Fisheye photography are based on three-dimensional space and they consider the geometry of the crown to estimate LAI. The aim of this study was to investigate the relationship between spectral behaviour of Quercus persica and Pistacia atlantica with two-dimensional and three-dimensional LAI. To estimate LAI, a box (0.5× 0.5× 0.5 meters was placed in the four directions of the crown and all the leaves were harvested. In situ spectral measurements of leaves were done with ASD Fieldspec spectroradiometer. The results of partial least squares regression to model LAI form spectral data of Quercus persica showed maximum regression coefficient at visible and near infrared wavelengths for both LAI3D and LAI2D. The coefficient of determination (R2 between the measured and estimated LAI2D and LAI3D values for Quercus persica was 0.16 and 0.23 respectively, and for Pistacia atlantica was 0.15 and to 0.42, respectively. Generally, LAI3D showed better relationship with spectral reflectance for both species.

  16. Aluminum-induced calcium deficiency in peach seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, J.H.; Horton, B.D.

    1977-07-01

    Total nutrient content, uptake rates, and distribution were determined for seedlings of peach (Prunus persica (L.) Batsch) grown in nutrient solutions containing 0, 222, 666, and 2000 ..mu..M Al. Generally, total nutrient content decreased in the peach seedling organs as Al concentration increased. The responses obtained with increased Al concentration were linear with some nutrients and curvilinear with others and varied with the plant organ. As Al concentration increased, the uptake rates for P, Ca, Mg, Zn, and Mn decreased by those for K and Fe increased. Aluminum did not alter the translocation of most nutrients; however, a greater percentage of the absorbed Ca accumulated in the leaves than in the roots or stems. Thus, aluminum toxicity in peaches may be related to a reduction in Ca uptake rate and not to inhibition in translocation of Ca.

  17. Aluminum toxicity symptoms in peach seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, J.H.; Horton, B.D.; Kirkpatrick, H.C.

    1976-03-01

    Elberta (Prunus persica (L.) Batsch) peach seedlings were grown in nutrient solutions for 27 days with aluminum concentrations of 0, 222, 666 and 2000 ..mu..m concentration induced Al toxicity symptoms in leaves and severely restricted root growth. The early stage of Al toxicity was characterized by marginal chlorosis that later developed into necrotic areas that extended along the veins toward the midrib. Advanced stages of toxicity were characterized by collapse of the midrib, terminal dieback and defoliation of the seedlings which are typical symptoms of calcium deficiency in peaches. At high Al concentrations roots died back and new roots developed as irregularly shaped cylinders with constrictions and enlargements at the root apex.

  18. Adaptability and stability of fruit set and production of peach trees in a subtropical climate

    Directory of Open Access Journals (Sweden)

    Idemir Citadin

    2014-04-01

    Full Text Available Brazilian peach breeding programs have been established to improve peach [Prunus persica (L. Batsch] production, yield consistency, quality, and disease resistance. Every year several genotypes are selected and their traits must be assessed. This study aimed to evaluate adaptability and stability of fruit set and production of peach genotypes in a subtropical climate, using the GGE biplot methodology. The experimental design was completely randomized with three replicates (trees in a factorial arrangement of 29 × 3 for genotype and growing season, respectively. The genotypes 'Conserva 1129', 'Rubimel', 'Kampai', 'Tropic Beauty', and 'Cascata 967' had the greatest adaptability and stability for fruit set. The genotypes 'Conserva 681', 'Santa Áurea', 'Atenas', 'Kampai', 'Cascata 962', 'Tropic Beauty' and 'Cascata 967' had the greatest production adaptability and stability. The GGE-biplot methodology classified the peach tree genotypes with regard to adaptability and stability of fruit set and production.

  19. Reação de genótipos de nectarina (Prunus persica var. nucipersica à ferrugem da folha, ao chumbinho e evolução da desfolha Reaction of genotypes of the nectarine (Prunus persica var. Nucipersica to leaf rust and shot hole, and the development of defoliation

    Directory of Open Access Journals (Sweden)

    Ricardo Antônio Ayub

    2013-06-01

    Full Text Available A resistência genética às doenças é um progresso na produção de todas as culturas e fontes de resistência devem ser reportadas, auxiliando os programas de melhoramento. O presente trabalho objetivou avaliar a resistência de genótipos de nectarina à ferrugem da folha e ao chumbinho, assim como, correlacionar a intensidade das doenças com a desfolha prematura. Foram avaliados três genótipos de nectarina em delineamento de blocos ao acaso com dez repeticões. Com base nos resultados obtidos, o genótipo Bruna mostrou-se resistente ao chumbinho e suscetível à ferrugem, ao passo que o genótipo Sunripe foi resistente à ferrugem; FLA 9-15N foi moderadamente suscetível à ferrugem. Houve correlação apenas entre severidade da ferrugem e desfolha.Genetic resistance to disease can be seen as progress in the production of all crops, and sources of resistance have to be reported, thus helping improvement programs. This study aimed to evaluate the resistance of nectarine genotypes to leaf rust and shot hole, as well as to correlate the severity of the diseases with premature defoliation. Three genotypes of the nectarine were evaluated in a randomized block design with ten replications. Based on the results, the genotype Bruna proved resistant to shot hole and susceptible to leaf rust, while the genotype Sunripe was resistant to leaf rust. FLA 9-15N was moderately susceptible to leaf rust. There was correlation between leaf-rust severity and defoliation only.

  20. The Cuticle Protein Gene MPCP4 of Myzus persicae (Homoptera: Aphididae) Plays a Critical Role in Cucumber Mosaic Virus Acquisition.

    Science.gov (United States)

    Liang, Yan; Gao, Xi-Wu

    2017-06-01

    Myzus persicae (Sulzer) (Homoptera: Aphididae) is one of the most important agricultural pests worldwide. In addition to sucking phloem sap, M. persicae also transmits Cucumber mosaic virus (CMV) as a vector in a nonpersistent manner. At present, the infection mechanism remains unclear, especially the process of aphid virus acquisition. In this study, we isolated four M. persicae cuticle protein genes (MPCP1, MPCP2, MPCP4, and MPCP5) from M. persicae. The relative amount of the gene encoding Cucumber mosaic virus capsid protein (CMV CP) and the transcript levels of these four cuticle protein genes were investigated in aphid virus acquisition by feeding the tobacco preinfested by CMV. The relative expression of MPCP1, MPCP2, and MPCP4 were significantly higher than MPCP5 at 24 h after aphids feeding on virus-infested tobacco. Yeast two-hybrid assays demonstrated that the protein encoded by MPCP4 gene was closely associated with the CMV CP through the direct interaction. Moreover, the ability of M. persicae to acquire CMV was suppressed by RNA interference of MPCP4. All these lines of evidence indicate that MPCP4, as a viral putative receptor in the stylet of aphid, plays an important role in aphid acquisition of CMV. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Molecular characterization of Prunus mahaleb L. rootstock canditates by ISSR markers

    Directory of Open Access Journals (Sweden)

    Ozyurt Ibrahim Kursat

    2013-01-01

    Full Text Available Prunus mahaleb is widely used as rootstocks particularly on calcareous and dry soils for both sweet and sour cherry cultivars in Turkey. Genetic diversity and relationships among members of Prunus mahaleb including 29 preselected rootstock candidate accessions from Tokat region in Turkey were investigated by using 15 ISSR markers. The study revealed high genetic diversity among accessions, detecting 138 fragments, of which 103 (75% were polymorphic. The number of polymorphic bands per primer was between 3-13, with average of 6.86. The primers 890 and 891 gave the highest polymorphism ratio (100%. The UPGMA dendrogram and the principal coordinate analysis revealed a clear differentiation among accessions. Reference rootstock, SL-64 clustered separately. The study demonstrates that ISSRs provide promising marker tools in revealing genetic diversity and relationships in Prunus mahaleb rootstock candidate accessions and can contribute to efficient identification, conservation, and utilization of germplasm for rootstock improvement through conventional as well as molecular breeding approaches.

  2. Antibacterial efficacy of Salvadora persica as a cleansing teeth towards Streptococcus mutans and Lactobacilli colonies

    Directory of Open Access Journals (Sweden)

    Erlina Sih Mahanani

    2012-12-01

    Full Text Available Background: Salvadora persica is a traditional chewing stick for cleaning teeth that it is known Siwak. Several studies have demonstrated the antimicrobial effects of Salvadora persica. Purpose: This study was aimed to examine the effectiveness of Salvadora persica in several modified preparation against the salivary Streptoccocus mutans and Lactobacilli. Methods: A single-blind, randomized clinical trial study with crossover design was used. The study comprised of 5 groups, per group consisted of 14 healthy dental students who had good oral hygiene. Each participant was given 5 intervention to clean their teeth using, electric toothbrush modified with siwak, electric toothbrush with siwak toothpaste (colgate kayu sugi toothpaste, electric toothbrush with general toothpaste (colgate total toothpaste, original siwak chewing stick and normal saline. The wash out periode each intervention was 3 days. Patients’ saliva was used to quantify the levels of Streptococcus mutans and Lactobacilli using caries risk test (CRT kit from Vivadent. Results: The results showed that there was a reduction in Streptococcus mutans and Lactobacilli risk score after cleansing different intervention except electric toothbrush modified with siwak. However, there was no significant difference for Streptococcus mutans (p=0.158 and Lactobacilli (p=0.396 risk score reduction when comparison was done between the groups. Conclusion: The original siwak chewing stick has antimicrobial effects similar to toothbrushing with general toothpaste and salvadora persica toothpaste. However, electric toothbrush modified with siwak has no effect on microbial reduction.Latar belakang: Salvadora persica adalah pembersih gigi tradisional yang lebih dikenal dengan sebutan Siwak. Beberapa penelitian menunjukkan bahwa Salvadora persica memiliki daya antibakteri. Tujuan: Penelitian ini bertujuan untuk mengetahui efektivitas Salvadora persica dalam berbagai bentuk sediaan untuk membersihkan

  3. Utilization of Amygdalin during Seedling Development of Prunus serotina.

    Science.gov (United States)

    Swain, E.; Poulton, J. E.

    1994-10-01

    Cotyledons of mature black cherry (Prunus serotina Ehrh.) seeds contain the cyanogenic diglucoside (R)-amygdalin. The levels of amygdalin, its corresponding monoglucoside (R)-prunasin, and the enzymes that metabolize these cyanoglycosides were measured during the course of seedling development. During the first 3 weeks following imbibition, cotyledonary amygdalin levels declined by more than 80%, but free hydrogen cyanide was not released to the atmosphere. Concomitantly, prunasin, which was not present in mature, ungerminated seeds, accumulated in the seedling epicotyls, hypocotyls, and cotyledons to levels approaching 4 [mu]mol per seedling. Whether this prunasin resulted from amygdalin hydrolysis remains unclear, however, because these organs also possess UDPG:mandelonitrile glucosyltransferase, which catalyzes de novo prunasin biosynthesis. The reduction in amygdalin levels was paralleled by declines in the levels of amygdalin hydrolase (AH), prunasin hydrolase (PH), mandelonitrile lyase (MDL), and [beta]-cyanoalanine synthase. At all stages of seedling development, AH and PH were localized by immunocytochemistry within the vascular tissues. In contrast, MDL occurred mostly in the cotyledonary parenchyma cells but was also present in the vascular tissues. Soon after imbibition, AH, PH, and MDL were found within protein bodies but were later detected in vacuoles derived from these organelles.

  4. Screening of solvent dependent antibacterial activity of Prunus domestica.

    Science.gov (United States)

    Yaqeen, Zahra; Naqvi, Naim-ul-Hasan; Sohail, Tehmina; Rehman, Zakir-ur; Fatima, Nudrat; Imran, Hina; Rehman, Atiqur

    2013-03-01

    Fruit of Prunus domestica was extracted in ethanol. The ethanol extract was further extracted with two solvents ethyl acetate and chloroform. The crude ethanol extract and two fractions (ethyl acetate and chloroform) were screened for their antibacterial activity using the agar well diffusion method .They were tested against nine bacteria; five Gram positive bacteria (Staphylococcus aureus, Streptococcuc intermedius, Bacillus cereus, Bacillus pumilus) and four Gram negative bacteria (Eschrichia coli, Proteus mirabilis Shigella flexneri, Salmonella typhi and Klebsiela pneumoniae). The susceptibility of microorganisms to all three fractions was compared with each other and with standard antibiotic (Ampicillin) Among all fractions ethyl acetate exhibited highest antibacterial activity (average zone of inhibition 34.57mm ± 1.3) while ethyl alcohol exhibited least antibacterial activity (average zone of inhibition 17.42mm ± 3.3). Minimum inhibitory concentration of ethanol, ethyl acetate and chloroform fractions was found in the range of 78 μ g/ml to 2500 μ gl/ml against gram positive and gram negative bacteria.

  5. Intensidade de raleio de frutos em pessegueiros 'flordaprince' conduzidos em pomar com alta densidade de plantio Intensity of fruit thinning in peaches 'flordaprince' conducted in orchard of high density

    Directory of Open Access Journals (Sweden)

    JOÃO ALEXIO SCARPARE FILHO

    2000-06-01

    Full Text Available O objetivo deste trabalho foi verificar o comportamento de pessegueiros (Prunus persica (L. Batsch. cultivar Flordaprince, conduzidos em pomar com alta densidade (3.333 plantas/ha, submetidos a diferentes intensidades de raleio manual de frutos. Os tratamentos utilizados foram 120, 100 e 80 frutos por planta, e o controle sem raleio (230 frutos por planta. As plantas submetidas ao raleio produziram frutos significativamente maiores e mais pesados do que os do controle. A produção por planta (kg e a produtividade estimada (t/ha foram maiores nas plantas sem raleio, mas a classificação comercial e a receita bruta (R$/ha desse tratamento foram menores, devido ao menor tamanho e peso dos frutos. Os tratamentos 100 e 80 frutos por planta (56,52% e 65,21% de raleio, respectivamente apresentaram os melhores resultadosThe objective of this paper was to test the behavior of peaches (Prunus persica (L. Batsch. cultivar Flordaprince carried out in high dense orchard (3,333 plants/ha submitted to different intensities of hand thinning of fruits. The treatments tested were 120, 100 and 80 fruits per plant and without thinning (230 fruits per plant. The thinned plants produced larger and weightier fruits if compared with control plants. The yield per plant (kg and estimated productivity (ton/ha were higher in plants not thinned, but marketing classification and gross income were lower in this treatment due to small fruit size and weight. The treatments 100 and 80 fruits per plant (56.52% and 65.21% of thinning, respectively presented the best results.

  6. Incremento no desenvolvimento do porta-enxerto de pessegueiro "Aldrighi" por fungos micorrízicos arbusculares autóctones Development increase of 'Aldrighi' peach rootstocks by indigenous arbuscular mycorrhizal fungi

    Directory of Open Access Journals (Sweden)

    José Luis da Silva Nunes

    2008-12-01

    Full Text Available Objetivou-se, neste trabalho, avaliar a influência de três espécies de fungos micorrízicos arbusculares (FMA isolados de pomares de pessegueiro sobre o crescimento vegetativo, nutrição mineral e substâncias de reserva em plantas do porta-enxerto de pessegueiro cv. Aldrighi [Prunus persica (L. Batsch]. O delineamento experimental utilizado foi o de blocos casualizados, com dez plantas por parcela e quatro repetições. As plantas inoculadas com Glomus etunicatum apresentaram maior altura, diâmetro, área foliar, biomassa fresca e seca, nutrição mineral e substâncias de reserva da parte aérea, enquanto as inoculadas com Glomus clarum induziram um crescimento intermediário, superior àquelas inoculadas com Gigaspora margarita, que apresentaram resultados semelhantes às plantas não inoculadas. O desempenho foi relacionado com as taxas de colonização que nas plantas inoculadas com Glomus etunicatum e Glomus clarum foram de 92% e 77% respectivamente, enquanto Gigaspora margarita colonizou somente 30% das raízes.This work aimed to evaluate the influence of three arbuscular mycorrhizal fungi (AMF species on the vegetative growth, mineral nutrition and carbohidrate contents on peach rootstocks cv. Aldrighi [Prunus persica (L. Batsch]. The experimental desing was the one of randomized blocks, with ten plants per plots and four repetitions. Plants inoculated with Glomus etunicatum presented larger stem height, stem diameter, foliar area, fresh and dry shoot biomass, leaf mineral nutrition and carbohidrate contents, while those inoculated with Glomus clarum induced an intermediate growth, higher to those inoculated with Gigaspora margarita that presented results similar to the non inoculated plants. Plant growth performance was related to colonization taxes, which were, respectively, 92%, 77% and 30% to Glomus etunicatum, Glomus clarum and Gigaspora margarita inoculated plants.

  7. Insecticidal activity of citronella grass essential oil on Frankliniella schultzei and Myzus persicae Atividade inseticida do óleo essencial de capim-citronela sobre Frankliniella schultzei e Myzus persicae

    Directory of Open Access Journals (Sweden)

    Patrícia Fontes Pinheiro

    2013-04-01

    Full Text Available The thrips, Frankliniella schultzei, and green peach aphid, Myzus persicae, cause direct damage to plants of economic importance and transmit phytoviruses, causing large economic losses. Chemical constituents of essential oils present a wide range of biological activities. The aim of this work was to evaluate insecticidal activity of essential oil from citronella grass, Cymbopogon winterianus, on F. schultzei and M. persicae. This essential oil was obtained by steam distillation and components were identified by GC/FID and GC/MS. A Potter spray tower was used to spray insects with the essential oil. The major constituents are geraniol (28.62%, citronellal (23.62% and citronellol (17.10%. Essential oil of C. winterianus at 1% (w v-1 causes mortality in F. schultzei and M. persicae at 34.3% and 96.9%, respectively. The LC50 value for M. persicae was 0.36% and LC90 0.66%. Thus, citronella grass essential oil at 1% (w v-1 is more toxic to M. persicae than F. schultzei. This essential oil shows promise for developing pesticides to manage M. persicae.O tripes, Frankliniella schultzei, e o pulgão-verde, Myzus persicae, além de causarem danos diretos a plantas de importância econômica, também são importantes transmissores de fitoviroses, acarretando grandes perdas econômicas. Os constituintes químicos dos óleos essenciais têm sido cada vez mais estudados, pois apresentam uma ampla gama de atividades biológicas. Neste trabalho, objetivou-se avaliar a atividade inseticida do óleo essencial de capim-citronela, Cymbopogon winterianus, sobre F. schultzei e M. persicae. O óleo essencial foi obtido por hidrodestilação e a identificação dos seus componentes foi realizada por CG/DIC e CG/EM. Uma torre de Potter foi utilizada para pulverizar os insetos com óleo essencial. Os componentes majoritários encontrados são geraniol (28,62%, citronelal (23,62% e citronelol (17,10%. O óleo essencial de C. winterianus a 1% (m v-1 causa mortalidade de F

  8. [Determination of elements in the leaves of Prunus mongolica by ICP-AES].

    Science.gov (United States)

    Niu, Shu-Fang; Shi, Song-Li; Wang, Deng-Kui; Cheng, Xiang-Hui; Liu, Zong-Qiang

    2013-01-01

    For determination of elements in the leaves of Prunus mongolica, the samples were digested by nitric acid-perchloric. The contents of Ca, Mg, Fe, Mn, Cu, Zn, Al, Sr, Sn and Pb in the leaves of Prunus mongolica were determined by ICP-AES, at the same time a blank experiment was carried out. The results showed that the recovery rate of the ten elements was between 93% and 110%, and the relative standard deviation was between 0.33% and 2.94%. This method is fast, simple and accurate.

  9. Light conditions affect the performance of Yponomeuta evonymellus on its native host Prunus padus and the alien Prunus serotina.

    Science.gov (United States)

    Łukowski, A; Giertych, M J; Walczak, U; Baraniak, E; Karolewski, P

    2017-04-01

    The bird cherry ermine moth, Yponomeuta evonymellus L., is considered an obligatory monophagous insect pest that feeds only on native European Prunus padus L. In recent years, however, increased larval feeding on alien P. serotina Ehrh. has been observed. In both species, general defoliation is extensive for shade grown trees, whereas it is high in P. padus, but very low in P. serotina, when trees are grown in full light conditions. The aim of the present study was to identify how the plant host species and light conditions affect the performance of Y. evonymellus. The influence of host species and light condition on their growth and development, characterized by the parameters of pupation, adult eclosion, body mass, potential fecundity, and wing size, was measured in a 2 × 2 experimental design (two light treatments, two hosts). In comparison with high light (HL) conditions, a greater percentage of pupation and a longer period and less dynamic adult emerge was observed under low light (LL) conditions. The effect of host species on these parameters was not significant. In contrast, mass, fecundity and all of the studied wing parameters were higher in larvae that grazed on P. padus than on P. serotina. Similarly the same parameters were also higher on shrubs in HL as compared with those grown under LL conditions. In general, light conditions, rather than plant species, were more often and to a greater extent, responsible for differences in the observed parameters of insect development and potential fecundity.

  10. Dynamics of membrane potential variation and gene expression induced by Spodoptera littoralis, Myzus persicae, and Pseudomonas syringae in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Irene Bricchi

    Full Text Available BACKGROUND: Biotic stress induced by various herbivores and pathogens invokes plant responses involving different defense mechanisms. However, we do not know whether different biotic stresses share a common response or which signaling pathways are involved in responses to different biotic stresses. We investigated the common and specific responses of Arabidopsis thaliana to three biotic stress agents: Spodoptera littoralis, Myzus persicae, and the pathogen Pseudomonas syringae. METHODOLOGY/PRINCIPAL FINDINGS: We used electrophysiology to determine the plasma membrane potential (V(m and we performed a gene microarray transcriptome analysis on Arabidopsis upon either herbivory or bacterial infection. V(m depolarization was induced by insect attack; however, the response was much more rapid to S. littoralis (30 min -2 h than to M. persicae (4-6 h. M. persicae differentially regulated almost 10-fold more genes than by S. littoralis with an opposite regulation. M. persicae modulated genes involved in flavonoid, fatty acid, hormone, drug transport and chitin metabolism. S. littoralis regulated responses to heat, transcription and ion transport. The latest Vm depolarization (16 h was found for P. syringae. The pathogen regulated responses to salicylate, jasmonate and to microorganisms. Despite this late response, the number of genes differentially regulated by P. syringae was closer to those regulated by S. littoralis than by M. persicae. CONCLUSIONS/SIGNIFICANCE: Arabidopsis plasma membranes respond with a V(m depolarization at times depending on the nature of biotic attack which allow setting a time point for comparative genome-wide analysis. A clear relationship between V(m depolarization and gene expression was found. At V(m depolarization timing, M. persicae regulates a wider array of Arabidopsis genes with a clear and distinct regulation than S. littoralis. An almost completely opposite regulation was observed between the aphid and the pathogen

  11. Benzyl isothiocyanate, a major component from the roots of Salvadora persica is highly active against Gram-negative bacteria.

    Directory of Open Access Journals (Sweden)

    Abier Sofrata

    Full Text Available Plants produce a number of antimicrobial substances and the roots of the shrub Salvadora persica have been demonstrated to possess antimicrobial activity. Sticks from the roots of S. persica, Miswak sticks, have been used for centuries as a traditional method of cleaning teeth. Diverging reports on the chemical nature and antimicrobial repertoire of the chewing sticks from S. persica led us to explore its antibacterial properties against a panel of pathogenic or commensal bacteria and to identify the antibacterial component/s by methodical chemical characterization. S. persica root essential oil was prepared by steam distillation and solid-phase microextraction was used to sample volatiles released from fresh root. The active compound was identified by gas chromatography-mass spectrometry and antibacterial assays. The antibacterial compound was isolated using medium-pressure liquid chromatography. Transmission electron microscopy was used to visualize the effect on bacterial cells. The main antibacterial component of both S. persica root extracts and volatiles was benzyl isothiocyanate. Root extracts as well as commercial synthetic benzyl isothiocyanate exhibited rapid and strong bactericidal effect against oral pathogens involved in periodontal disease as well as against other Gram-negative bacteria, while Gram-positive bacteria mainly displayed growth inhibition or remained unaffected. The short exposure needed to obtain bactericidal effect implies that the chewing sticks and the essential oil may have a specific role in treatment of periodontal disease in reducing Gram-negative periodontal pathogens. Our results indicate the need for further investigation into the mechanism of the specific killing of Gram-negative bacteria by S. persica root stick extracts and its active component benzyl isothiocyanate.

  12. The Issues of Apricot (Prunus Armeniaca L. Micropropagation

    Directory of Open Access Journals (Sweden)

    Martina Kudělková

    2017-01-01

    Full Text Available The effect of four modified mediums for apricot multiplication was observed in this study. A total number of 1864 single nodes of 20 Prunus armeniaca L.varieties were established. Explants surface was disinfected with 0.2 % mercuric chloride for 5 minutes. MS (1962 medium with 0.5 mg.l−1 BA, 0.01 mg.l−1 NAA and 0.5 mg.l−1 GA3 was used as a medium for primary culture. ‘Velkopavlovická’, ‘Bergeron’, genotype 1128 and genotype LE 2927 Š9 were successfully transferred to aseptic conditions and multiplied. Modified MS medium (1962, DKW/Juglans medium, Quoirin, Lepoivre (1977 medium and Marino et al. (1991 medium were used for multiplication. Modified MS medium and modified DKW/Juglans medium were not suitable for apricot multiplication at all and explants did not grow. The best results were observed in the case of Quoirin, Lepoivre (1977 medium with 0.4 mg.l−1 BA and 0.01 mg.l−1 NAA. Young plants multiplied well, were fresh and vital and no damage was observed. The highest number of new shoots was observed in the case of Marino et al. (1991 medium. The average growth of new shoots after the last passaging was 600 %, rate 7.33 (Velkopavlovická; 566 %, rate 7.0 (Bergeron; 475 %, rate 6.25 (1128 and 483 %, rate 6.33 (LE 2927 Š9. However, new shoots in clusters were too dense and stunted and this medium is not recommended for apricot multiplication.

  13. Prunus serotina Amygdalin Hydrolase and Prunasin Hydrolase 1

    Science.gov (United States)

    Li, Chun Ping; Swain, Elisabeth; Poulton, Jonathan E.

    1992-01-01

    In black cherry (Prunus serotina Ehrh.) seed homogenates, amygdalin hydrolase (AH) participates with prunasin hydrolase (PH) and mandelonitrile lyase in the sequential degradation of (R)-amygdalin to HCN, benzaldehyde, and glucose. Four isozymes of AH (designated AH I, I′, II, II′) were purified from mature cherry seeds by concanavalin A-Sepharose 4B chromatography, ion-exchange chromatography, and chromatofocusing. All isozymes were monomeric glycoproteins with native molecular masses of 52 kD. They showed similar kinetic properties (pH optima, Km, Vmax) but differed in their isoelectric points and N-terminal amino acid sequences. Analytical isoelectric focusing revealed the presence of subisozymes of each isozyme. The relative abundance of these isozymes and/or subisozymes varied from seed to seed. Three isozymes of PH (designated PH I, IIa, and IIb) were purified to apparent homogeneity by affinity, ion-exchange, and hydroxyapatite chromatography and by nondenaturing polyacrylamide gel electrophoresis. PH I and PH IIb are 68-kD monomeric glycoproteins, whereas PH IIa is dimeric (140 kD). The N-terminal sequences of all PH and AH isozymes showed considerable similarity. Polyclonal antisera raised in rabbits against deglycosylated AH I or a mixture of the three deglycosylated PH isozymes were not monospecific as judged by immunoblotting analysis, but also cross-reacted with the opposing glucosidase. Monospecific antisera deemed suitable for immunocytochemistry and screening of expression libraries were obtained by affinity chromatography. Each antiserum recognized all known isozymes of the specific glucosidase used as antigen. Images Figure 2 Figure 3 Figure 4 Figure 5 Figure 6 Figure 7 Figure 9 PMID:16652959

  14. Insecticide Resistance Mechanisms in the Green Peach Aphid Myzus persicae (Hemiptera: Aphididae) I: A Transcriptomic Survey

    Science.gov (United States)

    Silva, Andrea X.; Jander, Georg; Samaniego, Horacio; Ramsey, John S; Figueroa, Christian C.

    2012-01-01

    Background Insecticide resistance is one of the best examples of rapid micro-evolution found in nature. Since the development of the first synthetic insecticide in 1939, humans have invested considerable effort to stay ahead of resistance phenotypes that repeatedly develop in insects. Aphids are a group of insects that have become global pests in agriculture and frequently exhibit insecticide resistance. The green peach aphid, Myzus persicae, has developed resistance to at least seventy different synthetic compounds, and different insecticide resistance mechanisms have been reported worldwide. Methodology/Principal Findings To further characterize this resistance, we analyzed genome-wide transcriptional responses in three genotypes of M. persicae, each exhibiting different resistance mechanisms, in response to an anti-cholinesterase insecticide. The sensitive genotype (exhibiting no resistance mechanism) responded to the insecticide by up-regulating 183 genes primarily ones related to energy metabolism, detoxifying enzymes, proteins of extracellular transport, peptidases and cuticular proteins. The second genotype (resistant through a kdr sodium channel mutation), up-regulated 17 genes coding for detoxifying enzymes, peptidase and cuticular proteins. Finally, a multiply resistant genotype (carrying kdr and a modified acetylcholinesterase), up-regulated only 7 genes, appears not to require induced insecticide detoxification, and instead down-regulated many genes. Conclusions/Significance This study suggests strongly that insecticide resistance in M. persicae is more complex that has been described, with the participation of a broad array of resistance mechanisms. The sensitive genotype exhibited the highest transcriptional plasticity, accounting for the wide range of potential adaptations to insecticides that this species can evolve. In contrast, the multiply resistant genotype exhibited a low transcriptional plasticity, even for the expression of genes encoding

  15. Insecticide Resistance Mechanisms in the Green Peach Aphid Myzus persicae (Hemiptera: Aphididae) II: Costs and Benefits

    Science.gov (United States)

    Silva, Andrea X.; Bacigalupe, Leonardo D.; Luna-Rudloff, Manuela; Figueroa, Christian C.

    2012-01-01

    Background Among herbivorous insects that have exploited agro-ecosystems, the peach-potato aphid, Myzus persicae, is recognized as one of the most important agricultural pests worldwide. Uses over 400 plant species and has evolved different insecticides resistance mechanisms. As M. persicae feeds upon a huge diversity of hosts, it has been exposed to a wide variety of plant allelochemicals, which probably have promoted a wide range of detoxification systems. Methodology/Principal Findings In this work we (i) evaluated whether insecticide resistance mutations (IRM) in M. persicae can give an advantage in terms of reproductive fitness when aphids face two hosts, pepper (Capsicum annuum) a suitable host and radish (Raphanus sativus) the unfavorable host and (ii) examined the transcriptional expression of six genes that are known to be up-regulated in response to insecticides. Our results show a significant interaction between host and IRM on the intrinsic rate of increase (rm). Susceptible genotypes (not carrying insensitivity mutations) had a higher rm on pepper, and the transcriptional levels of five genes increased on radish. The rm relationship was reversed on the unfavorable host; genotypes with multiple IRM exhibited higher rm, without altering the transcriptional levels of the studied genes. Genotypes with one IRM kept a similar rm on both hosts, but they increased the transcriptional levels of two genes. Conclusions/Significance Although we have studied only nine genotypes, overall our results are in agreement with the general idea that allelochemical detoxification systems could constitute a pre-adaptation for the development of insecticide resistance. Genotypes carrying IRM exhibited a higher rm than susceptible genotypes on radish, the more unfavorable host. Susceptible genotypes should be able to tolerate the defended host by up-regulating some metabolic genes that are also responding to insecticides. Hence, our results suggest that the trade-off among

  16. Insecticide resistance mechanisms in the green peach aphid Myzus persicae (Hemiptera: Aphididae I: A transcriptomic survey.

    Directory of Open Access Journals (Sweden)

    Andrea X Silva

    Full Text Available BACKGROUND: Insecticide resistance is one of the best examples of rapid micro-evolution found in nature. Since the development of the first synthetic insecticide in 1939, humans have invested considerable effort to stay ahead of resistance phenotypes that repeatedly develop in insects. Aphids are a group of insects that have become global pests in agriculture and frequently exhibit insecticide resistance. The green peach aphid, Myzus persicae, has developed resistance to at least seventy different synthetic compounds, and different insecticide resistance mechanisms have been reported worldwide. METHODOLOGY/PRINCIPAL FINDINGS: To further characterize this resistance, we analyzed genome-wide transcriptional responses in three genotypes of M. persicae, each exhibiting different resistance mechanisms, in response to an anti-cholinesterase insecticide. The sensitive genotype (exhibiting no resistance mechanism responded to the insecticide by up-regulating 183 genes primarily ones related to energy metabolism, detoxifying enzymes, proteins of extracellular transport, peptidases and cuticular proteins. The second genotype (resistant through a kdr sodium channel mutation, up-regulated 17 genes coding for detoxifying enzymes, peptidase and cuticular proteins. Finally, a multiply resistant genotype (carrying kdr and a modified acetylcholinesterase, up-regulated only 7 genes, appears not to require induced insecticide detoxification, and instead down-regulated many genes. CONCLUSIONS/SIGNIFICANCE: This study suggests strongly that insecticide resistance in M. persicae is more complex that has been described, with the participation of a broad array of resistance mechanisms. The sensitive genotype exhibited the highest transcriptional plasticity, accounting for the wide range of potential adaptations to insecticides that this species can evolve. In contrast, the multiply resistant genotype exhibited a low transcriptional plasticity, even for the expression

  17. Soil feedback and pathogen activity in Prunus serotina throughout its native range

    Science.gov (United States)

    Kurt O. Reinhart; Alejandro Royo; Wim H. Van der Putten; Keith Clay

    2005-01-01

    1 Oomycete soil pathogens are known to have a negative effect on Prunus serotina seedling establishment and to promote tree diversity in a deciduous forest in Indiana, USA. Here, we investigate whether negative feedbacks operate widely in its native range in eastern USA. 2 In laboratory experiments, soil sterilization was used to test the...

  18. Agrobacterium-medicated transformation of mature Prunus serotina (black cherry) and regeneration of trangenic shoots

    Science.gov (United States)

    Xiaomei Liu; Paula Pijut

    2010-01-01

    A protocol for Agrobacterium-mediated transformation was developed for in vitro leaf explants of an elite, mature Prunus serotina tree. Agrobacterium tumefaciens strain EHA105 harboring an RNAi plasmid with the black cherry AGAMOUS (AG) gene was used. Bacteria were induced...

  19. Molecular mechanisms regulating flowering time in sweet cherry (Prunus avium L.)

    DEFF Research Database (Denmark)

    Ionescu, Irina Alexandra

    as a result of hydrogen cyanamide treatment: the jasmonate pathway, the hydrogen cyanide pathway and the cytokinin pathway. We further analyzed the levels of cyanogenic glucosides and their derivatives during endodormancy and its release in sweet cherry and almond (Prunus dulcis (Mill.) D. A. Webb). Prunasin...

  20. Soil feedback and pathogen activity in Prunus serotina throughout its native range

    NARCIS (Netherlands)

    Reinhart, K.O.; Royo, A.A.; Putten, van der W.H.; Clay, K.

    2005-01-01

    1 Oomycete soil pathogens are known to have a negative effect on Prunus serotina seedling establishment and to promote tree diversity in a deciduous forest in Indiana, USA. Here, we investigate whether negative feedbacks operate widely in its native range in eastern USA. 2 In laboratory experiments,

  1. Adventitious shoot regeneration and rooting of Prunus serotina in vitro cultures

    Science.gov (United States)

    Ana Carolina Espinosa; Paula M. Pijut; Charles H. Michler

    2006-01-01

    A complete regeneration protocol was developed for Prunus serotina Ehrh., an important hardwood species for timber and sawlog production in the central and eastern United States. Nodal sections were cultures on Murashige and Skoog (MS) medium supplemented with 4.44 µM 6-benzylaminopurine (BA), 0.49 µM indole-3-butyric acid (IBA),...

  2. Kirsipuu (Prunus avium) : [luuletused] / R. W. Stedingh ; tlk. ja saatesõna: Jüri Talvet

    Index Scriptorium Estoniae

    Stedingh, R. W.

    2003-01-01

    Sisu: Kirsipuu (Prunus avium) ; Rubus spectabilis ; Rododendron (Rhododendron macrophyllum) ; Lysuchitum americanum ; Tulp (Tulipa gesneriana) ; Kanada hani (Branta canadensis) ; Metsorava pärastlõuna (Sciurus carolinensis) ; Ohakalind (Spinus tristis) ; Shakespeare'i mälestusmärk (kogust "Stanley pargi süit")

  3. Cloning and characterization of prunus serotina AGAMOUS, a putative flower homeotic gene

    Science.gov (United States)

    Xiaomei Liu; Joseph Anderson; Paula Pijut

    2010-01-01

    Members of the AGAMOUS subfamily of MADS-box transcription factors play an important role in regulating the development of reproductive organs in flowering plants. To help understand the mechanism of floral development in black cherry (Prunus serotina), PsAG (a putative flower homeotic identity gene) was isolated...

  4. Sour Cherry (Prunus cerasus L.) Anthocyanins: effects of juice processing on phenolic compounds and bioavailability

    NARCIS (Netherlands)

    Toydemir, G.; Boyacioglu, D.; Beekwilder, M.J.; Vos, de R.C.H.; Hall, R.D.; Capanoglu, E.

    2014-01-01

    Sour cherry (Prunus cerasus L.), has gained growing interest in recent years due to the envisaged health benefits associated with a regular intake of anthocyanins and related polyphenolic compounds. Turkish sour cherries are widely consumed as processed products and are renowned for their high juice

  5. Changes in sour cherry (Prunus cerasus L.) antioxidants during nectar processing and in vitro gastrointestinal digestion.

    NARCIS (Netherlands)

    Toydemir, G.; Capanoglu, E.; Kamiloglu, S.; Boyacioglu, D.; Vos, de C.H.; Hall, R.D.; Beekwilder, M.J.

    2013-01-01

    Sour cherry (Prunus cerasus L.) is rich in polyphenols, and like its processed products, is especially rich in anthocyanins. We have applied HPLC, spectrophotometric and on-line antioxidant detection methods to follow the fate of cherry antioxidants during an entire multi-step industrial-scale

  6. Mass of Prunus africana stem barks on Tchabal mbabo and Tchabal ...

    African Journals Online (AJOL)

    A study which aimed to produce a formula for establishing the mass of the bark of Prunus africana specimens was carried out in May 2011 on Tchabal Mbabo and Tchabal Gang Daba mountain forests, in the Adamaoua region of Cameroon. The diameter at breast height (DBH), the height of the tree and the thickness of the ...

  7. A synonymic revision of the Prunus-infesting aphid genus Hyalopterus Koch 1854 (Hemiptera: Aphididae)

    Science.gov (United States)

    The three species of Hyalopterus Koch cause economic damage to various stone fruit trees of the genus Prunus L., H. pruni (Geoffroy), H. amygdali (Blanchard), and H. persikonus Miller et al. Although the third species was established recently, it has been suggested that one of the twelve older synon...

  8. Quantitative analysis of amygdalin and prunasin in Prunus serotina Ehrh. using 1H-NMR spectroscopy

    NARCIS (Netherlands)

    Santos Pimenta, Lucia P.; Schilthuizen, Menno; Verpoorte, Robert; Choi, Young Hae

    Introduction Prunus serotina is native to North America but has been invasively introduced in Europe since the seventeenth century. This plant contains cyanogenic glycosides that are believed to be related to its success as an invasive plant. For these compounds, chromatographic- or

  9. Can Prunus serotina be genetically engineered for reproductive sterility and insect pest resistance?

    Science.gov (United States)

    Ying Wang; Paula M. Pijut

    2014-01-01

    Black cherry (Prunus serotina) is a valuable hardwood timber species, and its value highly depends on the wood quality which is often threatened by insect pests. Transgenic black cherry plants that are more resistant to cambial-mining insects may reduce the occurrence of gummosis and have great economic benefits to landowners and the forest products...

  10. Plant regeneration from in vitro leaves of mature black cherry (Prunus serotina)

    Science.gov (United States)

    Xiaomei Liu; Paula M. Pijut

    2008-01-01

    A regeneration system was developed for Prunus serotina from a juvenile (F) and two mature genotypes (#3 and #4). Adventitious shoots regenerated from leaves of in vitro cultures on woody plant medium with thidiazuron (TDZ) and naphthaleneacetic acid (NAA). The best regeneration for genotype F (91.4%) was observed on medium with 9.08 µM TDZ...

  11. Performance of Prunus rootstocks in the 2001 NC-140 peach trial

    Science.gov (United States)

    Fourteen Prunus rootstock cultivars and selections budded with either ‘Redtop’, ‘Redhaven’ or ‘Cresthaven’ peach were planted at 11 locations in North America in 2001 in a randomized block design with a tree spacing of 5 by 6 m and 8 replicates. These rootstocks included three peach seedling rootst...

  12. The anti-viral effect of Acacia mellifera, Melia azedarach and Prunus ...

    African Journals Online (AJOL)

    Aqueous extracts from the stem barks of Prunus africana(Hook.f.) Kalkm, Acacia mellifera (Vahl.) Benth. and Melia azedarach L. were evaluated for in vivo antiviral activity in Balb/C mice following a cutaneous wild type strain 7401H herpes simplex virus type 1 (HSV-1) infection. A significant therapeutic effect was observed ...

  13. Transformation of somatic embryos of Prunus incisa ‘February Pink’ with a visible reporter gene

    Science.gov (United States)

    An Agrobacterium-mediated transformation system was developed for the ornamental cherry species Prunus incisa. This system uses both an antibiotic resistance gene (NPTII) and a visible selectable marker, the green fluorescent protein (GFP), to select plants. Cells from leaf and root explants were tr...

  14. Antioxidant properties and prevention of cell cytotoxicity of Phlomis persica Boiss

    Directory of Open Access Journals (Sweden)

    Moein S.

    2007-05-01

    Full Text Available The free radical scavenging capacity, reducing power and inhibition of β–carotene peroxidation of Phlomis persica (PP extracts was investigated. In addition, the effect of this extract on reduction of the hydrogen peroxide-induced cytotoxicity in non-immortalized fibroblast was examined. The extracts showed free radical scavenging capacity, and the ethyl acetate extract showed marked effect on inhibition of lipid peroxidation similar to that of gallic acid. These results were further supported by a protective effect of Phlomis crude extract on H2O2-induced cytotoxicity in human non-immortalized fibroblasts.

  15. AVALIAÇÃO DA COMPATIBILIDADE DA ENXERTIA EM Prunus sp. EVALUATION OF THE GRAFT COMPATIBILITY IN Prunus sp.

    Directory of Open Access Journals (Sweden)

    ALEXANDRE COUTO RODRIGUES

    2001-08-01

    Full Text Available A atividade de peroxidase e concentração de fenóis foi determinada com o objetivo de se avaliar aspectos de compatibilidade entre porta-enxertos e enxertos. As amostras foram processadas e obtidas a partir da casca e lenho dos porta-enxertos de pessegueiros (GF 677, Okinawa, Capdeboscq e Aldrighi e de ameixeiras (Mirabolano e Marianna, enxertados ou não com as cultivares Diamante, Eldorado e Santa Rosa. Concluiu-se que a atividade de peroxidase e a concentração de fenóis foram relacionadas com união entre enxerto e porta-enxerto, particularmente, em Marianna e Mirabolano, onde a atividade de peroxidase e a concentração de fenóis foram mais elevados. A cultivar Santa Rosa foi compatível tanto com os porta-enxertos de ameixeiras quanto com os de pessegueiros.The work was accomplished aiming to quantify the peroxidase activity and total phenols, in order to verify the physiological and biochemical processes in grafting of Prunus sp. cultivars. The samples were processed and obtained in bark and wood of the peach rootstocks (GF 677, Okinawa, Capdeboscq and Aldrighi and plum rootstocks (Mirabolano and Marianna, after they had or not been grafted with the stock Diamante, Eldorado and Santa Rosa. It could be concluded that the peroxidase and the total phenols activity influenced the union between stock and rootstock; after grafting, the incompatibility degree is related with high peroxidase activity and total phenols in the rootstock Marianna and Mirabolano. The Santa Rosa plum graft is as compatible to plum rootstocks as to the peach ones.

  16. Differences in the Detoxification Metabolism between Two clonal Lineages of the Aphid Myzus persicae (Sulzer (Hemiptera: Aphididae Reared on Tobacco (Nicotiana tabacum L. Diferencias en el Metabolismo de Detoxificación entre dos Linajes Clonales del Áfido Myzus persicae (Sulzer (Hemiptera: Aphididae creados sobre tabaco (Nicotiana tabacum L.

    Directory of Open Access Journals (Sweden)

    Marco A Cabrera-Brandt

    2010-12-01

    Full Text Available Myzus persicae (Sulzer is a highly polyphagous aphid species, with a subspecies (M. persicae nicotianae well adapted to tobacco (Nicotiana tabacum L.. We evaluated the effect of this host plant on the aphid performance and detoxification enzymes, in order to test the participation of xenobiotic metabolism on the ability of this aphid to overcome the tobacco chemical defences. Two genotypes, one corresponding to the only M. persicae nicotianae genotype reported in Chile on tobacco, and one genotype belonging to M. persicae sensu stricto were reared on tobacco and pepper (Capsicum annuum L., respectively. M. persicae nicotianae showed a significantly higher intrinsic rate of increase (r m on pepper than on tobacco, and M. persicae s.s. performed similarly, but with no reproduction at all on tobacco. In order to evaluate the effect of tobacco on detoxification enzymes, esterases, glutathione S-transferases (GST and cytochrome P-450 monooxygenases (MO were determined in both selected aphid genotypes after 12, 24, 36, 48 and 72 h of rearing on tobacco and pepper. M. persicae nicotianae exhibited the higher total esterase activities when reared on tobacco than on pepper after 48 h of rearing, while the activities of GST and MO did not show any significant difference between host-plants and duration of treatment. For M. persicae s.s., no significant differences were observed among host-plants for the studied enzymes. These results suggest a participation of the esterases, on the ability of this M. persicae nicotianae to overcome the tobacco defences.Myzus persicae (Sulzer es un áfido polífago que incluye a Myzus persicae nicotianae, una subespecie altamente adaptada sobre tabaco (Nicotiana tabacum L.. Evaluamos el efecto del tabaco sobre el desempeño biológico y sobre determinadas enzimas de detoxificación en áfidos, para estudiar su participación en la capacidad de M. persicae nicotianae de superar las defensas químicas del tabaco. Dos

  17. THE EFFECT OF NUTRIENT MEDIA IN MICROPROPAGATION AND IN VITRO CONSERVATION OF WILD POPULATION OF MAHALEB CHERRY (PRUNUS MAHALEB L.)

    National Research Council Canada - National Science Library

    Valbona Sota; Efigjeni Kongjika

    2014-01-01

      Shoot tips of Prunus mahaleb L. isolated from wild populations of Zejmen (Lezhe), promising as rootstocks for sweet cherry cultivars, were submitted to in vitro culture to test if micropropagation could be used for their rapid production...

  18. Endophytic bacteria in plant tissue culture: differences between easy- and difficult-to-propagate Prunus avium genotypes

    National Research Council Canada - National Science Library

    Quambusch, Mona; Pirttilä, Anna Maria; Tejesvi, Mysore V; Winkelmann, Traud; Bartsch, Melanie

    2014-01-01

    The endophytic bacterial communities of six Prunus avium L. genotypes differing in their growth patterns during in vitro propagation were identified by culture-dependent and culture-independent methods...

  19. Induced senescence promotes the feeding activities and nymph development of Myzus persicae (Hemiptera: Aphididae) on potato plants.

    Science.gov (United States)

    Machado-Assefh, Cristina R; Lucatti, Alejandro F; Alvarez, Adriana E

    2014-01-01

    The effect of dark-induced senescence on Solanum tuberosum L. (Solanales: Solanaceae) plants was assessed on the feeding behavior and performance of the green peach aphid, Myzus persicae Sulzer (Hemiptera: Aphididae). Senescence was induced by covering the basal part of the plant with a black cloth for 5 d, avoiding the light passage, but keeping the apical buds uncovered. The basal part of control plants was covered with a white nonwoven cloth. The degree of senescence was determined by measuring the chlorophyll content of the covered leaves. The performance and feeding behavior of M. persicae were studied on the uncovered nonsenescent apical leaves. The aphid's performance was evaluated by measuring nymphal mortality and prereproductive time. Aphid feeding behavior was monitored by the electrical penetration graph technique. In plants with dark-induced senescence, the aphids showed a reduction in their prereproductive time. Aphids also spent more time ingesting sap from the phloem than in control plants and performed more test probes after the first sustained ingestion of phloem sap. These data suggest that M. persicae's phloem activities and nymph development benefit from the nutritional enrichment of phloem sap, derived from dark-induced senescence on potato plants. The induced senescence improved plant acceptance by M. persicae through an increase in sap ingestion that likely resulted in a reduction in developmental time. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  20. Cellulomonas persica sp. nov. and Cellulomonas iranensis sp. nov., mesophilic cellulose-degrading bacteria isolated from forest soils.

    Science.gov (United States)

    Elberson, M A; Malekzadeh, F; Yazdi, M T; Kameranpour, N; Noori-Daloii, M R; Matte, M H; Shahamat, M; Colwell, R R; Sowers, K R

    2000-05-01

    Two newly described species of mesophilic, cellulose-degrading, aerobic bacteria were isolated from forest humus soils along the southern border of the Caspian Sea. Cellulomonas persica and Cellulomonas iranensis are proposed as new specific epithets based on comparative sequence analyses of 16S rDNA, DNA-DNA hybridization and phenotypic characteristics. Formal species descriptions are provided.

  1. A dietary test of putative deleterious sterols for the aphid Myzus persicae.

    Science.gov (United States)

    Bouvaine, Sophie; Faure, Marie-Line; Grebenok, Robert J; Behmer, Spencer T; Douglas, Angela E

    2014-01-01

    The aphid Myzus persicae displays high mortality on tobacco plants bearing a transgene which results in the accumulation of the ketosteroids cholestan-3-one and cholest-4-en-3-one in the phloem sap. To test whether the ketosteroids are the basis of the plant resistance to the aphids, M. persicae were reared on chemically-defined diets with different steroid contents at 0.1-10 µg ml(-1). Relative to sterol-free diet and dietary supplements of the two ketosteroids and two phytosterols, dietary cholesterol significantly extended aphid lifespan and increased fecundity at one or more dietary concentrations tested. Median lifespan was 50% lower on the diet supplemented with cholest-4-en-3-one than on the cholesterol-supplemented diet. Aphid feeding rate did not vary significantly across the treatments, indicative of no anti-feedant effect of any sterol/steroid. Aphids reared on diets containing equal amounts of cholesterol and cholest-4-en-3-one showed fecundity equivalent to aphids on diets containing only cholesterol. Aphids were reared on diets that reproduced the relative steroid abundance in the phloem sap of the control and modified tobacco plants, and their performance on the two diet formulations was broadly equivalent. We conclude that, at the concentrations tested, plant ketosteroids support weaker aphid performance than cholesterol, but do not cause acute toxicity to the aphids. In plants, the ketosteroids may act synergistically with plant factors absent from artificial diets but are unlikely to be solely responsible for resistance of modified tobacco plants.

  2. Proteomic analysis of Arabidopsis thaliana (L.) Heynh responses to a generalist sucking pest (Myzus persicae Sulzer).

    Science.gov (United States)

    Truong, D-H; Bauwens, J; Delaplace, P; Mazzucchelli, G; Lognay, G; Francis, F

    2015-11-01

    Herbivorous insects can cause severe cellular changes to plant foliage following infestations, depending on feeding behaviour. Here, a proteomic study was conducted to investigate the influence of green peach aphid (Myzus persicae Sulzer) as a polyphagous pest on the defence response of Arabidopsis thaliana (L.) Heynh after aphid colony establishment on the host plant (3 days). Analysis of about 574 protein spots on 2-DE gels revealed 31 differentially expressed protein spots. Twenty out of these 31 differential proteins were selected for analysis by mass spectrometry. In 12 of the 20 analysed spots, we identified seven and nine proteins using MALDI-TOF-MS and LC-ESI-MS/MS, respectively. Of the analysed spots, 25% contain two proteins. Different metabolic pathways were modulated in Arabidopsis leaves according to aphid feeding: most corresponded to carbohydrate, amino acid and energy metabolism, photosynthesis, defence response and translation. This paper has established a survey of early alterations induced in the proteome of Arabidopsis by M. persicae aphids. It provides valuable insights into the complex responses of plants to biological stress, particularly for herbivorous insects with sucking feeding behaviour. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.

  3. A case of canine borreliosis in Iran caused by Borrelia persica.

    Science.gov (United States)

    Shirani, Darush; Rakhshanpoor, Alaleh; Cutler, Sally Jane; Ghazinezhad, Behnaz; Naddaf, Saied Reza

    2016-04-01

    Tick-borne relapsing fever is an endemic disease in Iran, with most cases attributed to infection by Borrelia persica, which is transmitted by Ornithodoros tholozani soft ticks. Here, we report spirochetemia in blood of a puppy residing in Tehran, Iran. The causative species was identified by use of highly discriminative IGS sequencing; the 489 bp IGS sequence obtained in our study showed 99% identity (100% coverage) when compared with B. persica sequences derived from clinical cases or from O. tholozani ticks. Our IGS sequence also showed 99% similarity over 414 bp (85% coverage) with a strain from a domestic dog, and 96% over 328 bp (69% coverage) with a strain from a domestic cat. Pet-keeping in cosmopolitan cities like Tehran has become increasingly popular in recent years. Animals are often transported into the city in cages or cardboard boxes that might also harbor minute tick larvae and/or early stages of the nymphs bringing them into the urban environment. This may pose a threat to household members who buy and keep these puppies and as a result may come into close contact with infected ticks. Copyright © 2016 Elsevier GmbH. All rights reserved.

  4. Sublethal Effects of Cyantraniliprole and Imidacloprid on Feeding Behavior and Life Table Parameters of Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Zeng, Xianyi; He, Yingqin; Wu, Jiaxing; Tang, Yuanman; Gu, Jitao; Ding, Wei; Zhang, Yongqiang

    2016-08-01

    The green peach aphid, Myzus persicae (Sulzer) (Hemiptera: Aphididae), is an agricultural pest that seriously infests many crops worldwide. This study used electrical penetration graphs (EPGs) and life table parameters to estimate the sublethal effects of cyantraniliprole and imidacloprid on the feeding behavior and hormesis of M. persicae The sublethal concentrations (LC30) of cyantraniliprole and imidacloprid against adult M. persicae were 4.933 and 0.541 mg L(-1), respectively. The feeding data obtained from EPG analysis indicated that the count probes and number of short probes (<3 min) were significantly increased when aphids were exposed to LC30 of imidacloprid-treated plants. In addition, the phloem-feeding behavior of M persicae was significantly impaired on fed tobacco plants treated with cyantraniliprole and imidacloprid at LC30 Analysis of life table parameters indicated that the growth and reproduction of F1 generation aphids were significantly affected when initial adults were exposed to LC30 of cyantraniliprole and imidacloprid. The nymphal period, female longevity, total preoviposition period, and mean generation time were significantly prolonged when initial adults were exposed to LC30 of imidacloprid. By comparison, these parameters were prolonged but not significantly in the cyantraniliprole treatment. The fecundity and gross reproductive rate were significantly increased in the treated groups. Similarly, the net reproductive rate was greater in the treated group than the control group. Our results indicate that treatment with LC30 of imidacloprid and cyantraniliprole would lead to a hormetic response of M. persicae, with higher likelihood of occurrence when initial adults were exposed to LC30 of cyantraniliprole. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Amplification of a cytochrome P450 gene is associated with resistance to neonicotinoid insecticides in the aphid Myzus persicae.

    Directory of Open Access Journals (Sweden)

    Alin M Puinean

    2010-06-01

    Full Text Available The aphid Myzus persicae is a globally significant crop pest that has evolved high levels of resistance to almost all classes of insecticide. To date, the neonicotinoids, an economically important class of insecticides that target nicotinic acetylcholine receptors (nAChRs, have remained an effective control measure; however, recent reports of resistance in M. persicae represent a threat to the long-term efficacy of this chemical class. In this study, the mechanisms underlying resistance to the neonicotinoid insecticides were investigated using biological, biochemical, and genomic approaches. Bioassays on a resistant M. persicae clone (5191A suggested that P450-mediated detoxification plays a primary role in resistance, although additional mechanism(s may also contribute. Microarray analysis, using an array populated with probes corresponding to all known detoxification genes in M. persicae, revealed constitutive over-expression (22-fold of a single P450 gene (CYP6CY3; and quantitative PCR showed that the over-expression is due, at least in part, to gene amplification. This is the first report of a P450 gene amplification event associated with insecticide resistance in an agriculturally important insect pest. The microarray analysis also showed over-expression of several gene sequences that encode cuticular proteins (2-16-fold, and artificial feeding assays and in vivo penetration assays using radiolabeled insecticide provided direct evidence of a role for reduced cuticular penetration in neonicotinoid resistance. Conversely, receptor radioligand binding studies and nucleotide sequencing of nAChR subunit genes suggest that target-site changes are unlikely to contribute to resistance to neonicotinoid insecticides in M. persicae.

  6. Comparative analysis of Solanum stoloniferum responses to probing by the green peach aphid Myzus persicae and the potato aphid Macrosiphum euphorbiae.

    Science.gov (United States)

    Alvarez, Adriana E; Broglia, Viviana G; Alberti D'Amato, Anahí M; Wouters, Doret; van der Vossen, Edwin; Garzo, Elisa; Tjallingii, W Fred; Dicke, Marcel; Vosman, Ben

    2013-04-01

    Plants protect themselves against aphid attacks by species-specific defense mechanisms. Previously, we have shown that Solanum stoloniferum Schlechtd has resistance factors to Myzus persicae Sulzer (Homoptera: Aphididae) at the epidermal/mesophyll level that are not effective against Macrosiphum euphorbiae Thomas (Homoptera: Aphididae). Here, we compare the nymphal mortality, the pre-reproductive development time, and the probing behavior of M. persicae and M. euphorbiae on S. stoloniferum and Solanum tuberosum L. Furthermore, we analyze the changes in gene expression in S. stoloniferum 96 hours post infestation by either aphid species. Although the M. euphorbiae probing behavior shows that aphids encounter more probing constrains on phloem activities-longer probing and salivation time- on S. stoloniferum than on S. tuberosum, the aphids succeeded in reaching a sustained ingestion of phloem sap on both plants. Probing by M. persicae on S. stoloniferum plants resulted in limited feeding only. Survival of M. euphorbiae and M. persicae was affected on young leaves, but not on senescent leaves of S. stoloniferum. Infestation by M. euphorbiae changed the expression of more genes than M. persicae did. At the systemic level both aphids elicited a weak response. Infestation of S. stoloniferum plants with a large number of M. persicae induced morphological changes in the leaves, leading to the development of pustules that were caused by disrupted vascular parenchyma and surrounding tissue. In contrast, an infestation by M. euphorbiae had no morphological effects. Both plant species can be regarded as good host for M. euphorbiae, whereas only S. tuberosum is a good host for M. persicae and S. stoloniferum is not. Infestation of S. stoloniferum by M. persicae or M. euphorbiae changed the expression of a set of plant genes specific for each of the aphids as well as a set of common genes. © 2012 The Authors Insect Science © 2012 Institute of Zoology, Chinese Academy of

  7. Insecticide resistance mechanisms in the green peach aphid Myzus persicae (Hemiptera: Aphididae II: Costs and benefits.

    Directory of Open Access Journals (Sweden)

    Andrea X Silva

    Full Text Available BACKGROUND: Among herbivorous insects that have exploited agro-ecosystems, the peach-potato aphid, Myzus persicae, is recognized as one of the most important agricultural pests worldwide. Uses over 400 plant species and has evolved different insecticides resistance mechanisms. As M. persicae feeds upon a huge diversity of hosts, it has been exposed to a wide variety of plant allelochemicals, which probably have promoted a wide range of detoxification systems. METHODOLOGY/PRINCIPAL FINDINGS: In this work we (i evaluated whether insecticide resistance mutations (IRM in M. persicae can give an advantage in terms of reproductive fitness when aphids face two hosts, pepper (Capsicum annuum a suitable host and radish (Raphanus sativus the unfavorable host and (ii examined the transcriptional expression of six genes that are known to be up-regulated in response to insecticides. Our results show a significant interaction between host and IRM on the intrinsic rate of increase (r(m. Susceptible genotypes (not carrying insensitivity mutations had a higher r(m on pepper, and the transcriptional levels of five genes increased on radish. The r(m relationship was reversed on the unfavorable host; genotypes with multiple IRM exhibited higher r(m, without altering the transcriptional levels of the studied genes. Genotypes with one IRM kept a similar r(m on both hosts, but they increased the transcriptional levels of two genes. CONCLUSIONS/SIGNIFICANCE: Although we have studied only nine genotypes, overall our results are in agreement with the general idea that allelochemical detoxification systems could constitute a pre-adaptation for the development of insecticide resistance. Genotypes carrying IRM exhibited a higher r(m than susceptible genotypes on radish, the more unfavorable host. Susceptible genotypes should be able to tolerate the defended host by up-regulating some metabolic genes that are also responding to insecticides. Hence, our results suggest that

  8. Comparative analysis of genome sequences from four strains of the Buchnera aphidicola Mp endosymbion of the green peach aphid, Myzus persicae.

    Science.gov (United States)

    Jiang, Zhijie; Jones, Derek H; Khuri, Sawsan; Tsinoremas, Nicholas F; Wyss, Tania; Jander, Georg; Wilson, Alex C C

    2013-12-24

    Myzus persicae, the green peach aphid, is a polyphagous herbivore that feeds from hundreds of species of mostly dicot crop plants. Like other phloem-feeding aphids, M. persicae rely on the endosymbiotic bacterium, Buchnera aphidicola (Buchnera Mp), for biosynthesis of essential amino acids and other nutrients that are not sufficiently abundant in their phloem sap diet. Tobacco-specialized M. persicae are typically red and somewhat distinct from other lineages of this species. To determine whether the endosymbiotic bacteria of M. persicae could play a role in tobacco adaptation, we sequenced the Buchnera Mp genomes from two tobacco-adapted and two non-tobacco M. persicae lineages. With a genome size of 643.5 kb and 579 predicted genes, Buchnera Mp is the largest Buchnera genome sequenced to date. No differences in gene content were found between the four sequenced Buchnera Mp strains. Compared to Buchnera APS from the well-studied pea aphid, Acyrthosiphon pisum, Buchnera Mp has 21 additional genes. These include genes encoding five enzymes required for biosynthesis of the modified nucleoside queosine, the heme pathway enzyme uroporphyrinogen III synthase, and asparaginase. Asparaginase, which is also encoded by the genome of the aphid host, may allow Buchnera Mp to synthesize essential amino acids from asparagine, a relatively abundant phloem amino acid. Together our results indicate that the obligate intracellular symbiont Buchnera aphidicola does not contribute to the adaptation of Myzus persicae to feeding on tobacco.

  9. Evaluation of the reference genes for expression analysis using quantitative real-time polymerase chain reaction in the green peach aphid, Myzus persicae.

    Science.gov (United States)

    Kang, Zhi-Wei; Liu, Fang-Hua; Tian, Hong-Gang; Zhang, Meng; Guo, Shan-Shan; Liu, Tong-Xian

    2017-04-01

    The green peach aphid, Myzus persicae Sulzer (Hemiptera, Aphididae), is an important cosmopolitan pest. Real time qRT-PCR has been used for target gene expression analysis on M. persicae. Using real time qRT-PCR, the expression levels are normalized on the basis of the reliable reference genes. However, to date, the stability of available reference genes has been insufficient. In this study, we evaluated nine candidate reference genes from M. persicae under diverse experimental conditions. The tested candidate genes were comprehensively ranked based on five alternative methods (RefFinder, geNorm, Normfinder, BestKeeper and the comparative ΔC t method). 18s, Actin and ribosomal protein L27 (L27) were recommended as the most stable reference genes for M. persicae, whereas ribosomal protein L27 (L27) was found to be the least stable reference genes for abiotic studies (photoperiod, temperature and insecticide susceptibility). Our finding not only sheds light on establishing an accurate and reliable normalization of real time qRT-PCR data in M. persicae but also lays a solid foundation for further studies of M. persicae involving RNA interference and functional gene research. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  10. Is cut-stump and girdling an efficient method of black cherry Prunus serotina Ehrh. eradication?

    OpenAIRE

    Otręba Anna; Marciszewska Katarzyna; Janik Daria

    2017-01-01

    Efforts to prevent the invasion of black cherry Prunus serotina Ehrh. have a long history in Western Europe. However, effective methods of eliminating it that do not bear negative side effects for ecosystems have not yet been developed. Mechanical methods are the first choice in environmentally sensitive areas. In this study, we aimed to find answers to the questions: does the application of cutting at a height of 1 m from the ground limit the sprouting capacities of black cherry? And, is ste...

  11. Detection and characterization of genome-specific microsatellite markers in the allotetraploid Prunus serotina

    OpenAIRE

    Pairon, Marie; Jacquemart, Anne-Laure; Potter, Daniel

    2008-01-01

    The utility of microsatellite markers to characterize the genetic diversity of a polyploid species with disomic inheritance is often hampered by the impossibility of determining allele frequencies and the complexity of inheritance patterns. The objective of this study was to solve these problems in the allotetraploid Prunus serotina Ehrh. by finding genome-specific primers (i.e., primers that are specific to one of the two genomes that initially formed the species). Sixty-seven microsatellite...

  12. Occurrence of black cherry (Prunus serotina Ehrh.) in the State Forests in Poland

    OpenAIRE

    Bijak Szymon; Czajkowski Maciej; Ludwisiak Łukasz

    2015-01-01

    Among the invasive tree species identified in Polish forests, black cherry (Prunus serotina Ehrh.) appears to pose the greatest threat. The objective of this study was i), to determine the abundance of this species in the forests managed by the State Forests National Forest Holding (PGLLP) and ii), to characterise the ecological conditions that it is found in. The source data was obtained from the State Forests Information System (SILP) database. In Polish forests, black cherry mostly occurs ...

  13. Nutraceutical Value of Black Cherry Prunus serotina Ehrh. Fruits: Antioxidant and Antihypertensive Properties

    OpenAIRE

    Francisco J. Luna-Vázquez; César Ibarra-Alvarado; Alejandra Rojas-Molina; Juana I. Rojas-Molina; Elhadi M. Yahia; Dulce M. Rivera-Pastrana; Adriana Rojas-Molina; Ángel Miguel Zavala-Sánchez

    2013-01-01

    In Mexico black cherry (Prunus serotina Ehrh.) fruits are consumed fresh, dried or prepared in jam. Considering the evidence that has linked intake of fruits and vegetables rich in polyphenols to cardiovascular risk reduction, the aim of this study was to characterize the phenolic profile of black cherry fruits and to determine their antioxidant, vasorelaxant and antihypertensive effects. The proximate composition and mineral contents of these fruits were also assessed. Black cherry fruits po...

  14. Quantitative analysis of amygdalin and prunasin in Prunus serotina Ehrh. using (1) H-NMR spectroscopy.

    Science.gov (United States)

    Santos Pimenta, Lúcia P; Schilthuizen, Menno; Verpoorte, Robert; Choi, Young Hae

    2014-01-01

    Prunus serotina is native to North America but has been invasively introduced in Europe since the seventeenth century. This plant contains cyanogenic glycosides that are believed to be related to its success as an invasive plant. For these compounds, chromatographic- or spectrometric-based (targeting on HCN hydrolysis) methods of analysis have been employed so far. However, the conventional methods require tedious preparation steps and a long measuring time. To develop a fast and simple method to quantify the cyanogenic glycosides, amygdalin and prunasin in dried Prunus serotina leaves without any pre-purification steps using (1) H-NMR spectroscopy. Extracts of Prunus serotina leaves using CH3 OH-d4 and KH2 PO4 buffer in D2 O (1:1) were quantitatively analysed for amygdalin and prunasin using (1) H-NMR spectroscopy. Different internal standards were evaluated for accuracy and stability. The purity of quantitated (1) H-NMR signals was evaluated using several two-dimensional NMR experiments. Trimethylsilylpropionic acid sodium salt-d4 proved most suitable as the internal standard for quantitative (1) H-NMR analysis. Two-dimensional J-resolved NMR was shown to be a useful tool to confirm the structures and to check for possible signal overlapping with the target signals for the quantitation. Twenty-two samples of P. serotina were subsequently quantitatively analysed for the cyanogenic glycosides prunasin and amygdalin. The NMR method offers a fast, high-throughput analysis of cyanogenic glycosides in dried leaves permitting simultaneous quantification and identification of prunasin and amygdalin in Prunus serotina. Copyright © 2013 John Wiley & Sons, Ltd.

  15. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection.

    Directory of Open Access Journals (Sweden)

    Bernardo Rodamilans

    Full Text Available Plum pox virus (PPV infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01. Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  16. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection.

    Science.gov (United States)

    Rodamilans, Bernardo; San León, David; Mühlberger, Louisa; Candresse, Thierry; Neumüller, Michael; Oliveros, Juan Carlos; García, Juan Antonio

    2014-01-01

    Plum pox virus (PPV) infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01). Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  17. Experimental study of 『PERSICAE SEMEN』 on the blood injected by Endotoxin in rats

    Directory of Open Access Journals (Sweden)

    Chang-Keun

    2005-06-01

    Full Text Available This study was performed to investigate the effects of 「Persicae Semen」(PS on the blood injected by Endotoxin in rats. The blood was induced by Endotoxin injection into the caudal vein of rats and PS group taken a measurement of RBC, Hb, Hct, Platelet, WBC, ESR, CRP. The results were obtained as follows: 1. RBC, Hb, Hct, Platelet, WBC were increased with statistical significance at PS group as compared with those of the control group. 2. ESR, CRP were decreased with statistical significance at PS group as compared with those of the control group. It is concluded that PS group has significant effects on the blood injected by Endotoxin in rats. Therefore, PS group seems to be applicable to the diseases related to Endotoxin in clinics.

  18. A review on phytochemical and pharmacological investigations of miswak (Salvadora persica Linn

    Directory of Open Access Journals (Sweden)

    Jamal Akhtar

    2011-01-01

    Full Text Available The miswak is a natural toothbrush made from the twigs of the Salvadora persica (Salvadoraceae. Its use predates the inception of Islam and is frequently advocated in the Hadith (the traditions relating to the life of Prophet Muhammad PBUH . In addition to strengthening the gums, it prevents tooth decay, eliminating toothaches and halt further increase in decay that has already set in. It creates a fragrance in the mouth, eliminates bad odor, improves the sense of taste, and causes the teeth to glow and shine. The other parts of the tree have therapeutic values as corrective, deobstruent, liver tonic, diuretic, analgesic, anthelmintic, astringent, lithontriptic, carminative, diuretic, aphrodisiac, and stomachic. The present review is therefore an effort to give detailed survey of the literature on phytochemistry and pharmacological activities of miswak.

  19. Arabidopsis thaliana - Myzus persicae interaction: shaping the understanding of plant defense against phloem-feeding aphids

    Directory of Open Access Journals (Sweden)

    Joe eLouis

    2013-07-01

    Full Text Available The phloem provides a unique niche for several organisms. Aphids are a large group of Hemipteran insects that utilize stylets present in their mouthparts to pierce sieve elements and drink large volumes of phloem sap. In addition, many aphids also vector viral diseases. Myzus persicae, commonly known as the green peach aphid (GPA, is an important pest of a large variety of plants that includes Arabidopsis thaliana. This review summarizes recent studies that have exploited the compatible interaction between Arabidopsis and GPA to understand the molecular and physiological mechanisms utilized by plants to control aphid infestation, as well as genes and mechanisms that contribute to susceptibility. In addition, recent efforts to identify aphid-delivered elicitors of plant defenses and novel aphid salivary components that facilitate infestation are also discussed.

  20. Chemical composition and antibacterial activity of the essential oil the leaf of Nepeta persica

    Directory of Open Access Journals (Sweden)

    Soraya AKHSHI

    2014-11-01

    Full Text Available The essential oil from the leaf of Nepeta persica Boiss, analyzed by gas chromatography (GC and gas chromatography (GC/mass spectrometry (MS, were shown to contain 4aα, 7α, 7aβ-nepetalactone (49.46% and 4aα, 7α, 7aα-nepetalactone (14.18%. The other main constituents were n-octane (13.10%, n-decane (3.67% and germacrene-D (2.04%. Antibacterial activities of the leaf oil were evaluated using the micro-dilution broth method. Inhibitory effects on Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Salmonella typhi and Enterococcus faecalis were recorded. The leaf oil has difference activities against the test microorganisms. The antibacterial property of the essential oil might be ascribed to their high content of nepetalactone isomers.

  1. Insecticidal activity of three plants extracts against Myzus persicae (Sulzer, 1776 and their phytochemical screening

    Directory of Open Access Journals (Sweden)

    Billal NIA

    2015-11-01

    Full Text Available To reduce the use of synthetic pesticides and their negative effects on the environment, leaves extracts of Artemisia herba-alba Asso, Eucalyptus camaldulensis Dehnh and Rosmarinus officinalis L. were obtained with petroleum ether, ethanol and distilled water as solvents. These extracts were evaluated under laboratory conditions for their insecticidal effect against 3 to 4 days-old Myzus persicae individuals (Homoptera: Aphididae at 1, 2.5, 5, and 10 %. We made observations after 24 hours. Etheric extract of all plants was effective and caused mortalities (100 %, 53 % and 60 % respectively at the highest concentration. However, ethanolic and aqueous extracts did not show any significant insecticidal effect. The phytochemical screening showed the richness of etheric extract in terpenes. The results obtained suggest that we can make bioinsecticides based on leaves etheric extracts from these plants for use in integrated pest management.

  2. A review on phytochemical and pharmacological investigations of miswak (Salvadora persica Linn).

    Science.gov (United States)

    Akhtar, Jamal; Siddique, Khalid M; Bi, Salma; Mujeeb, Mohd

    2011-01-01

    The miswak is a natural toothbrush made from the twigs of the Salvadora persica (Salvadoraceae). Its use predates the inception of Islam and is frequently advocated in the Hadith (the traditions relating to the life of Prophet Muhammad(PBUH)). In addition to strengthening the gums, it prevents tooth decay, eliminating toothaches and halt further increase in decay that has already set in. It creates a fragrance in the mouth, eliminates bad odor, improves the sense of taste, and causes the teeth to glow and shine. The other parts of the tree have therapeutic values as corrective, deobstruent, liver tonic, diuretic, analgesic, anthelmintic, astringent, lithontriptic, carminative, diuretic, aphrodisiac, and stomachic. The present review is therefore an effort to give detailed survey of the literature on phytochemistry and pharmacological activities of miswak.

  3. Role of Glyco-Persica® in Targeting Diabetes Type 2: an Integrative Approach

    Directory of Open Access Journals (Sweden)

    Dashtdar Mehrab

    2013-12-01

    Full Text Available Objectives: The objective of this study was to examine how an integrated approach to type 2 diabetes mellitus treatment could improve glycemic control and immune-potentiating activities adherent to oral hypoglycemic agents along with a botanical compound, among primary care patients. Methods: In this study, we used the self-control and the group-control methods. Candidates meeting the trial conditions were selected from among volunteers who had taken the test substance for 45 days. During the trial, all groups were on a controlled diet; neither were the original medications nor their dosages changed. Results: The results showed that the botanical compound (Glyco-Persica® significantly reduced the main clinical symptoms in diabetes type 2. In the treatment group, 36 of 52 patients (69.23% and in the control group 10 of 52 patients (19.23% showed reduced symptoms, and this difference was statistically significant (P < 0.05. The fasting blood sugar in the treatment group after treatment compared with that before treatment and with that in the control group after treatment was statistically different (P < 0.05. The post-prandial glucose in the treatment group after treatment was significantly different from that before treatment and from that in the control group after treatment (P < 0.05; the post-prandial blood sugar in the treatment group was reduced by 8.98%. Conclusions: The results revealed that the botanical compound (Glyco-Persica® has significant hypoglycemic properties which affect main clinical symptoms in diabetes type 2. Body weight, blood pressure, heart rate, routine blood, stool and urine tests showed no meaningful negative changes after the course of treatment. There was no significant adverse reaction during the trial.

  4. Alarm pheromone habituation in Myzus persicae has fitness consequences and causes extensive gene expression changes.

    Science.gov (United States)

    de Vos, Martin; Cheng, Wing Yin; Summers, Holly E; Raguso, Robert A; Jander, Georg

    2010-08-17

    In most aphid species, facultative parthenogenetic reproduction allows rapid growth and formation of large single-genotype colonies. Upon predator attack, individual aphids emit an alarm pheromone to warn the colony of this danger. (E)-beta-farnesene (EBF) is the predominant constituent of the alarm pheromone in Myzus persicae (green peach aphid) and many other aphid species. Continuous exposure to alarm pheromone in aphid colonies raised on transgenic Arabidopsis thaliana plants that produce EBF leads to habituation within three generations. Whereas naive aphids are repelled by EBF, habituated aphids show no avoidance response. Similarly, individual aphids from the habituated colony can revert back to being EBF-sensitive in three generations, indicating that this behavioral change is not caused by a genetic mutation. Instead, DNA microarray experiments comparing gene expression in naive and habituated aphids treated with EBF demonstrate an almost complete desensitization in the transcriptional response to EBF. Furthermore, EBF-habituated aphids show increased progeny production relative to EBF-responsive aphids, with or without EBF treatment. Although both naive and habituated aphids emit EBF upon damage, EBF-responsive aphids have a higher survival rate in the presence of a coccinellid predator (Hippodamia convergens), and thus outperform habituated aphids that do not show an avoidance response. These results provide evidence that aphid perception of conspecific alarm pheromone aids in predator avoidance and thereby bestows fitness benefits in survivorship and fecundity. Therefore, although habituated M. persicae produce more progeny, EBF-emitting transgenic plants may have practical applications in agriculture as a result of increased predation of habituated aphids.

  5. Genetic variability of Myzus persicae nicotianae densovirus based on partial NS and VP gene sequences.

    Science.gov (United States)

    Song, X R; Tang, S H; Tang, Z Q; Yang, X M; Wang, X W; Wang, X F; Xu, P J; Ren, G W

    2016-11-21

    We previously described a novel densovirus [Myzus persicae nicotianae densovirus (MpnDV)] infecting M. persicae nicotianae (Hemiptera: Aphididae) with 34% prevalence. This single-stranded DNA virus has a 5480-nucleotide ambisense genome and belongs to the Densovirinae subfamily within the family Parvoviridae. In the present study, we estimated the genetic diversity of MpnDV using partial nonstructural protein (NS) and capsid protein (VP) gene sequences from 10 locations in China. First, we identified MpnDV-positive samples by amplifying a 445-bp fragment with primers MpDVF/MpDVR. Subsequently, we amplified and sequenced COI genes with primers MpCOIF/ MpCOIR, and partial NS and VP sequences with primers MpnDVF1/MpnDVR1. The respective 655-, 1461-, and 423-bp COI, NS, and VP fragments were used to analyze the genetic diversity of MpnDV using MEGA 6.0 and DnaSP 5.0. The high level of identity shared by all COI sequences (>99%) suggested that the aphids sampled were of the same species, and indicated population homogeneity across the 10 locations investigated. The nucleotide diversity of MpnDV sequences (0.0020 ± 0.0025) was significantly higher than that of the COI genes (0.0002 ± 0.0005). The pairwise fixation index for MpnDV was 0.832, and the total gene flow was 0.05. Phylogenetic analysis revealed that the MpnDV haplotypes clustered according to geographical location, except for those from the Liaoning and Shanxi provinces. In conclusion, MpnDV demonstrated a low level of gene flow and high genetic diversity, suggesting that it is vertically transmitted, and implying that endosymbiotic viruses could be used as markers in studies of insect population genetics.

  6. Comparative antifeedant activities of polygodial and pyrethrins against whiteflies (Bemisia tabaci) and aphids (Myzus persicae).

    Science.gov (United States)

    Prota, Neli; Bouwmeester, Harro J; Jongsma, Maarten A

    2014-04-01

    Polygodial, a sesquiterpene dialdehyde of the drimane family, has been shown to have deterrent and antifeedant effects on various insect species, including Myzus persicae (Sulzer), Spodoptera spp. and Leptinotarsa decemlineata (Say). This compound may have potential as a broad-spectrum biocontrol agent, similar to pyrethrins, given that it was previously reported to improve yield when sprayed on barley fields. This study compares the deterrent effect of polygodial and pyrethrins against the silverleaf whitefly Bemisia tabaci (Gennadius) and the green peach aphid M. persicae in dual-choice assays using compound-coated tomato leaf discs. B. tabaci adults were deterred by polygodial at an ED50 (effective dose at which 50% of the insects are deterred) of about 25 µg g(-1) fresh weight (FW), and green peach aphids at about 54 µg g(-1) FW. Bioassays were benchmarked with pyrethrins that had a 20-fold lower ED50 of approximately 1.4 µg g(-1) FW against whiteflies, but only a twofold lower ED50 (about 28 µg g(-1) FW) against peach aphids. Polygodial showed moderate phytotoxic effects (score of 2 on a scale of 1-5) on tomato leaves at concentrations above the ED50 concentrations (≥ 90 µg g(-1) FW). The sesquiterpene dialdehyde polygodial is 2-20 times less deterrent than pyrethrins, depending on the insect species, but it could provide a useful complement to pyrethrin sprays as it has a different mode of action, is food grade and has low volatility. However, a formulation that reduces the risks of phytotoxic effects should be developed. © 2013 Society of Chemical Industry.

  7. A dietary test of putative deleterious sterols for the aphid Myzus persicae.

    Directory of Open Access Journals (Sweden)

    Sophie Bouvaine

    Full Text Available The aphid Myzus persicae displays high mortality on tobacco plants bearing a transgene which results in the accumulation of the ketosteroids cholestan-3-one and cholest-4-en-3-one in the phloem sap. To test whether the ketosteroids are the basis of the plant resistance to the aphids, M. persicae were reared on chemically-defined diets with different steroid contents at 0.1-10 µg ml(-1. Relative to sterol-free diet and dietary supplements of the two ketosteroids and two phytosterols, dietary cholesterol significantly extended aphid lifespan and increased fecundity at one or more dietary concentrations tested. Median lifespan was 50% lower on the diet supplemented with cholest-4-en-3-one than on the cholesterol-supplemented diet. Aphid feeding rate did not vary significantly across the treatments, indicative of no anti-feedant effect of any sterol/steroid. Aphids reared on diets containing equal amounts of cholesterol and cholest-4-en-3-one showed fecundity equivalent to aphids on diets containing only cholesterol. Aphids were reared on diets that reproduced the relative steroid abundance in the phloem sap of the control and modified tobacco plants, and their performance on the two diet formulations was broadly equivalent. We conclude that, at the concentrations tested, plant ketosteroids support weaker aphid performance than cholesterol, but do not cause acute toxicity to the aphids. In plants, the ketosteroids may act synergistically with plant factors absent from artificial diets but are unlikely to be solely responsible for resistance of modified tobacco plants.

  8. Characterization and Distribution Analysis of a Densovirus Infecting Myzus persicae nicotianae (Hemiptera: Aphididae).

    Science.gov (United States)

    Tang, Shihao; Song, Xueru; Xue, Lin; Wang, Xinwei; Wang, Xiufang; Xu, Pengjun; Ren, Guangwei

    2016-04-01

    Densoviruses (DVs) are a group of viruses that contain a linear single-stranded DNA genome between 4–6 kb in length. Herein, we report a DV with a 5,480-nt genome, isolated from tobacco aphid (Myzus persicae nicotianae Blackman), named MpnDV. Unlike the genome of M. persicae densovirus (MpDV), which possesses five open reading frames (ORFs), the genome of MpnDV contains four putative ORFs—the nonstructural protein 1 (NS1) and NS2 from MpnDV are 98- and 52-amino acids longer than those of MpDV, respectively, at the N-terminus, and the capsid proteins (VP) are 102 amino acids longer at the C-terminus than those of MpDV. Mapping of the MpnDV transcripts by RACE method indicated that the ORF of NS2 started at nt 340 and the right two putative ORFs were combined together by deleting two introns, one of 95 bp located at nt 2,932–3,026 and the other of 145 bp located at nt 4,715–4,859, suggesting transcript mapping was necessary for analyzing of genome organization. Alignment analysis indicated that MpnDV shows 97% sequence identity with MpDV, and that the shortened ORFs resulted from nucleotide indels, suggesting MpnDV and MpDV were two isolates of the same virus. Thus, MpnDV and MpDV clustered together in a tree-based analysis. The prevalence of MpnDV infection in wild populations of tobacco aphids differed among 29 locations; 34% of the 622 individuals sampled were positive. The genome organization, transcript strategy, and widespread distribution in wild populations suggest that MpnDV might possess a biological function different from that of MpDV.

  9. Efeito da temperatura na biologia de Myzus persicae (Sulzer (Hemiptera: Aphididae criado em pimentão = Effect of temperature on biology of Myzus persicae (Sulzer (Hemiptera: Aphididae reared in sweet pepper

    Directory of Open Access Journals (Sweden)

    Leonardo Rodrigues Barbosa

    2006-04-01

    Full Text Available Avaliou-se o efeito de temperaturas constantes e variáveis sobre a biologia de M. persicae em pimentão. As ninfas foram individualizadas em discos foliares de pimentão mantidos em placas de Petri às temperaturas constantes de 15ºC, 20ºC, 25ºC e 30ºC. Em casa de vegetação, as temperaturas foram oscilantes, com média de 24,9ºC, e as ninfas foram colocadas em gaiolas apropriadas e fixadas em folhas de pimentão. O delineamento foi inteiramente casualizado, com 45 e 30 repetições para os ensaios em laboratório e em casa de vegetação, respectivamente. Ficou evidenciado que as temperaturas constantes de 20ºC e 25ºC foram mais favoráveis para M. persicae, por proporcionarem redução do ciclo biológico e maior fecundidade do que as temperaturas oscilantes em casa de vegetação.The influence of constant and variable temperatures on biology of M. persicae in sweet pepper was evaluated. The nymphs were individualized on pepper leaf discs and maintained in Petri dishes at constant temperatures of 15, 20, 25, and 30ºC. In greenhouse the temperature was variable with an average of 24.9ºC and the nymphs were kept in appropriate cages and fixed in sweet pepper leaves. The experimental design was completely randomized with 45 and 30 replicates for the laboratory and greenhouse assays, respectively. It was evidenced that constant temperatures of 20 and 25ºC were more favorable to M. persicae, decreasing the biological cycle and increasing the fecundity, than the oscillatory temperatures in the greenhouse.

  10. Use of silicon as inductor of the resistance in potato to Myzus persicae (Sulzer) (Hemiptera: Aphididae); Uso de silicio como indutor de resistencia em batata a Myzus persicae (Sulzer) (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Flavia B.; Moraes, Jair C.; Antunes, Cristiana [Universidade Federal de Lavras, MG (Brazil). Dept. de Entomologia; Santos, Custodio D. dos [Universidade Federal de Lavras, MG (Brazil). Dept. de Quimica

    2008-03-15

    The aphid Myzus persicae (Sulzer) is an important pest of potato and causes direct harm, due to the quantity of sap extracted and for being vector of important phytovirus. This work was carried out to evaluate the action of silicon as a resistance inducer of potato to M. persicae. Four treatments were tried: foliar fertilization with silicon acid at 1%; soil fertilization with 250 ml silicic acid solution at 1%; foliar fertilization with silicon acid at 1% + soil fertilization with 250 ml silicic acid solution at 1%; and a control. The treatments were applied thirty days after the explants emergence. Fifteen days after the application of the treatments, feeding preference and some biological aspects of the aphids were evaluated. After, the content of tannins and lignin present in the leaves and the activity of the enzymes peroxidase and phenylalanine ammonia-lyase were also determined. The silicon fertilization did not affect the preference of the aphids; however it reduced fecundity and the rate of population growth of the insects. The lignin percentage increased in the leaves of plants fertilized with silicon via soil and/or foliar and the percentage of tannins increased only in the leaves fertilized via soil plus foliar. The silicon acted as a resistance inducer to M. persicae in potato. (author)

  11. The antibacterial activity of traditionally used Salvadora persica L. (miswak) and Commiphora gileadensis (palsam) in Saudi Arabia.

    Science.gov (United States)

    Al-sieni, Abdulbasit I I

    2014-01-01

    Nowadays there is a need to find naturally occurring substances from plants with antimicrobial activity as an alternative to available used antibiotics. Salvadora persica (miswak) and Commiphora gileadensis were collected, dried and extracted with either methanol or warm water and the obtained extracts were assessed for their antibacterial activity against 5 different genera of bacteria using agar well diffusion method. The tested bacteria included some human pathogens. The obtained extracts exhibited considerable inhibitory effects against all the tested bacteria with various degrees of growth inhibition. It was shown that methanol extract was more effective compared to water extracts. The minimum inhibitory concentrations (MIC) of the methanol extracts ranged from 50-100 °g/ml. No toxicity was found using Artimia salina as test organism and no antitumor activity against Ehrlich ascites carcinoma. S. persica and C. gileadensis showed moderate to high inhibitory activity on pathogenic bacteria with no toxicity and can be used traditionally as alternative medicine.

  12. Molecular characterization of Borrelia persica, the agent of tick borne relapsing fever in Israel and the Palestinian Authority.

    Directory of Open Access Journals (Sweden)

    Gracia Safdie

    Full Text Available The identification of the Tick Borne Relapsing Fever (TBRF agent in Israel and the Palestinian Authority relies on the morphology and the association of Borrelia persica with its vector Ornithodoros tholozani. Molecular based data on B. persica are very scarce as the organism is still non-cultivable. In this study, we were able to sequence three complete 16S rRNA genes, 12 partial flaB genes, 18 partial glpQ genes, 16 rrs-ileT intergenic spacers (IGS from nine ticks and ten human blood samples originating from the West Bank and Israel. In one sample we sequenced 7231 contiguous base pairs that covered completely the region from the 5'end of the 16S rRNA gene to the 5'end of the 23S rRNA gene comprising the whole 16S rRNA (rrs, and the following genes: Ala tRNA (alaT, Ile tRNA (ileT, adenylosuccinate lyase (purB, adenylosuccinate synthetase (purA, methylpurine-DNA glycosylase (mag, hypoxanthine-guanine phosphoribosyltransferase (hpt, an hydrolase (HAD superfamily and a 135 bp 5' fragment of the 23S rRNA (rrlA genes. Phylogenic sequence analysis defined all the Borrelia isolates from O. tholozani and from human TBRF cases in Israel and the West Bank as B. persica that clustered between the African and the New World TBRF species. Gene organization of the intergenic spacer between the 16S rRNA and the 23S rRNA was similar to that of other TBRF Borrelia species and different from the Lyme disease Borrelia species. Variants of B. persica were found among the different genes of the different isolates even in the same sampling area.

  13. Antioxidant Activities, Metabolic Profiling, Proximate Analysis, Mineral Nutrient Composition of Salvadora persica Fruit Unravel a Potential Functional Food and a Natural Source of Pharmaceuticals.

    Science.gov (United States)

    Kumari, Asha; Parida, Asish K; Rangani, Jaykumar; Panda, Ashok

    2017-01-01

    Salvadora persica is a medicinally important plant mainly used in oral hygiene. However, little attention has been given towards the nutritional prominence of this plant. This study encloses the proximate and mineral nutrient contents, amino acid composition, metabolite profiling and antioxidant potential of S. persica fruit. The ripen fruit contained substantial amount of sugars, mineral nutrients, carotenoids, polyphenols and flavonoids. The metabolic profiling of the fruit extract by GC-MS revealed a total of 22 metabolites comprising of sugars, sugar alcohols, organic acids, organic base, and aromatic silica compound. The identified metabolites have been previously reported to have potential antioxidant, antimicrobial, anti-hyperglycemic, and antitumor properties. The GC-MS analysis indicated high glucose and glucopyranose (247.62 and 42.90 mg g(-1) FW respectively) contents in fruit of S. persica. The fruit extract demonstrated a significantly higher antioxidant and ROS scavenging properties along with high contents of mineral nutrients and essential amino acids. HPLC analysis revealed presence of essential and non-essential amino acid required for healthy body metabolism. The cysteine was found to be in highest amount (733.69 mg 100 g(-1) DW) among all amino acids quantified. Specifically, compared to similar medicinal plants, previously reported as a source of non-conventional food and with some of the commercially important fruits, S. persica fruit appears to be a potential source of essential mineral nutrients, amino acids, vitamins (ascorbic acid and carotenoid) and pharmaceutically important metabolites contributing towards fulfilling the recommended daily requirement of these for a healthy human being. This is the first report establishing importance of S. persica fruit as nutraceuticals. The data presented here proposed that fruit of S. persica may be used as functional food or reinvigorating ingredient for processed food to reduce deficiency of

  14. Antioxidant capacity and fatty acid profile of Centaurea kotschyi (Boiss. and Heldr.) Hayek var. persica (Boiss.) Wagenitz from Turkey

    Energy Technology Data Exchange (ETDEWEB)

    Zengin, G.; Guler, G.O.; Cakmak, Y.S.; Aktumseka, A.

    2011-07-01

    The antioxidant capacity of the methanolic extract and the fatty acid composition of C. kotschyi var. persica were investigated. Six different chemical methods were used to determine the antioxidant capacity. The fatty acid composition was analyzed using gas chromatography. The IC50 value of the extract was determined as 37.09 ig/ml (in the DPPH assay). In the {beta}carotene/linoleic acid system, the extract exhibited 65.22% inhibition against linoleic acid oxidation. The amount of total phenolic content and total antioxidant capacity were detected as 36.52 mg gallic acid equivalent (GAE)/g and 74.93 mg ascorbic acid equivalent (AE)/g, respectively. The major fatty acid in the composition of C. kotschyi var. persica was found to be C 18:3 u3 ({beta}-linolenic acid) by GC analysis. The results presented here indicate that C. kotschyi var. persica possess strong antioxidant properties. Therefore, the species can be used as a natural additive in food, cosmetic and pharmaceutical industries. (Author).

  15. Molecular cloning, characterisation and mRNA expression of the ryanodine receptor from the peach-potato aphid, Myzus persicae.

    Science.gov (United States)

    Troczka, B J; Williams, A J; Bass, C; Williamson, M S; Field, L M; Davies, T G E

    2015-02-10

    The peach potato aphid, Myzus persicae, is one of the most important agricultural pests of temperate climates. It is mainly controlled through the judicious application of insecticides; however, over time, aphids have developed resistance to many insecticidal classes. The recent introduction of synthetic diamide insecticides, with a novel mode of action, potentially offers new tools to control aphid populations. These diamides act on the ryanodine receptor (RyR), a large endoplasmic calcium release channel. In this study we have cloned cDNAs encoding the complete open reading frame of the RyR from M. persicae. The open reading frame is 15,306 base pairs long and encodes a protein of 5101 amino acids. The aphid RyR shares many of the features of other insect and vertebrate RyRs, including a highly conserved transmembrane region. However, unlike the other RyRs characterised to date, the M. persicae channel does not display alternative splicing at any stage of its developmental cycle, so it cannot generate functional variants of the channel. Copyright © 2014. Published by Elsevier B.V.

  16. Aphid Transmission of the Ontario Isolate of Plum Pox Virus.

    Science.gov (United States)

    Lowery, D Thomas; Vickers, Patricia M; Bittner, Lori A; Stobbs, Lorne W; Foottit, Robert G

    2015-10-01

    Utilization of timed virus acquisition access probes in studies of plum pox virus (PPV) transmission by aphids demonstrated that endemic species transmitted the virus readily from plum, Prunus domestica (L.) Batsch; peach, P. persica (L.); or dwarf flowering almond, P. glandulosa Thunberg., to peach seedlings. The green peach aphid, Myzus persicae (Sulzer), was shown to be the most efficient vector. Acquisition of virus by green peach aphids from infected peach leaves resulted in 18-28% infected peach seedlings, while aphids previously fed on infected leaves of plum transferred virus to 36% of peach seedlings. Although the spirea aphid, Aphis spiraecola (Patch), was a less efficient vector than M. persicae it is perhaps more important for the spread of PPV due to its greater abundance and occurrence earlier in the season when peach trees are thought to be more susceptible to infection. Virus transmission rates varied depending on the virus source and healthy test plant species. In contrast to many previous studies, aphid inoculation of the experimental host Nicotiana benthamiana Domin occurred at a low rate, never exceeding 4%. Acquisition of PPV by M. persicae from infected peach fruit was greatly reduced compared with acquisition from leaves. The results of this research indicate that the Ontario isolate of PPV-D is readily transmissible by aphids to peach and natural spread of the virus needs to be considered in future management or eradication programs. © Her Majesty in Right of Canada, as represented by the Minister of Agriculture and Agri-Food Canada. Published by Oxford University Press on behalf of Entomological Society of America.

  17. Chemical composition and antibacterial properties of essential oil and fatty acids of different parts of Ligularia persica Boiss

    Directory of Open Access Journals (Sweden)

    Maryam Mohadjerani

    2016-04-01

    Full Text Available Objectives: The objective of this research was to investigate the chemical composition and antibacterial activities of the fatty acids and essential oil from various parts of Ligularia persica Boiss (L. persica growing wild in north of Iran. Materials and Methods: Essential oils were extracted by using Clevenger-type apparatus. Antibacterial activity was tested on two Gram-positive and two Gram-negative bacteria by using micro dilution method. Results: GC and GC∕MS analysis of the oils resulted in detection of 94%, 96%, 93%, 99% of the total essential oil of flowers, stems, roots and leaves, respectively. The main components of flowers oil were cis-ocimene (15.4%, β-myrcene (4.4%, β-ocimene (3.9%, and γ-terpinene (5.0%. The major constituents of stems oil were β-phellandrene (5.4%, β-cymene (7.0%, valencene (3.9%. The main compounds of root oil were fukinanolid (17.0%, α-phellandrene (11.5% and Β-selinene (5.0% and in the case of leaves oil were cis-ocimene (4.8%, β-ocimene (4.9%, and linolenic acid methyl ester (4.7%. An analysis by GC-FID and GC-MS on the fatty-acid composition of the different parts of L. persica showed that major components were linoleic acid (11.3-31.6%, linolenic acid (4.7-21.8% and palmitic acid (7.2-23.2%. Saturated fatty acids were found in lower amounts than unsaturated ones. The least minimum inhibition concentration (MIC of the L. persica was 7.16 μg/ml against Pseudomonas aeruginosa. Conclusion: Our study indicated that the essential oil from L. persica stems and flowers showed high inhibitory effect on the Gram negative bacteria. The results also showed that fatty acids from the stems and leaves contained a high amount of poly-unsaturated fatty acids (PUFAs.

  18. Longevidade e parâmetros reprodutivos de Myzus persicae (Sulzer, 1776 (Hemiptera: Aphididae sobre berinjela em diferentes temperaturas

    Directory of Open Access Journals (Sweden)

    Michelotto Marcos Doniseti

    2005-01-01

    Full Text Available O afídeo Myzus persicae (Sulzer, 1776 (Hemiptera: Aphididae é uma das principais pragas de diversas culturas em condições de campo ou em cultivo protegido. Este trabalho teve por objetivo avaliar o efeito de diferentes temperaturas na longevidade e nos aspectos reprodutivos de M. persicae sobre berinjela (Solanum melongena L.. O experimento foi conduzido sob condições controladas de temperatura (15, 20, 25 e 30degreesC, umidade relativa do ar (70 ? 10% e fotofase (12 horas. As unidades experimentais consistiram de placas de Petri contendo ágar-água solidificado (1%. Nestas placas, os afídeos foram mantidos individualmente sobre os discos foliares de berinjela (3 cm de diâmetro em uma das temperaturas (tratamentos, com 25 repetições. Foram determinadas as curvas mais ajustadas aos parâmetros biológicos de M. persicae, suas equações de regressão e os respectivos coeficientes de determinação (R². A temperatura influenciou todos os parâmetros avaliados. As durações dos períodos pré-reprodutivo e reprodutivo de M. persicae variaram de 0,46 dia (25degreesC a 1,12 dia (15degreesC e de 3,89 dias (25degreesC a 19,11 dias (15degreesC, respectivamente. A fecundidade total e diária foi de 17,63 ninfas/fêmea e 4,38 ninfas/fêmea/dia a 25degreesC; 43,63 ninfas/fêmea e 4,34 ninfas/fêmea/dia a 20degreesC; 60,65 ninfas/fêmea e 3,15 ninfas/fêmea/dia a 15degreesC. A 30degreesC, não houve reprodução. A duração do período pós-reprodutivo variou de 0,89 dia (25degreesC a 3,72 dias (15degreesC. A longevidade do afídeo diminuiu com o aumento da temperatura, de 23,95 dias (15degreesC para 5,06 dias (25degreesC. Temperaturas entre 15 e 20degreesC são mais favoráveis a M. persicae.

  19. The green peach aphid Myzus persicae perform better on pre-infested Chinese cabbage Brassica pekinensis by enhancing host plant nutritional quality.

    Science.gov (United States)

    Cao, He-He; Liu, Hui-Ru; Zhang, Zhan-Feng; Liu, Tong-Xian

    2016-02-24

    The green peach aphid, Myzus persicae Sulzer, is a notorious pest on vegetables, which often aggregates in high densities on crop leaves. In this study, we investigated whether M. persicae could suppress the resistance level of Chinese cabbage Brassica pekinensis. M. persicae performed better in terms of weight gain (~33% increase) and population growth (~110% increase) when feeding on previously infested (pre-infested) Chinese cabbage compared with those on non-infested plants. However, when given a choice, 64% of the aphids preferred to settle on non-infested leaves, while 29% of aphids chose pre-infested leaves that had a 2.9 times higher concentration of glucosinolates. Aphid feeding significantly enhanced the amino acid:sugar ratio of phloem sap and the absolute amino acid concentration in plant leaves. Aphid infestation significantly increased the expression levels of salicylic acid (SA) marker genes, while it had marginal effects on the expression of jasmonate marker genes. Exogenously applied SA or methyl jasmonate had no significant effects on M. persicae performance, although these chemicals increased glucosinolates concentration in plant leaves. M. persicae infestation increase amino acid:sugar ratio and activate plant defenses, but aphid performed better on pre-infested plants, suggesting that both nutrition and toxics should be considered in insect-plant interaction.

  20. Les espèces envahissantes : le cas du cerisier tardif (Prunus serotina Ehrh).

    OpenAIRE

    Pairon, Marie; Vervoort, Arnaud; Jacquemart, Anne-Laure

    2006-01-01

    Introduites pour divers usages, les espèces envahissantes se sont rapidement adaptées et répandues dans leurs nouveaux habitats. Elles ont pour la plupart des impacts environnementaux, économiques et/ou sociaux. Parmi les essences forestières introduites, le cerisier tardif (Prunus serotina Ehrh.), importé d’Amérique du Nord, est une espèce particulièrement en expansion dans nos forêts et est considérée comme espèce envahissante en Belgique, surtout sur les so...

  1. Immunocytochemical Localization of Prunasin Hydrolase and Mandelonitrile Lyase in Stems and Leaves of Prunus serotina.

    Science.gov (United States)

    Swain, E.; Poulton, J. E.

    1994-12-01

    In macerates of black cherry (Prunus serotina Ehrh.) leaves and stems, (R)-prunasin is catabolized to HCN, benzaldehyde, and D-glucose by the sequential action of prunasin hydrolase (EC 3.2.1.21) and (R)-(+)-mandelonitrile lyase (EC 4.1.2.10). Immuno-cytochemical techniques have shown that within these organs prunasin hydrolase occurs within the vacuoles of phloem parenchyma cells. In arborescent leaves, mandelonitrile lyase was also located in phloem parenchyma vacuoles, but comparison of serial sections revealed that these two degradative enzymes are usually localized within different cells.

  2. Alternaria cerasidanica sp nov., isolated in Denmark from drupes of Prunus avium

    DEFF Research Database (Denmark)

    Roberts, R. G.; Reymond, S. T.; Andersen, Birgitte

    2010-01-01

    The ex-type strain of Alternaria cerasidanica was isolated in 2001 from an immature, asymptomatic drupe of Prunus avium collected at a commercial cherry orchard near Skaelskor, Denmark. Cultural morphology, sporulation pattern and cluster analyses of combined RAPD, RAMS (microsatellite), and AFLP...... fingerprints of A. cerasidanica and 167 strains of Alternaria spp. support the placement of A. cerasidanica within the A. infectoria species-group sensu Simmons and its segregation from other members of this group. A. cerasidanica is currently monotypic and known only from preharvest sweet cherry fruit...

  3. Isolation and Structure Elucidation of a New Triterpenoid from Prunus cerasoides D. Don

    Directory of Open Access Journals (Sweden)

    Liaqat Ali

    2013-03-01

    Full Text Available One new metabolite, prunol (1, belonging to the pentacyclic triterpenoid skeleton was purified from the dichloromethane soluble fraction of the crude ethanolic extract of Prunus cerasoides D. Don. The structure elucidation was accomplished on the basis of one dimensional 1H and 13C NMR and two dimensional HMQC, HMBC, and COSY experiments. The molecular mass was determined by HRFAB-MS, while the major fragments were observed in the EI-MS. The comparative analysis of the NMR spectral data with the known analogues and the NOESY experiments were helpful in assigning the stereo centers in the molecule.

  4. PRUNUS SERRULATA VAR. 'KANZAN' MICROSHOOTS BEHAVIOUR DURING IN VITRO ROOTING AND ACCLIMATIZATION PHASES

    Directory of Open Access Journals (Sweden)

    Magdalena Duţă

    2012-04-01

    Full Text Available The paper presents aspects regarding in vitro rooting and acclimatization percentages of Prunus serrulata var. Kanzan vitroplants. During in vitro rooting stage, good results were obtained using a nutrient medium with the following composition: halved Murashige - Skoog mineral salts, Linsmaier – Skoog vitamins, gibberellic acid (GA 0.1 mg/l, indolelacetic acid (IAA 1.0 mg/l, activated carbon 0.3 mg/l, iron chelate 38 mg/l, 30 g/l dextrose, 7 g/l agar. The substrate recommended for acclimatization of in vitro plants is composed of black peat + perlite (1:1, at pH = 6.0.

  5. The apoplastic antioxidant system in Prunus: response to long-term plum pox virus infection.

    Science.gov (United States)

    Diaz-Vivancos, P; Rubio, M; Mesonero, V; Periago, P M; Barceló, A Ros; Martínez-Gómez, P; Hernández, J A

    2006-01-01

    This work describes, for the first time, the changes taking place in the antioxidative system of the leaf apoplast in response to plum pox virus (PPV) in different Prunus species showing different susceptibilities to PPV. The presence of p-hydroxymercuribenzoic acid (pHMB)-sensitive ascorbate peroxidase (APX) (class I APX) and pHMB-insensitive APX (class III APX), superoxide dismutase (SOD), peroxidase (POX), NADH-POX, and polyphenoloxidase (PPO) was described in the apoplast from both peach and apricot leaves. PPV infection produced different changes in the antioxidant system of the leaf apoplast from the Prunus species, depending on their susceptibility to the virus. In leaves of the very susceptible peach cultivar GF305, PPV brought about an increase in class I APX, POX, NADH-POX, and PPO activities. In the susceptible apricot cultivar Real Fino, PPV infection produced a decrease in apoplastic POX and SOD activities, whereas a strong increase in PPO was observed. However, in the resistant apricot cultivar Stark Early Orange, a rise in class I APX as well as a strong increase in POX and SOD activities was noticed in the apoplastic compartment. Long-term PPV infection produced an oxidative stress in the apoplastic space from apricot and peach plants, as observed by the increase in H2O2 contents in this compartment. However, this increase was much higher in the PPV-susceptible plants than in the resistant apricot cultivar. Only in the PPV-susceptible apricot and peach plants was the increase in apoplastic H2O2 levels accompanied by an increase in electrolyte leakage. No changes in the electrolyte leakage were observed in the PPV-inoculated resistant apricot leaves, although a 42% increase in the apoplastic H2O2 levels was produced. Two-dimensional electrophoresis analyses revealed that the majority of the polypeptides in the apoplastic fluid had isoelectric points in the range of pI 4-6. The identification of proteins using MALDI-TOF (matrix-assisted laser

  6. Biased transmission of sex chromosomes in the aphid Myzus persicae is not associated with reproductive mode.

    Directory of Open Access Journals (Sweden)

    Alex C C Wilson

    Full Text Available Commonly, a single aphid species exhibits a wide range of reproductive strategies including cyclical parthenogenesis and obligate parthenogenesis. Sex determination in aphids is chromosomal; females have two X chromosomes, while males have one. X chromosome elimination at male production is generally random, resulting in equal representation of both X chromosomes in sons. However, two studies have demonstrated deviations from randomness in some lineages. One hypothesis to account for such deviations is that recessive deleterious mutations accumulate during bouts of asexual reproduction and affect male viability, resulting in overrepresentation of males with the least deleterious of the two maternal X chromosomes. This hypothesis results in a testable prediction: X chromosome transmission bias will increase with time spent in the asexual phase and should therefore be most extreme in the least sexual aphid life cycle class. Here we test this prediction in Myzus persicae. We used multiple heterozygous X-linked microsatellite markers to screen 1085 males from 95 lines of known life cycle. We found significant deviations from equal representation of X chromosomes in 15 lines; however, these lines included representatives of all life cycles. Our results are inconsistent with the hypothesis that deviations from randomness are attributable to mutation accumulation.

  7. Effects of Salvadora persica Extract on the Hematological and Biochemical Alterations against Immobilization-Induced Rats

    Directory of Open Access Journals (Sweden)

    Kholoud S. Ramadan

    2015-01-01

    Full Text Available A total of 24 rats were divided into 4 groups: control, stress, extract alone, and stress + extract (n=6 each, for total 21 days of treatment. The immobilization stress was induced in rats by putting them in 20 cm × 7 cm plastic tubes for 2 h/day for 21 days. Rats were postorally treated with Salvadora persica at a dose of 900 mg/kg body weight via intragastric intubations. At the end of the test period, hematological and biochemical parameters were determined in blood and serum samples with determination of vital organs weights. The vital organ weights were not significantly affected in stressed rats as compared to control rats. Compared to the control group, the stress treated group showed significances in several hematological parameters, including decreases in WBC, RBC, and PLT counts. Furthermore, in comparison to the control group, the stress group showed significantly increased blood glucose, serum total cholesterol, LDL-cholesterol, and triacylglycerols levels and decreased HDL-cholesterol level. The hematological and biochemical parameters in the stress + extract treated group were approximately similar to control group. The SP extract restored the changes observed following stress treatment.

  8. Effects of Different Treatments on Seed Germination Improvement of Calotropis persica

    Directory of Open Access Journals (Sweden)

    Asghar Farajollahi

    2014-01-01

    Full Text Available The purpose of this study was to investigate the effects of different treatments on seed germination in the desert plant species Calotropis persica (Gand.. This species is known to have long time for seed germination considering arid region condition and short time of access moist. An experiment was performed with 13 treatments and 4 replications in a completely randomized design. Treatments included KNO3 with concentrations of 0.1, 0.2, and 0.3 percent, immersion in hot water for five min, acetylsalicylic acid 100, 200, and 300 mg L−1, ethereal sulfuric acid (60% for 5 and 10 min, thiourea with concentrations of 0.1% and 0.3%, and prechilling for 10 days. Tap water was used as the control. Our findings indicate that KNO3 0.1% and 100 mg L−1 acetylsalicylic acid were the most effective treatments for improvement of seed germination properties in this species. In a comparison of the two mentioned treatment, KNO3 0.1% treatments is the best.

  9. Behavioural avoidance and enhanced dispersal in neonicotinoid-resistant Myzus persicae (Sulzer).

    Science.gov (United States)

    Fray, Lucy M; Leather, Simon R; Powell, Glen; Slater, Russell; McIndoe, Eddie; Lind, Robert J

    2014-01-01

    The peach potato aphid Myzus persicae is a major agricultural pest capable of transmitting over 100 plant viruses to a wide range of crops. Control relies largely upon treatment with neonicotinoid insecticides such as thiamethoxam (TMX). In 2009, a strain denoted FRC, which exhibits between 255- and 1679-fold resistance to current neonicotinoids previously linked to metabolic and target site resistance, was discovered in France. Dispersal behaviour may potentially further enhance the resistance of this strain. This study investigated this possibility and is the first to compare the dispersal behaviour of aphid clones of the same species with differing levels of neonicotinoid resistance. Comparing the dispersal behaviour of the FRC strain with that of a clone of lower neonicotinoid resistance (5191A), and a susceptible clone (US1L) highlighted several differences. Most importantly, the FRC strain exhibited an increased ability to locate untreated areas when presented with an environment consisting of both TMX-treated and untreated plant tissue. The altered dispersal behaviour of the FRC may partially account for the high level of neonicotinoid resistance exhibited by this strain in the field. Since the dispersal of aphid vectors is key to the transmission of viruses across crop fields this has implications for current crop protection practice. © 2013 Society of Chemical Industry.

  10. (E)-β-farnesene synthase genes affect aphid (Myzus persicae) infestation in tobacco (Nicotiana tabacum).

    Science.gov (United States)

    Yu, Xiudao; Jones, Huw D; Ma, Youzhi; Wang, Genping; Xu, Zhaoshi; Zhang, Baoming; Zhang, Yongjun; Ren, Guangwei; Pickett, John A; Xia, Lanqin

    2012-03-01

    Aphids are major agricultural pests which cause significant yield losses of the crop plants each year. (E)-β-farnesene (EβF) is the alarm pheromone involved in the chemical communication between aphids and particularly in the avoidance of predation. In the present study, two EβF synthase genes were isolated from sweet wormwood and designated as AaβFS1 and AaβFS2, respectively. Overexpression of AaβFS1 or AaβFS2 in tobacco plants resulted in the emission of EβF ranging from 1.55 to 4.65 ng/day/g fresh tissues. Tritrophic interactions involving the peach aphids (Myzus persicae), predatory lacewings (Chrysopa septempunctata) demonstrated that the transgenic tobacco expressing AaβFS1 and AaβFS2 could repel peach aphids, but not as strongly as expected. However, AaβFS1 and AaβFS2 lines exhibited strong and statistically significant attraction to lacewings. Further experiments combining aphids and lacewing larvae in an octagon arrangement showed transgenic tobacco plants could repel aphids and attract lacewing larvae, thus minimizing aphid infestation. Therefore, we demonstrated a potentially valuable strategy of using EβF synthase genes from sweet wormwood for aphid control in tobacco or other economic important crops in an environmentally benign way.

  11. Biased transmission of sex chromosomes in the aphid Myzus persicae is not associated with reproductive mode.

    Science.gov (United States)

    Wilson, Alex C C; Delgado, Ryan N; Vorburger, Christoph

    2014-01-01

    Commonly, a single aphid species exhibits a wide range of reproductive strategies including cyclical parthenogenesis and obligate parthenogenesis. Sex determination in aphids is chromosomal; females have two X chromosomes, while males have one. X chromosome elimination at male production is generally random, resulting in equal representation of both X chromosomes in sons. However, two studies have demonstrated deviations from randomness in some lineages. One hypothesis to account for such deviations is that recessive deleterious mutations accumulate during bouts of asexual reproduction and affect male viability, resulting in overrepresentation of males with the least deleterious of the two maternal X chromosomes. This hypothesis results in a testable prediction: X chromosome transmission bias will increase with time spent in the asexual phase and should therefore be most extreme in the least sexual aphid life cycle class. Here we test this prediction in Myzus persicae. We used multiple heterozygous X-linked microsatellite markers to screen 1085 males from 95 lines of known life cycle. We found significant deviations from equal representation of X chromosomes in 15 lines; however, these lines included representatives of all life cycles. Our results are inconsistent with the hypothesis that deviations from randomness are attributable to mutation accumulation.

  12. Plant Essential Oils Synergize and Antagonize Toxicity of Different Conventional Insecticides against Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Faraone, Nicoletta; Hillier, N Kirk; Cutler, G Christopher

    2015-01-01

    Plant-derived products can play an important role in pest management programs. Essential oils from Lavandula angustifolia (lavender) and Thymus vulgaris (thyme) and their main constituents, linalool and thymol, respectively, were evaluated for insecticidal activity and synergistic action in combination with insecticides against green peach aphid, Myzus persicae (Sulzer) (Hemiptera: Aphididae). The essential oils and their main constituents exerted similar insecticidal activity when aphids were exposed by direct sprays, but were non-toxic by exposure to treated leaf discs. In synergism experiments, the toxicity of imidacloprid was synergized 16- to 20-fold by L. angustifolia and T. vulgaris essential oils, but far less synergism occurred with linalool and thymol, indicating that secondary constituents of the oils were probably responsible for the observed synergism. In contrast to results with imidacloprid, the insecticidal activity of spirotetramat was antagonized by L. angustifolia and T. vulgaris essential oils, and linalool and thymol. Our results demonstrate the potential of plant essential oils as synergists of insecticides, but show that antagonistic action against certain insecticides may occur.

  13. [Geostatistical analysis on distribution dynamics of Myzus persicae (Sulzer) in flue-cured tobacco field].

    Science.gov (United States)

    Xia, Peng-liang; Liu, Ying-hong; Fan, Jun; Tan, Jun

    2015-02-01

    Abstract: Myzus persicae belonging to Aphididae, Hemiptera, is an important migratory pest in tobacco field. As nymph and adult, it sucks the juice, breeds the mildew stains disease, spreads tobacco virus diseases and causes huge losses to the yield and quality. The distribution pattern and dynamics of winged and wingless aphids in the field were investigated from the transplanting of tobacco to the harvesting stage of mid-place tobacco leaves in Enshi, Hubei. The semivariable function characteristics were analyzed by geostatistical method, and the field migration pattern were simulated. The results showed that the population dynamics of winged aphids in Enshi were of bimodal curve, with two peaks at 3 weeks after transplanting and 2 weeks after multi-topping of tobacco leaves, and there were five-step process such as random, aggregation, random, aggregation and random. The population dynamics of wingless peach aphids were of single-peak curve, getting its peak before multi-topping, and had random, aggregation, random three-step process. Human factors and the hosts had considerable effects on the population density. Spatial distribution simulation-interpolation-figure could clearly reflect the dynamics of tobacco aphids. Combined with the Pearson correlation analysis, we found that the population density was low and highly concentrated as winged type in the immigration period, which was the key period for the management of peach aphids.

  14. Seasonal activity of cambium in some tropical trees. 111. Salvadora persica L.

    Directory of Open Access Journals (Sweden)

    G. S. Paliwal

    2015-01-01

    Full Text Available Seasonal activity of cambium has been investigated in Salvadora persica L., one of the commonest evergrenn tree of northern India, from March, 1974 to February, 1975 in the main stem and the branch. Secondary vascular cambium behaves abnormally on the xylem side, by producing xylem and phloem in succession, resulting in the formation of interxylary phloem. It has a storied (sitratified cambium organization, comprising short fusiform and isodiametric ray initials. The fusiform initials show characteristically beaded cell walls due to the presence of primary pit fields and are uninucleate. These are highly vacuolate during the active period. The cambial activity starts in the month of March, reaches the peak in August and finally slows down in the main stem. In an young branch, however, it is initiated in March-April and reaches the peak in July and then declines till November. It once again showed an upward trend gradually. It appears that the initiation of the combial activity in this tree takes place by a hormone produced in the newly formed leaves, coupled with the high rainfall, enhanced relative humidity, optimum temperature, and short-day conditions. Size measurements for the fusiform initials showed considerable variations during the span of a year. A comparision of the organization of three types of phloem 'normal', 'included' and 'internal' occurring in this plant has also bean presented.

  15. Silício e imidacloprid na colonização de plantas por Myzus persicae e no desenvolvimento vegetativo de batata inglesa Silicon and imidacloprid on plants colonized by Myzus persicae and on vegetative development of potato

    Directory of Open Access Journals (Sweden)

    Flávia Batista Gomes

    2008-08-01

    Full Text Available O pulgão Myzus persicae (Sulzer é considerado praga-chave da cultura da batata inglesa, cuja produtividade depende do uso de inseticidas para o seu controle. Este trabalho foi conduzido para verificar o efeito do silício e do imidaclopride na colonização de plantas por M. persicae e seus possíveis reflexos positivos no desenvolvimento da batata inglesa. Foram testados cinco tratamentos, com sete repetições: 1- testemunha; 2- ácido silícico a 1%; 3- imidacloprid na dosagem recomendada (252g ha-1; 4- ácido silícico a 1% e imidacloprid na metade da dosagem recomendada (126g ha-1; e 5- imidaclopride na metade da dosagem recomendada (126g ha-1. Após 20 dias do plantio, as plantas (cv. Emeraude foram infestadas com dez pulgões adultos. Avaliaram-se, após 20 dias da infestação, o número de ninfas e de adultos de pulgões, a altura, o diâmetro, o número de folhas e a fitomassa fresca e seca das plantas. As plantas tratadas com o inseticida foram pouco colonizadas pelos pulgões e aquelas tratadas com silício apresentaram menor infestação em relação à testemunha. Em relação à altura, ao diâmetro e à fitomassa, não houve diferença significativa entre os tratamentos, porém a testemunha apresentou menor número de folhas. Assim, o silício diminuiu a colonização da batata por M. persicae e o uso da metade da dosagem recomendada de imidacloprid (126g ha-1 foi igualmente eficiente para impedir a colonização, tornando a adubação silicatada mais uma tática a ser testada no manejo integrado de pragas da batateira.The aphid Myzus persicae (Sulzer is a key pest of potato crops, the yield of which depends on insecticides for its control. This research was carried out to verify the effect of silicon and imidacloprid on the colonization of potato plants by M. persicae and its possible positive consequences on development parameters. Five treatments with seven replications were tested: 1- control treatment; 2- 1% silicic acid

  16. Evaluation of Aphis glycines as an Alternative Host for Supporting Aphelinus albipodus Against Myzus persicae on Capsicum annuum cv. Ox Horn and Hejiao 13.

    Science.gov (United States)

    Song, Y Q; Sun, H Z; Du, J; Wang, X D; Cheng, Z J

    2017-04-01

    Bank plant systems provide effective biological control for pests infesting commercially important crops. Aphids cause physical damage to crops by feeding on the leaves, as well as transmitting damaging viral diseases. To develop a bank plant system to control aphids that damage vegetable crops, we initially reared the parasitoid Aphelinus albipodus (Hayat and Fatima) on the soybean aphid, Aphis glycines (Matsumura) reared on the soybean plant, Glycine max (L.) that was elected as the alternate host. Parasitoid adults that emerged from A. glycines were allowed to parasitize second instar nymphs of the aphid Myzus persicae (Sulzer) which were reared on sweet pepper and chili pepper leaves. The results showed that A. albipodus females feeding and parasitizing M. persicae nymphs reared on sweet pepper lived for 18.9 days, with an average fecundity of 337.3 progenies/female, while females feeding and parasitizing on M. persicae nymphs reared on chili pepper lived for 18.8 days, with an average fecundity of 356.2 progenies/female. There were no significant difference in the development time and reproduction of A. albipodus individuals parasitizing M. persicae nymphs reared on sweet pepper and chili pepper plants. The intrinsic rate of increase (r), net reproductive rate (R 0 ), net aphid killing rate (Z 0 ), and finite aphid killing rate (θ) of A. albipodus parasitizing sweet pepper and chili pepper M. persicae was 0.2258 days -1 , 171.7 progeny adults, 222.6 aphids, and 0.4048 and 0.2295 days -1 , 191.8 progeny adults, 243.3 aphids, and 0.4021, respectively. Our results suggested that A. glycines could serve as an effective alternative host for supporting A. albipodus against M. persicae infesting sweet pepper and chili pepper.

  17. Amygdalin isolated from Semen Persicae (Tao Ren) extracts induces the expression of follistatin in HepG2 and C2C12 cell lines.

    Science.gov (United States)

    Yang, Chuanbin; Li, Xuechen; Rong, Jianhui

    2014-01-01

    The Chinese medicine formulation ISF-1 (also known as Bu-Yang-Huan-Wu-Tang) for post-stroke rehabilitation could increase the expression of growth-regulating protein follistatin by approximately 4-fold. This study aims to identify the active compounds of ISF-1 for the induction of follistatin expression. Active compounds in ISF-1 responsible for induction of follistatin were identified by a bioactivity-guided fractionation procedure involving liquid-liquid extraction, HPLC separation and RT-PCR detection. The aqueous extracts of seven ISF-1 ingredients including Semen Persicae (Tao Ren) and the S. Persicae-derived fractions were assayed for the induction of follistatin mRNA expression in human hepatocarcinoma HepG2 cells by RT-PCR. The concentrations of isolated compounds were proportionally normalized to the reported IC50 concentration (5.8 mg/mL) of the formulation ISF-1 in HepG2. The active fractions were characterized by reverse-phase HPLC on a C18 column and identified by mass spectrometry. Three ingredients of ISF-1, namely S. Persicae (Tao Ren), Pheretima (Di Long), and Flos Carthami (Hong Hua), induced the expression of follistatin mRNA. Among these, the ingredient S. Persicae were the most active, and amygdalin from S. Persicae extract was identified as a novel follistatin inducer. Amygdalin stimulated the growth of skeletal muscle cell line C2C12 cells in a concentration-dependent manner. Amygdalin isolated from S. Persicae extract in ISF-1 through a bioactivity-guided fractionation procedure induced the expression of follistatin in HepG2 and C2C12 cell lines.

  18. Shade, leaf growth, and crown development of Quercus rubra, Q. velutina, Prunus serotina, and Acer rubrum seedlings

    Science.gov (United States)

    Kurt W. Gottschalk

    1994-01-01

    The study was conducted in an open field to detennine the optimum irradiance for establishment and growth of two oak species and two major associated woody species. Half-sib seedlings of black cherry (Prunus serotina Ehrh.), red maple (Acer rubrum L.), northern red oak (Quercus rubra L.) and black oak (Q. velutina Lam.) were grown for two years under shade-clotht...

  19. Bacterial wetwood detection in Fagus grandifolia and Prunus serotina sapwood using a conducting polymer electronic-nose device

    Science.gov (United States)

    A.D. Wilson

    2014-01-01

    New electronic gas-detection methods were developed and tested for the diagnosis of bacterial wetwood disease in Fagus grandifolia (American beech) and Prunus serotina (black cherry) using a Conducting Polymer (CP)-type electronic nose (e-nose), the Aromascan A32S, based on detection of headspace...

  20. Botryosphaeriaceae as potential pathogens of prunus species in South Africa, with descriptions of Diplodia africana and Lasiodiplodia plurivora sp. nov

    NARCIS (Netherlands)

    Damm, Ulrike; Crous, Pedro W; Fourie, Paul H

    2008-01-01

    Botryosphaeriaceae are common dieback and canker pathogens of woody host plants, including stone fruit trees. In the present study the diversity of members of the Botryosphaeriaceae isolated from symptomatic wood of Prunus species (plum, peach, nectarine and apricot) was determined in stone

  1. Botryosphaeriaceae as potential pathogens of Prunus species in South Africa, with descriptions of Diplodia africana and Lasiodiplodia plurivora sp. nov.

    NARCIS (Netherlands)

    Damm, U.; Crous, P.W.; Fourie, P.H.

    2007-01-01

    Botryosphaeriaceae are common dieback and canker pathogens of woody host plants, including stone fruit trees. In the present study the diversity of members of the Botryosphaeriaceae isolated from symptomatic wood of Prunus species (plum, peach, nectarine and apricot) was determined in stone

  2. A fissitunicate ascus mechanism in the Calosphaeriaceae, and novel species of Jattaea and Calosphaeria on Prunus wood

    NARCIS (Netherlands)

    Damm, U.; Crous, P.W.; Fourie, P.H.

    2008-01-01

    During a survey of Prunus wood from South Africa, isolations were made of three presumably Calosphaerialean fungi that formed hyphomycetous, phialidic anamorphs in culture. In order to reveal the phylogenetic relationship of these fungi, they were characterised on a morphological and molecular (LSU

  3. Controle da cochonilha-parda Parthenolecanium persicae (Fabricius, 1776 (Hemiptera: Coccidae na cultura da videira Control of the european peach scale Parthenolecanium persicae (Fabricius, 1776 (Hemiptera: Coccidae in vineyards

    Directory of Open Access Journals (Sweden)

    Ana Paula Schneid Afonso

    2004-08-01

    Full Text Available A cochonilha-parda Parthenolecanium persicae é considerada uma das principais pragas da videira na região sul do Brasil. Com o objetivo de avaliar inseticidas fosforados e neonicotinóides foram conduzidos dois experimentos avaliando-se os produtos fitossanitários: dimetoato (Tiomet 400 CE, 100mL/100L de água, fenitrotion (Sumithion 500 CE, 150mL/100 L de água, metidation (Supracid 400 CE, 100mL/100L de água, paratiom metil (Folidol 600 CE, 100mL/100L de água e triclorfon (Dipterex 500 SNAqC, 300mL/100L de água em 2001 e, imidacloprid (Provado 200 SC, 30, 40 e 50mL/100L de água, tiacloprid (Calypso 480 SC, 20, 30 e 40mL/100L, tiametoxam (Actara 250 WG, 20, 30 e 40g/100L de água e paratiom metil (Folidol 600 CE, 100mL/100L em 2002. Os produtos foram aplicados via foliar num volume de 800L.ha-1. Os fosforados fenitrotion, metidation, paratiom metil e os neonicotinóides imidacloprid e tiametoxam foram eficientes no controle de ninfas do terceiro ínstar de P. persicae. Os inseticidas dimetoato e tiacloprid não atingiram 50% de controle da cochonilha-parda na cultura da videira.The european peach scale Parthenolecanium persicae is one of the most important grape pest in southern Brasil. The insecticides dimetoato (Tiomet 400 CE, 100mL/100L, fenitrotion (Sumithion 500 CE, 150mL/100L, metidation (Supracid 400 CE, 100mL/100L, paratiom metil (Folidol 600 CE, 100mL/100L and triclorfon (Dipterex 500 SNAqC, 300mL/100L were evaluated in a field experiment in 2001 and imidacloprid (Provado 200 SC, 30, 40 and 50mL/100L, tiacloprid (Calypso 480 SC, 20, 30 and 40mL/100L, tiametoxam (Actara 250 WG, 20, 30 and 40 g/100L and paratiom metil (Folidol 600 CE, 100mL/100L in 2002. Insecticides were sprayed using 800L of water.ha-1 seeking third instar nymphs. Phosporous insecticides fenitrotion, metidation, paratiom metil and triclorfon and the neonicotinoid imidacloprid and tiametoxam were efficient for P. persicae control. Dimetoato and tiacloprid were

  4. Ecophysiological and morphological responses to shade and drought in two contrasting ecotypes of Prunus serotina.

    Science.gov (United States)

    Abrams, M D; Kloeppel, B D; Kubiske, M E

    1992-06-01

    Photosynthesis (A), water relations and stomatal reactivity during drought, and leaf morphology were evaluated on 2-year-old, sun- and shade-grown Prunus serotina Ehrh. seedlings of a mesic Pennsylvania seed source and a more xeric Wisconsin source. Wisconsin plants maintained higher A and leaf conductance (g(wv)) than Pennsylvania plants during the entire drought under sun conditions, and during the mid stages of drought under shade conditions. Compared to shade plants, sun plants of both sources exhibited a more rapid decrease in A or % A(max) with decreasing leaf water potential (Psi). Tissue water relations parameters were generally not significantly different between seed sources. However, osmotic potentials were lower in sun than shade plants under well-watered conditions. Following drought, shade plants, but not sun plants, exhibited significant osmotic adjustment. Sun leaves had greater thickness, specific mass, area and stomatal density and lower guard cell length than shade leaves in one or both sources. Wisconsin sun leaves were seemingly more xerophytic with greater thickness, specific mass, and guard cell length than Pennsylvania sun leaves. No source differences in leaf structure were exhibited in shade plants. Stomatal reactivity to sun-shade cycles was similar between ecotypes. However, well-watered and droughted plants differed in stomatal reactivity within and between multiple sun-shade cycles. The observed ecotypic and phenotypic variations in ecophysiology and morphology are consistent with the ability of Prunus serotina to survive in greatly contrasting environments.

  5. Electronic nose to detect volatile compound profile and quality changes in 'spring Belle' peach (Prunus persica L.) during cold storage in relation to fruit optical properties measured by time-resolved reflectance spectroscopy.

    Science.gov (United States)

    Rizzolo, Anna; Bianchi, Giulia; Vanoli, Maristella; Lurie, Susan; Spinelli, Lorenzo; Torricelli, Alessandro

    2013-02-27

    The aim of this research was to study the relationships between electronic nose (E-nose) pattern, maturity class of peaches assessed at harvest by means of absorption coefficient at 670 nm (μ(a)670) measured in fruit pulp by time-resolved reflectance spectroscopy (TRS), and quality evolution during a 4 week cold storage. 'Spring Belle' peaches were measured for μ(a)670 by TRS, ranked according to decreasing μ(a)670 value, divided into three TRS maturity classes (less (LeM), medium (MeM), and more (MoM) mature), and randomized into 9 samples of 30 fruit each, so that fruits from the whole μ(a)670 range were present in each sample. At harvest and after 1, 2, 3, and 4 weeks of storage at 0 and 4 °C, fruits of each sample were evaluated for firmness, expressible juice, μ(a)670, and ethylene production. LeM and MoM peaches of each sample were analyzed for aroma pattern by a commercial electronic nose and by static HS-GC and for sugar (glucose, fructose, sucrose, and sorbitol) and organic acid (quinic, malic, and citric acids) compositions by HPLC. Principal component analysis (PCA) of electronic nose data emphasized the ability of the E-nose to assess the ripening stage of fruit associated with maturity class, storage time, and storage temperature. The sensors having the highest influence on the pattern were W5S in PC-1, W1S in PC-2, and W2S in PC-3. From linear correlation analysis between PCs and firmness, flavor, and volatile compounds, it was found that PC-1 was related to ethylene production and volatile compounds (mainly acetate esters and ethanol); the highest PC-1 scores were found for fruit belonging to the MoM class after 2 weeks of storage at 4 °C, which showed the rise in ethylene production coupled with the highest total volatile production and sugar and acid composition of ripe peach fruits. PC-2 correlated with hexanal, ethyl acetate, and sugar composition, and PC-3 was mainly related to flavor compounds; both functions significantly changed with cold storage time in different ways according to storage temperature and maturity class.

  6. Potencial de manejo de Myzus persicae com óleo de pinhão manso armazenado em diferentes embalagens

    Directory of Open Access Journals (Sweden)

    Anderson Mathias Holtz

    2015-12-01

    Full Text Available Myzus persicae vem provocando prejuízos em diversas hortícolas. A utilização de inseticidas químicos vem proporcionando graves problemas na agricultura e meio ambiente. Métodos alternativos de controle têm-se tornado uma ferramenta eficaz no manejo de pragas, como a utilização de plantas inseticidas. Com o objetivo de reduzir e/ou substituir os agrotóxicos sintéticos por produtos ecologicamente corretos, este trabalho visou estudar a potencialidade inseticida do óleo de Jatropha curcas sobre o pulgão verde da couve, armazenado por 180 dias, em diferentes embalagens. Foram utilizados discos de folhas de couve contendo 10 pulgões, os quais foram imersos em solução de óleo de pinhão manso nas concentrações 0,0; 0,5; 1,0; 2,0 %. A mortalidade variou em função do tempo de armazenamento, concentração e do uso de diferentes tipos de recipientes, ocorrendo interação significativa entre esses fatores. Os polietilenos “pet branco”, “iogurte” e vidro de cor âmbar apresentaram maior mortalidade na concentração de 2 % ao longo do tempo, sendo que a maior mortalidade (99, 100 e 98 % foi obtida no período de 120, 150 e 60 dias de armazenamento, respectivamente. O polietileno “pet verde” também apresentou maior mortalidade na concentração de 2 % até os 150 dias. Essa foi de 100 % no tempo de armazenamento zero e de 14,6 % no tempo de 180 dias, demonstrando, nesse caso, que o tempo de armazenamento em garrafa “pet verde” interfere na ação do óleo sobre M. persicae. Conclui-se que óleo de pinhão manso, mesmo armazenado em diferentes recipientes ao longo do tempo, demonstra potencial no manejo de M. persicae. Palavras-chave: Myzus persicae. Jatropha curcas. Manejo alternativo.

  7. CONTROLE QUÍMICO DO PULGÃO MYZUS PERSICAE (SULZER,1776 (HOMOPTERA-APHIDIDAE NA CULTURA DO FUMO

    Directory of Open Access Journals (Sweden)

    Manoel Fernando Sigaran Tarragó

    1994-01-01

    Full Text Available RESUMO Estudou-se a ação de diferentes inseticidas sobre populações do pulgão, Myzus persicae, em lavouras de fumo da Agro Comercial Fumageira S. A., var. Sumatra, no Município de Cruz das Almas - BA. Foram realizados dois ensaios, um em dezembro de 1991 e o outro em fevereiro de 1992, e nas duas oportunidades mostraram-se eficientes os inseticidas Acefate 750 PS, Pirimicarb 500 PM e Metamidofos 600 CE.

  8. Impact of packaging material and storage conditions on polyphenol stability, colour and sensory characteristics of freeze-dried sour cherry (prunus cerasus var. Marasca)

    National Research Council Canada - National Science Library

    Zorić, Zoran; Pedisić, Sandra; Kovačević, Danijela Bursać; Ježek, Damir; Dragović-Uzelac, Verica

    2016-01-01

    The aim of this study was to evaluate the influence of packaging materials and storage conditions on polyphenols stability, colour and sensory characteristics of freeze-dried sour cherry (Prunus cerasus var. Marasca...

  9. Transcriptomic analysis revealed the mechanism of oil dynamic accumulation during developing Siberian apricot (Prunus sibirica L.) seed kernels for the development of woody biodiesel

    National Research Council Canada - National Science Library

    Niu, Jun; An, Jiyong; Wang, Libing; Fang, Chengliang; Ha, Denglong; Fu, Chengyu; Qiu, Lin; Yu, Haiyan; Zhao, Haiyan; Hou, Xinyu; Xiang, Zheng; Zhou, Sufan; Zhang, Zhixiang; Feng, Xinyi; Lin, Shanzhi

    2015-01-01

    Siberian apricot (Prunus sibirica L.) has emerged as a novel potential source of biodiesel in China, but the molecular regulatory mechanism of oil accumulation in Siberian apricot seed kernels (SASK...

  10. A multi-target therapeutic potential of Prunus domestica gum stabilized nanoparticles exhibited prospective anticancer, antibacterial, urease-inhibition, anti-inflammatory and analgesic properties

    National Research Council Canada - National Science Library

    Nazar Ul Islam; Raza Amin; Muhammad Shahid; Muhammad Amin; Sumera Zaib; Jamshed Iqbal

    2017-01-01

    .... In this study, Prunus domestica gum-loaded, stabilized gold and silver nanoparticles (Au/Ag-NPs) were evaluated for their prospective anticancer, antibacterial, urease-inhibition, anti-inflammatory, and analgesic properties...

  11. Morphological features of Persica species and varieties in the Forest-Steppe zone of Ukraine

    Directory of Open Access Journals (Sweden)

    І. М. Голубкова

    2017-03-01

    Full Text Available Purpose. To determine morphological and morphometric features of vegetative and generative organs of Persica species and varieties under the conditions of the Forest-Steppe zone of Ukraine for further use in breeding. Methods. Biological (morphological analysis and statistical (processing of morphometric parameters ones. Results. It was found that except ternate multiple buds, in peach hybrid ‘Suputnyk’collateral buds were prevalent which was not common to other tested varieties and species. Buds of each species and variety have a certain number of scales. The most scales were observed in ‘Suputnyk’. Pubescence of abaxial side of the leaf in P. davіdiana and ‘Suputnyk’ plants was not revealed. Species of P. vulgaris (‘Pecherskyi’, ‘Antotsianovyi’, ‘Poleskyi’ was characterized by increase in size of leaf blades, flowers and fruits. The distinctive features of P. davidiana and ‘Suputnyk’ are that stamens were accumulated in their flowers while in P. vulgaris they are branched. Raphe of a P. vulgaris stone protrudes above the edges of the bordering creases and consists of a number of narrow plates. Conclusions. For the breeding purposes, plants have an advantage for some basic criteria: the most flower buds that is common to interspecies hybrid ‘Suputnyk’; increase in photosynthetic productivity of the leaf apparatus to be typical for the variety ‘Pecherskyi’; large fruits that ‘Pecherskyi’ variety is noted for; intense red color of fruits that is inherent feature of ‘Antocianovyi’ variety.

  12. A functional genomics approach identifies candidate effectors from the aphid species Myzus persicae (green peach aphid.

    Directory of Open Access Journals (Sweden)

    Jorunn I B Bos

    2010-11-01

    Full Text Available Aphids are amongst the most devastating sap-feeding insects of plants. Like most plant parasites, aphids require intimate associations with their host plants to gain access to nutrients. Aphid feeding induces responses such as clogging of phloem sieve elements and callose formation, which are suppressed by unknown molecules, probably proteins, in aphid saliva. Therefore, it is likely that aphids, like plant pathogens, deliver proteins (effectors inside their hosts to modulate host cell processes, suppress plant defenses, and promote infestation. We exploited publicly available aphid salivary gland expressed sequence tags (ESTs to apply a functional genomics approach for identification of candidate effectors from Myzus persicae (green peach aphid, based on common features of plant pathogen effectors. A total of 48 effector candidates were identified, cloned, and subjected to transient overexpression in Nicotiana benthamiana to assay for elicitation of a phenotype, suppression of the Pathogen-Associated Molecular Pattern (PAMP-mediated oxidative burst, and effects on aphid reproductive performance. We identified one candidate effector, Mp10, which specifically induced chlorosis and local cell death in N. benthamiana and conferred avirulence to recombinant Potato virus X (PVX expressing Mp10, PVX-Mp10, in N. tabacum, indicating that this protein may trigger plant defenses. The ubiquitin-ligase associated protein SGT1 was required for the Mp10-mediated chlorosis response in N. benthamiana. Mp10 also suppressed the oxidative burst induced by flg22, but not by chitin. Aphid fecundity assays revealed that in planta overexpression of Mp10 and Mp42 reduced aphid fecundity, whereas another effector candidate, MpC002, enhanced aphid fecundity. Thus, these results suggest that, although Mp10 suppresses flg22-triggered immunity, it triggers a defense response, resulting in an overall decrease in aphid performance in the fecundity assays. Overall, we

  13. Divided infraorbital foramen in the lion (Panthera leo): its implications for colonisation history, population bottlenecks, and conservation of the Asian lion (P. l. persica)

    NARCIS (Netherlands)

    Yamaguchi, N.; Kitchener, A.C.; Driscoll, C.A.; Macdonald, D.W.

    2009-01-01

    A divided infraorbital foramen is an important morphological feature in lion taxonomy and has previously been considered to occur only in the Asian lion, Panthera leo persica. Based on an examination of 498 lion skulls from museum collections in Europe and southern Africa, we report for the first

  14. Genetic variation in target-site resistance to pyrethroids and pirimicarb in Tunisian populations of the peach potato aphid, Myzus persicae (Sulzer) (Hemiptera: Aphididae).

    Science.gov (United States)

    Charaabi, Kamel; Boukhris-Bouhachem, Sonia; Makni, Mohamed; Fenton, Brian; Denholm, Ian

    2016-12-01

    We used molecular assays to diagnose resistance to pyrethroids and pirimicarb in samples of Myzus persicae from field crops or an insect suction trap in Tunisia. Genotypes for resistance loci were related to ones for polymorphic microsatellite loci in order to investigate breeding systems and patterns of genetic diversity, and to inform resistance management tactics. The kdr mutation L1014F conferring pyrethroid resistance was found in all samples. The M918T s-kdr mutation also occurred in most samples, but only in conjunction with kdr. We discovered a previously unreported genotype heterozygous for L1014F but homozygous for M918T. Samples with modified acetylcholinesterase (MACE) conferring resistance to pirimicarb were less common but widespread. 16% of samples contained both the kdr and MACE mutations. Many unique microsatellite genotypes were found, suggesting that M. persicae is holocyclic in Tunisia. There were no consistent associations between resistance and microsatellite markers. This first study of insecticide resistance in M. persicae in North Africa showed genetic variation in insecticide resistance within microsatellite multilocus genotypes (MLG M s) and the same resistance mechanisms to be present in different MLG M s. This contrasts with variation in northern Europe where M. persicae is fully anholocyclic. Implications for selection and control strategies are discussed. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  15. Toxicity of newly isolated piperideine alkaloids from the red imported fire ant, Solenopsis invicta Buren, against the green peach aphid, Myzus persicae (Sulzer)

    Science.gov (United States)

    The green peach aphid, Myzus persicae (Sulzer), is a major insect pest of many agronomic and horticultural crops and is distributed worldwide Aphid management is often based on application of insecticides. However, the aphid is now resistant to many of these and much interest has recently develope...

  16. Borrelia persica: In vitro cultivation and characterization via conventional PCR and multilocus sequence analysis of two strains isolated from a cat and ticks from Israel.

    Science.gov (United States)

    Schwarzer, Sandra; Margos, Gabriele; Overzier, Evelyn; Fingerle, Volker; Baneth, Gad; Straubinger, Reinhard K

    2015-09-01

    Borrelia persica, one of the pathogenic agents of tick-borne relapsing fever, is transmitted by the soft tick Ornithodoros tholozani. It causes infections in humans as well as in animals. In this study, we developed a medium, termed Pettenkofer/LMU Bp, for reliable in vitro cultivation. Cell densities up to 5.2×10(7) viable cells/ml were achieved over at least 40 passages. The cultivable B. persica strain isolated from a cat was further analyzed by amplification of the flaB gene using conventional PCR. In addition, seven housekeeping genes (clpA, clpX, pepX, pyrG, recG, rplB and uvrA) of this B. persica strain and a second strain isolated out of pooled ticks from Israel were amplified and the phylogenetic relationships among Borrelia species were analyzed. The results of the conventional PCR and the multilocus sequence analysis confirmed our isolates as B. persica. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. Dicty_cDB: Contig-U06466-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .70 2 ( AJ824292 ) Prunus persica EST, clone S417J10. 34 0.87 2 ( CV050606 ) EST 10061 Half...U3_plate25_J06 PU3 Prunus persica cDNA similar t... 34 1.1 2 ( CV052260 ) EST 11708 Half-Ripe Apricot Fruit

  18. Susceptibility to Xylella fastidiosa in a first generation hybrid from a non-traditional peach-almond cross

    Science.gov (United States)

    To facilitate development of Prunus rootstocks with desirable agronomic traits, domesticated peach (Prunus persica) and almond (P. dulcis) were crossed with wild almond relatives. This work reports that a hybrid from a P. webbii x P. persica cv Harrow Blood cross is susceptible to almond leaf scorch...

  19. Resistance of Arabidopsis thaliana to the green peach aphid, Myzus persicae, involves camalexin and is regulated by microRNAs

    Science.gov (United States)

    Kettles, Graeme J; Drurey, Claire; Schoonbeek, Henk-jan; Maule, Andy J; Hogenhout, Saskia A

    2013-01-01

    Small RNAs play important roles in resistance to plant viruses and the complex responses against pathogens and leaf-chewing insects. We investigated whether small RNA pathways are involved in Arabidopsis resistance against a phloem-feeding insect, the green peach aphid (Myzus persicae). We used a 2-wk fecundity assay to assess aphid performance on Arabidopsis RNA silencing and defence pathway mutants. Quantitative real-time polymerase chain reaction was used to monitor the transcriptional activity of defence-related genes in plants of varying aphid susceptibility. High-performance liquid chromatography-mass spectrometry was employed to measure the accumulation of the antimicrobial compound camalexin. Artificial diet assays allowed the assessment of the effect of camalexin on aphid performance. Myzus persicae produces significantly less progeny on Arabidopsis microRNA (miRNA) pathway mutants. Plants unable to process miRNAs respond to aphid infestation with increased induction of PHYTOALEXIN DEFICIENT3 (PAD3) and production of camalexin. Aphids ingest camalexin when feeding on Arabidopsis and are more successful on pad3 and cyp79b2/cyp79b3 mutants defective in camalexin production. Aphids produce less progeny on artificial diets containing camalexin. Our data indicate that camalexin functions beyond antimicrobial defence to also include hemipteran insects. This work also highlights the extensive role of the miRNA-mediated regulation of secondary metabolic defence pathways with relevance to resistance against a hemipteran pest. PMID:23528052

  20. The attack of the clones: tracking the movement of insecticide-resistant peach-potato aphids Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Fenton, B; Malloch, G; Woodford, J A T; Foster, S P; Anstead, J; Denholm, I; King, L; Pickup, J

    2005-10-01

    Myzus persicae (Sulzer) collected in Scotland were characterized for four microsatellite loci, intergenic spacer fingerprints and the resistance mechanisms modified acetylcholinesterase (MACE), overproduced carboxylesterase and knockdown resistance (kdr). Microsatellite polymorphisms were used to define a limited number of clones that were either fully susceptible to insecticides or possessed characteristic combinations of resistance mechanisms. Within these clones, intergenic spacer fingerprints could either be very consistent or variable, with the latter indicating ongoing evolution within lineages, most likely derived from the same zygote. Two clones (termed A and B) possessed all three resistance mechanisms and predominated at sites treated with insecticides. Their appearance on seed potatoes and oilseed rape in Scotland in 2001 coincided with extensive insecticide use and severe control failures. Clones C, I and J, with no or fewer resistance mechanisms, were found in samples from 1995 and were dominant at untreated sites in 2001. A comparison of Scottish collections with those from other UK and non-UK sites provides insight into the likely origins, distribution and dynamics of M. persicae clones in a region where asexual (anholocyclic) reproduction predominates, but is vulnerable to migration by novel genotypes from areas of Europe where sexual (holocyclic) reproduction occurs.

  1. Resistance of Arabidopsis thaliana to the green peach aphid, Myzus persicae, involves camalexin and is regulated by microRNAs.

    Science.gov (United States)

    Kettles, Graeme J; Drurey, Claire; Schoonbeek, Henk-jan; Maule, Andy J; Hogenhout, Saskia A

    2013-06-01

    · Small RNAs play important roles in resistance to plant viruses and the complex responses against pathogens and leaf-chewing insects. · We investigated whether small RNA pathways are involved in Arabidopsis resistance against a phloem-feeding insect, the green peach aphid (Myzus persicae). We used a 2-wk fecundity assay to assess aphid performance on Arabidopsis RNA silencing and defence pathway mutants. Quantitative real-time polymerase chain reaction was used to monitor the transcriptional activity of defence-related genes in plants of varying aphid susceptibility. High-performance liquid chromatography-mass spectrometry was employed to measure the accumulation of the antimicrobial compound camalexin. Artificial diet assays allowed the assessment of the effect of camalexin on aphid performance. · Myzus persicae produces significantly less progeny on Arabidopsis microRNA (miRNA) pathway mutants. Plants unable to process miRNAs respond to aphid infestation with increased induction of PHYTOALEXIN DEFICIENT3 (PAD3) and production of camalexin. Aphids ingest camalexin when feeding on Arabidopsis and are more successful on pad3 and cyp79b2/cyp79b3 mutants defective in camalexin production. Aphids produce less progeny on artificial diets containing camalexin. · Our data indicate that camalexin functions beyond antimicrobial defence to also include hemipteran insects. This work also highlights the extensive role of the miRNA-mediated regulation of secondary metabolic defence pathways with relevance to resistance against a hemipteran pest. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  2. Mp10 and Mp42 from the aphid species Myzus persicae trigger plant defenses in Nicotiana benthamiana through different activities.

    Science.gov (United States)

    Rodriguez, Patricia A; Stam, Remco; Warbroek, Tim; Bos, Jorunn I B

    2014-01-01

    Aphids are phloem-feeding insects that, like other plant parasites, deliver effectors inside their host to manipulate host responses. The Myzus persicae (green peach aphid) candidate effectors Mp10 and Mp42 were previously found to reduce aphid fecundity upon intracellular transient overexpression in Nicotiana benthamiana. We performed functional analyses of these proteins to investigate whether they activate defenses through similar activities. We employed a range of functional characterization experiments based on intracellular transient overexpression in N. benthamiana to determine the subcellular localization of Mp10 and Mp42 and investigate their role in activating plant defense signaling. Mp10 and Mp42 showed distinct subcellular localization in planta, suggesting that they target different host compartments. Also, Mp10 reduced the levels of Agrobacterium-mediated overexpression of proteins. This reduction was not due to an effect on Agrobacterium viability. Transient overexpression of Mp10 but not Mp42 activated jasmonic acid and salicylic acid signaling pathways and decreased susceptibility to the hemibiotrophic plant pathogen Phytophthora capsici. We found that two candidate effectors from the broad-host-range aphid M. persicae can trigger aphid defenses through different mechanisms. Importantly, we found that some (candidate) effectors such as Mp10 interfere with Agrobacterium-based overexpression assays, an important tool to study effector activity and function.

  3. Characterization of non-LTR retrotransposable TRAS elements in the aphids Acyrthosiphon pisum and Myzus persicae (Aphididae, Hemiptera).

    Science.gov (United States)

    Monti, Valentina; Serafini, Chiara; Manicardi, Gian Carlo; Mandrioli, Mauro

    2013-01-01

    A non-LTR TRAS retrotransposon (identified as TRASAp1) has been amplified in the pea aphid Acyrthosiphon pisum and its presence has been assessed also in the peach potato aphid Myzus persicae. This TRAS element possesses 2 overlapping ORFs (a gag-ORF1 and a pol-ORF2 containing the reverse transcriptase and the endonuclease domains) that show a similarity ranging from 40% to 48% to proteins coded by other TRAS elements identified in insects (including the beetle Tribolium castaneum and the moth Bombyx mori). The study of the TRAS chromosomal insertion sites, performed by standard fluorescent in situ hybridization (FISH) and fiber FISH, showed that TRAS elements were located in a subtelomeric position, just before the telomeric (TTAGG) n repeats. In both the aphid species, TRAS elements were present at all termini of autosomes, but the 2 X chromosome telomeres show a clear-cut structural difference. Indeed, cromomycin A3 staining, together with FISH using a TRAS probe, revealed that TRAS signals only occur at the telomere opposite to the NOR-bearing one. Lastly, the analysis of the distribution of TRAS retrotransposons in a M. persicae strain possessing spontaneous fragmentations of the X chromosomes assessed that TRAS elements were not involved in the healing of de novo telomeres.

  4. Age-Specific Functional Response of Aphidius matricariae and Praon volucre (Hymenoptera: Braconidae) on Myzus persicae (Hemiptera: Aphididae).

    Science.gov (United States)

    Tazerouni, Z; Talebi, A A; Fathipour, Y; Soufbaf, M

    2016-12-01

    The green peach aphid, Myzus persicae (Sulzer), is one of the most important aphid pests on pepper. Aphidius matricariae Haliday and Praon volucre (Haliday) are known as biological control agents for aphids in vegetable crops. In this research, age-specific functional responses of these two parasitoids were evaluated on different densities of 2, 4, 8, 16, 32, and 64 green peach aphids. Type of functional response varied from type II to type III for different ages of A. matricariae, but type of functional response was not affected by female age for P. volucre. The functional response of P. volucre was determined as type II in the whole parasitoid lifetime. The searching efficiency (a), b, and handling time (T h ) were estimated using the Rogers equations. The highest searching efficiency (a) and lowest handling time were observed during the first half of lifetime of A. matricariae and P. volucre. Aphidius matricariae and P. volucre caused reasonable mortality of the green peach aphid by parasitism of 52.17 and 47.05 host aphids, respectively, in 24 h. Therefore, they are suggested as suitable candidates for control of M. persicae in pepper greenhouses.

  5. Clonal turnover of MACE-carrying peach-potato aphids (Myzus persicae (Sulzer), Homoptera: Aphididae) colonizing Scotland.

    Science.gov (United States)

    Kasprowicz, L; Malloch, G; Foster, S; Pickup, J; Zhan, J; Fenton, B

    2008-04-01

    Peach-potato aphids, Myzus persicae (Sulzer), collected in Scotland in the years 1995 and 2002-2004 were characterized using four microsatellite loci and three insecticide resistance mechanisms. From 868 samples, 14 multilocus genotypes were defined (designated clones A-N). Five of these (denoted A, B, H, M and N) carried modified acetylcholinesterase (MACE) resistance, the most recent resistance mechanism to have evolved in M. persicae. The current paper shows that the continued presence of MACE aphids is due to turnover, as clones A and B were replaced in field samples by clones H, M and N in later seasons. Thus, insecticide-resistant populations in Scotland can be attributed to multiple waves of rapid clone colonisations and not to the continued presence of stable resistant clones or mutation or sexual recombination in local populations. The MACE clones carried varying levels of the other insecticide resistance mechanisms, kdr and esterase. The presence of these mechanisms could alter the clones success in the field depending on insecticide spraying (positive selection) and resistance fitness costs (negative selection).

  6. Wound Healing Potential of Chlorogenic Acid and Myricetin-3-O-β-Rhamnoside Isolated from Parrotia persica

    Directory of Open Access Journals (Sweden)

    Sara E. Moghadam

    2017-09-01

    Full Text Available Wound healing is a complex physiological process that is controlled by a well-orchestrated cascade of interdependent biochemical and cellular events, which has spurred the development of therapeutics that simultaneously target these active cellular constituents. We assessed the potential of Parrotia persica (Hamamelidaceae in wound repair by analyzing the regenerative effects of its two main phenolic compounds, myricetin-3-O-β-rhamnoside and chlorogenic acid. To accomplish this, we performed phytochemical profiling and characterized the chemical structure of pure compounds isolated from P. persica, followed by an analysis of the biological effects of myricetin-3-O-β-rhamnoside and chlorogenic acid on three cell types, including keratinocytes, fibroblasts, and endothelial cells. Myricetin-3-O-β-rhamnoside and chlorogenic acid exhibited complementary pro-healing properties. The percentage of keratinocyte wound closure as measured by a scratch assay was four fold faster in the presence of 10 µg/mL chlorogenic acid, as compared to the negative control. On the other hand, myricetin-3-O-β-rhamnoside at 10 µg/mL was more effective in promoting fibroblast migration, demonstrating a two-fold higher rate of closure compared to the negative control group. Both compounds enhanced the capillary-like tube formation of endothelial cells in an in vitro angiogenesis assay. Our results altogether delineate the potential to synergistically accelerate the fibroblastic and remodelling phases of wound repair by administering appropriate amounts of myricetin-3-O-β-rhamnoside and chlorogenic acid.

  7. Effects of processing techniques on oxidative stability of Prunus pedunculatus seed oil

    Directory of Open Access Journals (Sweden)

    J. Yan

    2017-09-01

    Full Text Available This paper investigated the effects of Prunus pedunculatus (P. pedunculatus seed pre-treatment, including microwaving (M, roasting (R, steaming (S and roasting plus steaming (RS on crude oil quality in terms of yield, color change, fatty acid composition, and oxidative stability. The results showed an increase in monounsaturated fatty acid content and oxidative stability of the oils obtained from different processing treatments compared to the oil obtained from raw seeds (RW without processing. The oils, obtained from pretreated seeds, had higher conjugated diene (CD and 2-thiobarbituric acid (2-TBA values, compared to that obtained from RW when stored in a Schaal oven at 65 °C for 168 h. However, polyphenol and tocopherol contents decreased in all oil samples, processed or unprocessed. The effect of pre-treating the seeds was more prominent in the oil sample obtained through the RS technique, and showed higher oxidative stability than the other processed oils and the oil from RW.

  8. Extraction optimization of polyphenols, antioxidant and xanthine oxidase inhibitory activities from Prunus salicina Lindl.

    Directory of Open Access Journals (Sweden)

    Yibin LI

    2016-01-01

    Full Text Available Abstract Optimization of polyphenols extraction from plum (Prunus salicina Lindl. was evaluated using response surface methodology. The Box-Behnken experimental results showed the optimal conditions involved an extraction temperature of 59 °C, a sonication time of 47 min, and an ethanol concentration of 61% respectively. The maximum extraction yield of total polyphenols was 44.74 mg gallic acid equivalents per gram of dried plum at optimal conditions. Polyphenol extracts exhibited stronger antioxidant activities than Vc by evaluating of 1,1-diphenyl-2-picrylhydrazyl (DPPH and hydroxyl radical scavenging activity. Furthermore, polyphenol extracts (IC50 = 179 g/mL showed obvious inhibitory effects on xanthine oxidase. These findings suggest that polyphenol extracts from P. salicina can be potentially used as natural antioxidant and xanthine oxidase inhibitory agents.

  9. Tissue and Subcellular Localization of Enzymes Catabolizing (R)-Amygdalin in Mature Prunus serotina Seeds 1

    Science.gov (United States)

    Swain, Elisabeth; Li, Chun Ping; Poulton, Jonathan E.

    1992-01-01

    In black cherry (Prunus serotina Ehrh.) homogenates, (R)-amygdalin is catabolized to HCN, benzaldehyde, and d-glucose by the sequential action of amygdalin hydrolase, prunasin hydrolase, and mandelonitrile lyase. The tissue and subcellular localizations of these enzymes were determined within intact black cherry seeds by direct enzyme analysis, immunoblotting, and colloidal gold immunocytochemical techniques. Taken together, these procedures showed that the two β-glucosidases are restricted to protein bodies of the procambium, which ramifies throughout the cotyledons. Although amygdalin hydrolase occurred within the majority of procambial cells, prunasin hydrolase was confined to the peripheral layers of this meristematic tissue. Highest levels of mandelonitrile lyase were observed in the protein bodies of the cotyledonary parenchyma cells, with lesser amounts in the procambial cell protein bodies. The residual endosperm tissue had insignificant levels of amygdalin hydrolase, prunasin hydrolase, and mandelonitrile lyase. Images Figure 5 Figure 1 Figure 2 Figure 3 Figure 4 Figure 6 PMID:16652960

  10. Tissue and Subcellular Localization of Enzymes Catabolizing (R)-Amygdalin in Mature Prunus serotina Seeds.

    Science.gov (United States)

    Swain, E; Li, C P; Poulton, J E

    1992-09-01

    In black cherry (Prunus serotina Ehrh.) homogenates, (R)-amygdalin is catabolized to HCN, benzaldehyde, and d-glucose by the sequential action of amygdalin hydrolase, prunasin hydrolase, and mandelonitrile lyase. The tissue and subcellular localizations of these enzymes were determined within intact black cherry seeds by direct enzyme analysis, immunoblotting, and colloidal gold immunocytochemical techniques. Taken together, these procedures showed that the two beta-glucosidases are restricted to protein bodies of the procambium, which ramifies throughout the cotyledons. Although amygdalin hydrolase occurred within the majority of procambial cells, prunasin hydrolase was confined to the peripheral layers of this meristematic tissue. Highest levels of mandelonitrile lyase were observed in the protein bodies of the cotyledonary parenchyma cells, with lesser amounts in the procambial cell protein bodies. The residual endosperm tissue had insignificant levels of amygdalin hydrolase, prunasin hydrolase, and mandelonitrile lyase.

  11. Identification of volatile compounds in thinning discards from plum trees (Prunus salicina Lindl. cultivar Harry Pickstone

    Directory of Open Access Journals (Sweden)

    Rossana Podestá

    2011-09-01

    Full Text Available Plum (Prunus salicina Lindl. cv. Harry Pickstone, a China indigenous fruit, is widely produced and consumed in countries such as Japan and Brazil. The practice of thinning is common in horticulture and the fruits removed are discarded as waste. Like the great majority of vegetables, these thinning discards also contain essential oils which have not been investigated until the present time. The extraction of the plum thinning discards volatile oil, through the hydrodistillation method, produced a yield of 0.06% (m/m and a total of 21 components were identified, with 11 of them being responsible for 72,9% of the total oil composition. The major compounds determined through GC and GC-MS were Z-α-bisabolene (13.7%, n-hexadecanoic acid (12.7%, phytol (12.7%, and β-caryophyllene (10.4%.

  12. Purification, identification and preliminary crystallographic studies of Pru du amandin, an allergenic protein from Prunus dulcis

    Energy Technology Data Exchange (ETDEWEB)

    Gaur, Vineet; Sethi, Dhruv K.; Salunke, Dinakar M., E-mail: dinakar@nii.res.in [National Institute of Immunology, Aruna Asaf Ali Marg, New Delhi 110 067 (India)

    2008-01-01

    The purification, identification, crystallization and preliminary crystallographic studies of an allergy-related protein, Pru du amandin, from P. dulcis nuts are reported. Food allergies appear to be one of the foremost causes of hypersensitivity reactions. Nut allergies account for most food allergies and are often permanent. The 360 kDa hexameric protein Pru du amandin, a known allergen, was purified from almonds (Prunus dulcis) by ammonium sulfate fractionation and ion-exchange chromatography. The protein was identified by a BLAST homology search against the nonredundant sequence database. Pru du amandin belongs to the 11S legumin family of seed storage proteins characterized by the presence of a cupin motif. Crystals were obtained by the hanging-drop vapour-diffusion method. The crystals belong to space group P4{sub 1} (or P4{sub 3}), with unit-cell parameters a = b = 150.7, c = 164.9 Å.

  13. Reaction of Prunus Rootstocks to Meloidogyne incognita and M. arenaria in Spain.

    Science.gov (United States)

    Marull, J; Pinochet, J; Verdejo-Lucas, S; Soler, A

    1991-10-01

    Prunus rootstocks were evaluated for their reaction to Meloidogyne incognita and M. arenaria. Most rootstocks were peach-almond hybrids of Spanish origin. In one experiment three selections of Garfi x Nemared (G x N) and Hansen-5 were highly resistant to M. incognita, but four other rootstocks were susceptible showing high galling indices and population increases. In two experiments with M. arenaria, the hybrid selections G x N nos. 1 and 9 were immune, GF-305 and Hansen-5 were resistant, but nine other rootstocks expressed various degrees of susceptibility. All Spanish rootstocks were susceptible to both Meloidogyne species except for the three G x N selections. The root-knot nematode resistant peach Nemared used as a male parent with Garfi was found to transmit a high degree of resistance to M. incognita and immunity to M. arenaria. Progenies of P. davidiana (Ga x D no. 3), a known source of resistance to root-knot nematodes, were susceptible.

  14. Microsatellite marker development for the coastal dune shrub Prunus maritima (Rosaceae).

    Science.gov (United States)

    Badgley, Emily M; Grubisha, Lisa C; Roland, Anna K; Connolly, Bryan A; Klooster, Matthew R

    2015-02-01

    • Microsatellite primers were developed in the beach plum, Prunus maritima, to investigate the genetic composition of remaining populations in need of conservation and, in future studies, to determine its relation to P. maritima var. gravesii. • Fourteen primer pairs were identified and tested in four populations throughout the species' geographic range. Of these 14 loci, 12 were shown to be polymorphic among a total of 60 P. maritima individuals sampled (15 individuals sampled from four populations). Among the polymorphic loci, the number of alleles ranged from two to 10 and observed heterozygosity of loci ranged from 0.07 to 0.93 among specimens tested. • These microsatellites will be useful in evaluating the population genetic composition of P. maritima and in developing approaches for further conservation and management of this species within the endangered coastal dune ecosystem of the northeastern United States.

  15. Unusual behavior of growing pollen tubes in the ovary of plum culture (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Đorđević Milena

    2010-01-01

    Full Text Available Unusual behavior of growing pollen tubes in different combinations of pollination was observed in the ovary of the plum (Prunus domestica L. cv 'Čačanska Lepotica'. It primarily refers to several issues, i.e. the curling up of pollen tubes within the micropyle, the growth of two pollen tubes into the nucellus of an ovule, the occurrence of a bundle above the nucellar cap and fluorescence of the part of the embryo sac containing the egg apparatus. Upon the growth of pollen tubes into the nucellus of the ovule, subsequently penetrating pollen tubes form a bundle either above the micropyle entrance or above the nucellus. Branching and bending of pollen tubes by 180o upon their growth into the micropyle was also observed.

  16. Seasonal variation of Prunus necrotic ringspot virus concentration in almond, peach, and plum cultivars

    Directory of Open Access Journals (Sweden)

    N. Salem

    2003-08-01

    Full Text Available Levels of Prunus necrotic ringspot virus (PNRSV infection in almond, peach, and plum cultivars over the course of an entire year were determined by testing different plant parts of naturally infected trees, using the double antibody sandwich-enzyme linked immunosorbent assay (DAS-ELISA. The data showed that spring was the best time of year for PNRSV detection in flowers, active growing buds, and young leaves. PNRSV detection was less reliable during the summer months. Young leaves of all cultivars were the most reliable source for distinguishing between healthy and infected plants, while flowers and buds yielded high values in some cultivars but not in others. Seasonal fluctuations in virus concentration did not follow the same pattern in all cultivars. It is therefore impossible to distinguish between infected and healthy trees on the basis of one single sampling time for all cultivars.

  17. Light as a regulator of structural and chemical leaf defenses against insects in two Prunus species

    Science.gov (United States)

    Mąderek, Ewa; Zadworny, Marcin; Mucha, Joanna; Karolewski, Piotr

    2017-11-01

    Light is a key factor influencing competition between species, and the mechanisms by which trees overcome insect outbreaks can be associated with alternation of the leaves structure, which then prevent or promotes their susceptibility to herbivores. It was predicted that leaf tissue anatomy would likely be different in sun and shade leaves, with a gradual decline of leaves resistance coupled with reduction of accessible light. We quantified anatomical patterns and the distribution of defence compounds (phenols, total tannins, catechol tannins) within heavily grazed leaves of Prunus padus, native in Europe and Prunus serotina, an invasive to Central Europe. Both species were strongly attacked by folivorous insects when shrubs grew in the shade. In the sun, however only P. padus leaves were grazed, but P. serotina leaves were almost unaffected. We identified that anatomical characteristics are not linked to different P. padus and P. serotina leaf vulnerability to insects. Furthermore, the staining of defence compounds of P. serotina leaves grown in full sun revealed that the palisade mesophyll cells had a higher content of phenolic compounds and catechol tannins. Thus, our results indicate that a specific distribution of defence compounds, but not the anatomical relationships between palisade and spongy mesophyll, may be beneficial for P. serotina growth outside its natural range. The identified pattern of defence compounds distribution is linked to a lower susceptibility of P. serotina leaves to herbivores, and is associated with its invasiveness. This likely reflects that P. serotina is a stronger competitor than P. padus, especially at high sunlit sites i.e. gaps in the forest.

  18. GENETIC DIVERSITY OF SOME IRANIAN SWEET CHERRY (PRUNUS AVIUM) CULTIVARS USING MICROSATELLITE MARKERS AND MORPHOLOGICAL TRAITS.

    Science.gov (United States)

    Farsad, A; Esna-Ashari, M

    2016-01-01

    The aim of this study was to characterize 23 important Iranian sweet cherry (Prunus avium) cultivars collected from different provinces of Iran and 1 foreign cultivar, which was used as control, considered for breeding programs by using 21 microsatellite markers and 27 morphological traits. In sweet cherry (Prunus avium) accessions, leaf, fruit, and stone morphological characters were evaluated during two consecutive years. The study revealed a high variability in the set of evaluated sweet cherry accessions. The majority of important correlations were determined among variables representing fruit and leaf size and variables related to color. Cluster analysis distinguished sweet cherry accessions into two distinct groups. Principal component analysis (PCA) of qualitative and quantitative morphological parameters explained over 86.59% of total variability in the first seven axes. In PCA, leaf traits such as leaf length and width, and fruit traits such as length, width, and weight, and fruit flesh and juice color were predominant in the first two components, indicating that they were useful for the assessment of sweet cherry germplasm characterization. Out of 21 SSR markers, 16 were polymorphic, producing 177 alleles that varied from 4 to 16 alleles (9.35 on average) with a mean heterozygosity value of 0.82 that produced successful amplifications and revealed DNA polymorphisms. Allele size varied from 95 to 290 bp. Cluster analyses showed that the studied sweet cherry genotypes were classified intofive main groups based mainly on their species characteristics and SSR data. In general, our results did not show a clear structuring of genetic variability within the Iranian diffusion area of sweet cherry, so it was not possible to draw any indications on regions of provenance delimitation. The results of this study contribute to a better understanding of sweet cherry genetic variations in Iran, thus making for more efficient programs aimed at preserving biodiversity and

  19. Purification and characterization of α-Amylase from Miswak Salvadora persica.

    Science.gov (United States)

    Mohamed, Saleh A; Almulaiky, Yaaser Q; Ahmed, Youssri M; Al-Bar, Omar A M; Ibrahim, Ibrahim H

    2014-04-01

    The miswak (Salvadora persica) is a natural toothbrush. It is well known that very little information has been reported on enzymes in miswak as medicinal plant. Recently, we study peroxidase in miswak. In the present study, the main goal of this work is to purify and characterize α-amylase from miswak. The second goal is to study the storage stability of α-amylase in toothpaste. The purification method included chromatography of miswak α-amylase on DEAE-Sepharose column and Sephacryl S-200 column. Molecular weight was determined by gel filtration and SDS-PAGE. Five α-amylases A1, A4a, A4b, A5a and A5b from miswak were purified and they had molecular weights of 14, 74, 16, 30 and 20 kDa, respectively. α-Amylases had optimum pH from 6 to 8. Affinity of the substrates toward all enzymes was studied. Miswak α-amylases A1, A4a, A4b, A5a and A5b had Km values for starch and glycogen of 3.7, 3.7, 7.1, 0.52, 4.3 mg/ml and 5.95, 5.9 4.16, 6.3, 6.49 mg/ml, respectively. The optimum temperature for five enzymes ranged 40°C- 60°C. Miswak α-amylases were stable up to 40°C- 60°C after incubation for 30 min. Ca+2 activated all the miswak α-amylases, while Ni2+, Co+2 and Zn+2 activated or inhibited some of these enzymes. The metal chelators, EDTA, sodium citrate and sodium oxalate had inhibitory effects on miswak α-amylases. PMSF, p-HMB, DTNB and 1,10 phenanthroline caused inhibitory effect on α-amylases. The analysis of hydrolytic products after starch hydrolysis by miswak α-amylases on paper chromatography revealed that glucose, maltose, maltotriose and oligosaccharide were the major products. Crude miswak α-amylase in the toothpaste retained 55% of its original activity after 10 months of storage at room temperature. From these findings, α-amylases from miswak can be considered as beneficial enzymes for pharmaceuticals. Therefore, we study the storage stability of the crude α-amylase of miswak, which contained the five α-amylases, in toothpaste. The enzyme in

  20. Seed washing, exogenous application of gibberellic acid, and cold stratification enhance the germination of sweet cherry (Prunus avium L.) seed

    OpenAIRE

    Javanmard, T.; Zamani, Z; R. Keshavarz Afshar; Hashemi, M; Struik, P. C.

    2014-01-01

    Seed germination in sweet cherry (Prunus avium L.) is a slow and lengthy process which has delayed breeding efforts. In this study, seed from ripe fruit of the sweet cherry cultivar ‘Lambert’ were collected and, after removing the endocarp, various dormancy-breaking treatments such as seed washing, the application of exogenous gibberellic acid (GA3), or cold stratification were evaluated for their ability to enhance the percentage and rate of seed germination. The results indicated that seed ...