
Sample records for protactinium 224


    Moore, R.L.


    An lmprovement in the separation of protactinium from aqueous nitric acid solutions is described. 1t covers the use of lead dioxide and tin dioxide as carrier precipitates for the protactinium. In carrying out the process, divalent lead or divalent tin is addcd to the solution and oxidized, causing formation of a carrier precipitate of lead dioxide or stannic oxide, respectively.

  2. The electroreduction of pentavalent protactinium; Reduction electrolytique du protactinium pentavalent

    Energy Technology Data Exchange (ETDEWEB)

    Musikas, C [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France)


    The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [French] La reduction du protactinium pentavalent en protactinium tetravalent, dans des solutions sulfuriques et chlorhydriques a ete realisee a l'echelle du milligramme, par electrolyse, dans une cellule a compartiments separes. Aucun indice ne permet de penser que le protactinium puisse exister dans ces solutions a l'etat trivalent. De plus les polarogrammes traces en milieu fluorhydrique ne font apparaitre qu'une seule vague de reduction. Le principe d'une methode volumetrique de dosage du protactinium est donne. (auteur)

  3. The electroreduction of pentavalent protactinium

    International Nuclear Information System (INIS)

    Musikas, C.


    The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [fr

  4. A new isotope of protactinium: 239Pa

    International Nuclear Information System (INIS)

    Yuan, S.; Yang, W.; Mou, W.; Zhang, X.; Li, Z.; Yu, X.; Gu, J.; Guo, Y.; Gan, Z.; Liu, H.; Guo, J.


    A new nuclide 239 Pa was produced by 50MeV/u 18 O bombardment of uranium. A radiochemical separation method was employed for preparing sources of 239 Pa. The protactinium isotope 239 Pa has been identified for the first time by the results observed from the decay of the 239 Pa and its daughter 239 U. The half-life of 239 Pa has been determined to be 106±30min. (orig.)


    Studier, M.H.; Sullivan, J.C.


    A cation exchange prccess is described for separating protactinium values from thorium values whereby they are initially adsorbed together from an aqueous 0.1 to 2 N hydrochloric acid on a cation exchange resin in a column. Then selectively eluting the thorium by an ammonium sulfate solution and subsequently eluting the protactinium by an oxalate solution.

  6. Recovery of protactinium from molten fluoride nuclear fuel compositions (United States)

    Baes, C.F. Jr.; Bamberger, C.; Ross, R.G.


    A method is provided for separating protactinium from a molten fluonlde salt composition consisting essentially of at least one alkali and alkaline earth metal fluoride and at least one soluble fluoride of uranium or thorium which comprises oxidizing the protactinium in said composition to the + 5 oxidation state and contacting said composition with an oxide selected from the group consisting of an alkali metal oxide, an alkaline earth oxide, thorium oxide, and uranium oxide, and thereafter isolating the resultant insoluble protactinium oxide product from said composition. (Official Gazette)

  7. Synthesis, crystallographic and magnetic properties of protactinium pnictides

    International Nuclear Information System (INIS)

    Hery, Yves.


    From a theoretical point of view, protactinium lies in a very important place in the periodic system for it seems to be the first element of the actinide series where the 5f state is occupied. We have studied protactinium pnictides, particularly arsenides and antimonides. PaAs 2 , Pa 3 As 4 , PaSb 2 and Pa 3 Sb 4 were synthetized and their crystallographic properties were determined and discussed. We have measured the magnetic susceptibilities of PaC, PaAs 2 and PaSb 2 . Protactinium exhibits a dual character. In its monocarbide, which is a weakly diamagnet, it behaves as a transition element while in the temperature independent paramagnets PaAs 2 and PaSb 2 , it behaves like a 'f' element. This 'f' element character increases with increasing metal-metal distances. Furthermore the radial expansion of the protactinium 5f orbital seems to be more important than the Uranium one, and consequently the corresponding protactinium 5f electrons are less localized. In addition, some protactinium chalcogenides (βPaS 2 , γPaSe 2 and PaOSe) have been identified [fr

  8. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.


    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  9. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.


    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  10. Separation of Protactinium from Neutron Irradiated Thorium Oxide

    International Nuclear Information System (INIS)

    Dominguez, G.; Gutierrez, L.; Ropero, M.


    The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO 2 material into ThF 4 . For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs

  11. Preconcentration of natural protactinium from thorium concentrate with subsequent determination using Gamma (γ) spectrometry

    International Nuclear Information System (INIS)

    Raja, Naine; Swain, Kallola; Kayasth, S.R.; Pathassarathy, R.; Mathur, P.K.; Anil Kumar, S.


    A simple and efficient method has been developed to preconcentrate natural protactinium ( 231 Pa) from large size of thorium concentrate (5.0-100.0g) on Dowex 1 X 8 in acid medium. Gamma spectrometry, a powerful determination technique, has been used for quantitative determination of protactinium

  12. The geochemical behavior of protactinium 231 and its chosen geochemical analogue thorium in the biosphere

    International Nuclear Information System (INIS)

    Gillberg-Wickman, M.


    To be able to judge whether protactinium 231 might represent a major contribution to the human radiation risk from high level radioactive waste a literature study of the geochemical behavior of protactinium has been made. The interest in protactinium determinations has, as far, been in the field of marine geochemistry and geochronology. These investigations show that thorium may be used as a chemical analogue. The content of protactinium 231 is determined by the 235 U content and consequently the occurrence of protactinium in nature is directly associated to the geochemistry of uranium. The pronounced hydrolytic tendency of protactinium and its great sorption and coprecipitation capacity ought to prevent or at least appreciably delay its transport from a back-filled nuclear waste vault to the uppermost surface of the earth. It also has a tendency to form colloids or particulates which may be strongly fixed on a rock surface. In adsorption and desorption processes kinetics must play an important role. Our knowledge in this field is quite limited. Under the physico-chemical conditions in the sea, protactinium is rapidly scavenged from the water column by particulates. It accumulates in the sediments. (author)

  13. Recovery of protactinium-231 and thorium-230 from cotter concentrate: pilot plant operatins and process development

    International Nuclear Information System (INIS)

    Hertz, M.R.; Figgins, P.E.; Deal, W.R.


    The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100 0 C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables

  14. Protactinium and the intersection of actinide and transition metal chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Richard E.; De Sio, Stephanie; Vallet, Valérie


    The role of the 5f and 6d orbitals in the chemistry of the actinide elements has been of considerable interest since their discovery and synthesis. Relativistic effects cause the energetics of the 5f and 6d orbitals to change as the actinide series is traversed left to right imparting a rich and complex chemistry. The 5f and 6d atomic states cross in energy at protactinium (Pa), making it a potential intersection between transition metal and actinide chemistries. Herein, we report the synthesis of a Pa-peroxo cluster, A(6)(Pa4O(O-2)(6)F-12) [A = Rb, Cs, (CH3)(4)N], formed in pursuit of an actinide polyoxometalate. Quantum chemical calculations at the density functional theory level demonstrate equal 5f and 6d orbital participation in the chemistry of Pa and increasing 5f orbital participation for the heavier actinides. Periodic changes in orbital character to the bonding in the early actinides highlights the influence of the 5f orbitals in their reactivity and chemical structure.

  15. Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231

    International Nuclear Information System (INIS)

    Guillot, Ph.


    A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through α,n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [fr

  16. Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    International Nuclear Information System (INIS)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.


    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10 -1 to 10 -10 mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10 -9 mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)

  17. Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    Energy Technology Data Exchange (ETDEWEB)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.


    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10/sup -1/ to 10/sup -10/ mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10/sup -9/ mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)

  18. The metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    International Nuclear Information System (INIS)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.


    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Neptunium-239, Np-237, and Pa-233 were prepared as either citrate-buffer, nitrate, or bicarbonate solutions with oxidation states of (V) and (VI). Samples of blood, urine, feces and autopsy tissues were measured by gamma spectrometry. Retention of neptunium and protactinium was determined in vivo using whole and partial body gamma-scintillation spectrometry with [NaI-CsI(T1)] detectors. Fed and fasted baboons were administered solutions of Np(VI) bicarbonate (10/sup -8/ to 10/sup -1/ mg/kg) and Pa(V) citrate-buffer (10/sup -9/ mg/kg) by gavage. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 + 2% was in liver, and 42 +- 0.1% was excreted in urine. The metabolism of neptunium followed oral and iv administrations was found to be similar. This observation was also true for baboons which had received oral and iv doses of protactinium. A method was developed to estimate GI absorption values for both nuclides in baboons, which were not sacrificed, by comparison of activities present in bioassay samples after injection and gavage. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. Further experiments are currently underway to evaluate this assay technique

  19. Preparation of high purity metallic protactinium. Crystal structure and dissolution enthalpy of the metal

    International Nuclear Information System (INIS)

    Bohet, J.


    Some 300 mg of Pa have been produced in a high purity metallic state. Protactinium monocarbide has been obtained by the carboreduction of Pa 2 O 5 . Protactinium iodide, produced by the direct reaction of iodine on the carbide, has been sublimated at 420 0 C and thermally dissociated at 1200 0 C on a W wire. In these conditions Pa metal has been deposited with a yield greater than 85% and presents a bct structure stable at room temperature (a=3.921+-0.001A and c=3.235+-0.001A). The fcc phase (Fm3m type) (a=5.018+-0.001A) has been obtained by quenching metallic samples (bct) heated in argon at 1500 0 C. The chemical analysis and the transformation of the fcc into bct phase by controlled heat treatments show the presence of this high temperature phase in the metal. Protactinium mononitride (5.58% N) produced by direct reaction of N on Pa at 1100 0 C presents the same fcc crystal structure but the lattice parameter is higher (a=5.047+-0.001A). The dissolution heat of metallic Pa (bct) has been determined in the aqueous solution HCl 12M - HF 0.05M at 298.15+-0.05 K. The standard formation enthalpies of the ionic species Pa(IV) and Pa(V) are respectively equal to -672+-15 kJ.mol -1 and -821+-15 kJ.mol -1

  20. Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231; Etude preliminaire a la preparation d'uranium 232 par irradiation de protactinium 231

    Energy Technology Data Exchange (ETDEWEB)

    Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires


    A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)

  1. Energies and electric dipole transitions for low-lying levels of protactinium IV and uranium V

    Energy Technology Data Exchange (ETDEWEB)

    Uerer, Gueldem; Oezdemir, Leyla [Sakarya Univ. (Turkey). Physics Dept.


    We have reported a relativistic multiconfiguration Dirac-Fock (MCDF) study on low-lying level structures of protactinium IV (Z = 91) and uranium V (Z = 92) ions. Excitation energies and electric dipole (E1) transition parameters (wavelengths, oscillator strengths, and transition rates) for these low-lying levels have been given. We have also investigated the influence of the transverse Breit and quantum electrodynamic (QED) contributions besides correlation effects on the level structure. A comparison has been made with a few available data for these ions in the literature. (orig.)

  2. Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR

    Energy Technology Data Exchange (ETDEWEB)

    Trianti, N.; Su' ud, Z.; Riyana, E. S. [Nuclear Physics and Biophysics Research Division Department of Physics - Institut Teknologi Bandung (ITB) Jalan Ganeca 10 Bandung 40132 (Indonesia)


    A preliminary design study for the utilization of thorium added with {sup 231}Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of {sup 233}U to {sup 231}Pa in burn-up process. Optimizations of the content of {sup 231}Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 {approx} 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.

  3. Sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite

    International Nuclear Information System (INIS)

    Huitti, T.; Hakanen, M.


    The aim of the study is to determine the sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite in the brackish groundwater of Haestholmen (site of the Loviisa-1, Loviisa-2 reactors). The studies were carried out under aerobic (Cs, Ra, Pa, U, Np, Pu) and anaerobic (Np, Pa, Pu, Tc) laboratory conditions. The cation exchange capasity was determined for the rock and the diffusion of tritiated water in the rocks of different degree of alteration. The sorption and diffusion properties of the rocks are briefly compared with those of host rocks at other sites under investigation by the Finnish company Posiva Oy for the final disposal of spent fuel. (29 refs.)

  4. Separation of Protactinium from Neutron Irradiated Thorium Oxide; Separacion de Protactinio de Oxido de Torio Irradiado con Neutrones

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez, G; Gutierrez, L; Ropero, M


    The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO{sub 2} material into ThF{sub 4}. For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs.

  5. 49 CFR 195.224 - Welding: Weather. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Weather. 195.224 Section 195.224 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.224 Welding: Weather. Welding must be protected from weather conditions that...

  6. 33 CFR 2.24 - Internal waters. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Internal waters. 2.24 Section 2.24 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.24 Internal waters. (a) With respect to the United States, internal waters means the...

  7. 40 CFR 224.2 - Reports. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Reports. 224.2 Section 224.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING RECORDS AND REPORTS REQUIRED OF OCEAN DUMPING PERMITTEES UNDER SECTION 102 OF THE ACT § 224.2 Reports. (a) Periodic reports...

  8. 9 CFR 354.224 - Water supply. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Water supply. 354.224 Section 354.224....224 Water supply. The water supply shall be ample, clean, and potable with adequate facilities for its distribution in the plant and its protection against contamination and pollution. (a) Hot water at a...

  9. 22 CFR 224.2 - Definitions. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 224.2 Section 224.2 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224..., or accounting or bookkeeping entry made— (a) With respect to a claim or to obtain the approval or...

  10. 49 CFR 224.13 - Preemptive effect. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 224.13 Section 224.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... effect. Under 49 U.S.C. 20106, issuance of this part preempts any State law, rule, regulation, or order...

  11. 22 CFR 224.21 - Discovery. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discovery. 224.21 Section 224.21 Foreign....21 Discovery. (a) The following types of discovery are authorized: (1) Requests for production of... parties, discovery is available only as ordered by the ALJ. The ALJ shall regulate the timing of discovery...

  12. 42 CFR 93.224 - Research record. (United States)



  13. Formation cross-sections and chromatographic separation of protactinium isotopes formed in proton-irradiated thorium metal

    Energy Technology Data Exchange (ETDEWEB)

    Radchenko, Valery; Engle, Jonathan W.; Wilson, Justin J.; Maassen, Joel R.; Nortier, Meiring F.; Birnbaum, Eva R.; John, Kevin D.; Fassbender, Michael E. [Los Alamos National Laboratory, NM (United States)


    Targeted alpha therapy (TAT) is a treatment method of increasing interest to the clinical oncology community that utilizes α-emitting radionuclides conjugated to biomolecules for the selective killing of tumor cells. Proton irradiation of thorium generates a number of α-emitting radionuclides with therapeutic potential for application via TAT. In particular, the radionuclide {sup 230}Pa is formed via the {sup 232}Th(p, 3n) nuclear reaction and partially decays to {sup 230}U, an α emitter which has recently received attention as a possible therapy nuclide. In this study, we estimate production yields for {sup 230}Pa and other Pa isotopes from proton-irradiated thorium based on cross section measurements. We adopt existing methods for the chromatographic separation of protactinium isotopes from proton irradiated thorium matrices to combine and optimize them for effective fission product decontamination.

  14. Dicty_cDB: SLH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH224 (Link to dictyBase) - - - Contig-U16287-1 SLH224F (Link to Original site) SLH2...24F 565 - - - - - - Show SLH224 Library SL (Link to library) Clone ID SLH224 (Link Representative seq. ID SLH22...4F (Link to Original site) Representative DNA sequence >SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH224Q.Seq.d/ AAAAA.../SS/SSF8-A/SSF805Q.Seq.d/ 1033 0.0 SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH288Q.Seq.d/ 1033 0.0 SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH2

  15. 49 CFR 224.109 - Inspection, repair, and replacement. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection, repair, and replacement. 224.109 Section 224.109 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD..., Inspection, and Maintenance of Retroreflective Material § 224.109 Inspection, repair, and replacement. (a...

  16. 22 CFR 224.41 - Stay pending appeal. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Stay pending appeal. 224.41 Section 224.41 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224.41 Stay pending appeal. (a) An initial decision is stayed automatically pending disposition...

  17. 4 CFR 22.4 - Appeal File [Rule 4]. (United States)


    ... alternative organization of the appeal file is permitted, such as by document type or topic, documents within... 4 Accounts 1 2010-01-01 2010-01-01 false Appeal File [Rule 4]. 22.4 Section 22.4 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.4 Appeal File [Rule 4]. (a) Duties of the Contracting Officer. (1...

  18. Thermodynamic and structural properties in complexing media; Comportement chimique du protactinium (V) en presence d'ions sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Di Giandomenico, M.V


    Protactinium is experiencing a renewal of interest in the frame of long-term energy production. Modelling the behaviour of this element in the geosphere requires thermodynamic and structural data relevant to environmental conditions. Now deep clayey formation are considered for the disposal of radioactive waste and high values of natural sulphate contents have been determined in pore water in equilibrium with clay surface. Because of its tendency to polymerisation, hydrolysis and sorption on all solid supports, the equilibria constants relative to monomer species were determined at tracer scale (ca. 10 - 12 M) with {sup 233}Pa. The complexation constants of Pa(V) and sulphate ions were calculated starting from a systematic study of the apparent distribution coefficient D in the system TTA/Toluene/H{sub 2}O/Na{sub 2}SO{sub 4}/HClO{sub 4}/NaClO{sub 4} and as a function of ionic strength, temperature, free sulphate, protons and chelatant concentration. First of all, the interaction between free species H{sup +}, SO{sub 4}{sup -}, Na{sup +} leads to the formation of HSO{sub 4}{sup -} and NaSO{sub 4}{sup -}, for which concentrations depend upon the related thermodynamic constants. For this purpose a computer code was developed in order to determine all free species concentration. This iterative code takes into account the influence of temperature and ionic strength (SIT modelling) on thermodynamic constants. The direct measure of Pa(V) in the organic and aqueous phase by g-spectrometry had conducted to estimate the apparent distribution coefficient D as function of free sulphate ions. Complexation constants have been determined after a mathematical treatment of D. The extrapolation of these constants at zero ionic strength have been realized by SIT modelling at different temperatures. Besides, enthalpy and entropy values were calculated. Parallelly, the structural study of Pa(V) was performed using 231 Pa. XANES and EXAFS spectra show unambiguously the absence of the

  19. Iron status markers in 224 indigenous Greenlanders

    DEFF Research Database (Denmark)

    Milman, N; Byg, K E; Mulvad, G


    OBJECTIVE: To evaluate iron status in indigenous Greenlanders and its relationship to gender, age and intake of traditional Greenlandic foods. Methods: Serum ferritin, serum transferrin saturation and haemoglobin were evaluated in a population survey in 1993-1994 comprising 224 Greenlandic...... of living. Consumption of traditional foods was assessed by questionnaire. RESULTS: Intake of traditional foods was more prevalent among elderly than among young individuals and more frequent in Uummannaq than in Ilulissat and Nuuk. Ferritin levels were higher in men than in women (p....06; women, r(s)=0.73, ptraditional foods was correlated with ferritin in men (r(s)=0.29, p=0.01) and women (r(s)=0.40, p

  20. The significance of lead-210, polonium-210 and protactinium-231 in emissions from coal-fired power stations: a comparison with natural environmental sources

    International Nuclear Information System (INIS)

    Corbett, J.O.


    Recently published calculations have suggested that a hypothetical individual may receive an effective radiation dose equivalent of 23 mrem/y from coal-fired power station emissions through the ingestion of lead-210, polonium-210 and protactinium-231. It is shown that the model used in those calculations is over-pessimistic by one or two orders of magnitude when applied to the deposition of Pb-210 and Po-210 derived from the decay of radon naturally present in the atmosphere. A more recent assessment of metabolic data for Pa-231 suggests that estimated doses from this nuclide also can be reduced by about a factor of twenty. It is concluded that the maximum effective dose equivalent from power station emissions probably does not exceed 1-2 mrem/y. (author)

  1. Growth retardation in children injected with 224Ra

    International Nuclear Information System (INIS)

    Spiess, H.; Mays, C.W.; Spiess-Paulus, E.


    We have obtained the adult heights of 133 patients formerly injected with 224 Ra as juveniles. 224 Ra induced growth retardation was greatest in children injected at young ages and increased with dose. The growth retardation was well represented as a 2% decrease in potential growth post irradiation per 100 rads of calculated average skeletal dose. (orig.)

  2. 14 CFR 417.224 - Probability of failure analysis. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Probability of failure analysis. 417.224..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.224 Probability of failure..., must account for launch vehicle failure probability in a consistent manner. A launch vehicle failure...

  3. 48 CFR 352.224-70 - Privacy Act. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Privacy Act. 352.224-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.224-70 Privacy Act. As prescribed in 324.103(b)(2), the Contracting Officer shall insert the following clause: Privacy Act (January...

  4. 48 CFR 52.224-2 - Privacy Act. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Privacy Act. 52.224-2... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.224-2 Privacy... agency function: Privacy Act (APR 1984) (a) The Contractor agrees to— (1) Comply with the Privacy Act of...

  5. The biological effects of radium-224 injected into dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.


    A life-span study was conducted in 128 beagle dogs to determine the biological effects of intravenously injected 224 Ra chloride. The 224 Ra chloride was prepared by the same method used for intravenous injections in humans who were treated for ankylosing spondylitis and tuberculosis. Thus the results obtained from dogs can be compared directly to the population of treated humans, both for the elucidation of the effect of exposure rate and for comparison with other radionuclides for which data for humans are unavailable. Using equal numbers of males and females, the dogs were injected with one of four levels of 224 Ra resulting in initial body burdens of approximately 13, 40, 120 or 350 kBq of 224 Ra kg -1 body mass. A control group of dogs was injected with diluent only. All dogs were divided further into three groups for which the amount of injected 224 Ra (half-life of 3.62 days) or diluent was given in a single injection or divided equally into 10 or 50 weekly injections. As a result of these three injection schedules, the accumulation of dose from the injected 224 Ra was distributed over approximately 1, 3 or 12 months. Each injection schedule included four different injection levels resulting in average absorbed α-particle doses to bone of 0.1, 0.3, 1 and 3 Gy, respectively. The primary early effect observed was a hematological dyscrasia in the dogs receiving either of the two highest injection levels. The effect was most severe in the dogs receiving a single injection of 224 Ra and resulted in the death of three dogs injected at the highest level. The late-occurring biological effects were tumors. Bone tumors were the most common followed by tumors in the nasal mucosa. 52 refs., 8 figs., 8 tabs

  6. Argonne-Utah studies of 224Ra endosteal surface dosimetry

    International Nuclear Information System (INIS)

    Schlenker, R.A.; Smith, J.M.


    The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after radium injection into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the low end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. 11 references, 2 figures, 7 tables

  7. Argonne-Utah studies of 224Ra endosteal surface dosimetry

    International Nuclear Information System (INIS)

    Schlenker, R.A.; Smith, J.M.


    The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after injection of radium into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter-product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the lower end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. 11 references, 2 figures, 7 tables

  8. Argonne-Utah studies of 224Ra endosteal surface dosimetry

    International Nuclear Information System (INIS)

    Schlenker, R.A.; Smith, J.M.


    The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after radium injection into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the low end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. (orig.)

  9. Structural integrity analysis of the 224U elevator mothballing

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, W.M.


    As part of the preparation of Building 224U for turnover to Decontamination and Decommissioning, it is necessary to place the elevator in a mothballed condition so that it can be reactivated for use after 10 to 25 years. This mothballing is going to be accomplished by landing the counterweight on wooden timbers and suspending the elevator cab with wire rope or chain slings. This will take the load off the cables and make it relatively easy to reactive. The objective of this Supporting Document is to verify the structural integrity of all of the load bearing components involved in mothballing the 224U Building elevator. Building 224U is part of the UO{sub 3} Plant where uranyl nitrates from the PUREX Plant was converted to UO{sub 3} powder.

  10. The biological effects of 224Ra injected into dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Lloyd, R.D.; Hahn, F.F.; Griffith, W.C.; Boecker, B.B.


    The purpose of this study was to investigate the toxicity of injected 224 Ra in the dog. Radium-224 is a short-lived isotope of radium with a half-life of 3.62 d. When administered parenterally, it deposits on bone surfaces; because of its short half-life, most of its energy is deposited on bone surfaces, in a manner similar to plutonium. The experimental design included a comparison to the exposed human population. Instead of using a single injection of 224 Ra, groups were included in which dogs were injected once, 10 times, or 50 times. This design provided groups that could be compared to the multiple injections often used in people for the treatment of ankylosing spondylitis

  11. Tooth breakage in patients injected with 224Ra

    International Nuclear Information System (INIS)

    Sonnabend, E.; Spiess, H.; Mays, C.W.


    Tooth breakage has been common among the 224 Ra patients, especially those injected as teenagers. The fracture of 1 or more teeth was reported by 26% (8/31) of boys and 23% (7/30) of girls injected with 224 Ra at 16-20 years of age. Combining results from all age groups, the incidence of tooth fractures increased significantly with dose (P=0.01). Unlike the normal loss of permanent teeth by periodontal disease, in which the entire tooth is lost, the tooth loss following 224 Ra injection was primarily from tooth resorption near the gum line causing the tooth crowns to break off easily. Eventually the tooth roots may either become incorporated into the jawbone or are resorbed and replaced with bone. These tooth fractures resembled those observed in the U.S. radium dial painters and in dogs injected with bone-seeking α-emitters. (orig.)

  12. Risk and effect of radium-224 therapy of ankylosing spondylitis

    International Nuclear Information System (INIS)

    Schmitt, E.; Wick, R.R.


    A total of 1426 patients suffering from Bechterew's disease who had formerly been treated with 224-Ra (up to 30 years ago), were included in an epidemiological study. The mean skeletal alpha dose amounted to 65 rad, the mean observation period was 16 years. Among the 363 mortalities recorded 3 were due to tumours in the skeletal region; of these, 2 were observed in the haemopoietic system. The types of the tumours detected deserve to be given particular attention: whereas osteosarcomas were almost the only tumours observed in a group of patients studied by Spiess, who had been treated with higher doses, no such tumour was revealed in the study population investigated here. Among the 3 tumours seen in this study group 2 were detected in the haemopoietic system as compared to 1 out of 55 tumours observed by Spiess. In contrast to this finding there was a remarkably high incidence of tumours of haemopoietic organs among the victims of Hiroshima. These results show that the relative benefits and disadvantages of the drug 224-Ra once again must be carefully considered. None of the chemical agents used in the treatment of ankylosing spondylitis is free from side-effects. A comparison of the latter with the risks involved in the use of 224-Ra leads to the conclusion that - according to the experience gained so far - 224-Ra is very useful in the treatment of this disease, if there is an absolute indication. (orig./MG) [de

  13. Radium-224, 226 and 228 activity in Brazil nuts

    International Nuclear Information System (INIS)

    Andrello, Avacir Casanova; Appoloni, Carlos Roberto; Martins, Maristela; Pacheco, Ariane Mendonca


    Full text: Recently, Brazil nuts have received a special attention because they contain large quantities of omega 6, antioxidant fat and selenium. Omega 6 and antioxidant fat prevent body cells inflammation and selenium combats cellular aging, guaranteeing a long and healthy life. One cashew per day is sufficient to assure the minimum amount of selenium necessary to the body. The aim of this work was to study radium (224, 226 and 228) concentration in Brazil nuts of the Amazon region. Thirty samples of different size (10 small, 10 medium and 10 large) exportation-type Brazil nuts, peeled and dehydrated, from the 2009 harvest, were analysed. Each sample, with 1.8 kg mass, was milled and then incinerated, resulting in 48 grams of ashes, that were placed in a 300 ml cylindrical recipient for gamma-ray spectrometry. Ra-224, Ra-226 and Ra-228 activities were determined using the gamma-rays of 234 keV following Pb-214 decay, 352 keV and 609 keV from Pb-212 and Bi-212, and the 911 keV from Ac-228, respectively. The incinerated samples average activities were 1100 Bq/kg for Ra-224, 4500 Bq/kg for Ra-226 and 3500 Bq/kg for Ra-228, corresponding to activities of 29.3 Bq/kg for Ra-224, 120 Bq/kg for Ra-226 and 93.9 Bq/kg for Ra-228 in raw Brazil nuts. (author)

  14. Model for the induction of bone cancer by 224Ra

    International Nuclear Information System (INIS)

    Groer, P.G.; Marshall, J.H.


    A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by α irradiation is applied to 224 Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transforming events is the killing of any endosteal cell by α irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human 224 Ra cases: after the decay of 224 Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate; for exposure to the same dose the model predicts an increased number of tumors for protracted exposure (i.e., exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by 224 Ra in man

  15. 78 FR 43963 - Twenty-Third Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    ... Committee 224, Airport Security Access Control Systems AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 224, Airport Security... meeting of the RTCA Special Committee 224, Airport Security Access Control Systems. DATES: The meeting...

  16. 22 CFR 224.40 - Stays ordered by the Department of Justice. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Stays ordered by the Department of Justice. 224.40 Section 224.40 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224.40 Stays ordered by the Department of Justice. If at any time the...

  17. Exostoses induced by 224Ra(ThX) in children

    International Nuclear Information System (INIS)

    Spiess, H.; Mays, C.W.


    Exostoses are benign cartilaginous tumors of bone. They can occur naturally or be induced by radiation therapy during the time of skeletal growth. We have observed exostoses in 28 of 218 children given repeated injections of radioactive bone-seeking 224 Ra. The younger the age at irradiation, the higher the incidence of exostoses. Boys are more susceptible than girls. To our knowledge, none of these radiation-induced exostoses have become malignant, although 36 of these children have developed bone sarcomas elsewhere in the skeleton. (orig.) [de

  18. Estuarine geochemistry of 224Ra, 226Ra, and 222Rn

    International Nuclear Information System (INIS)

    Elsinger, R.J.


    Desorption from river borne sediments is the most likely source of the excess 226 Ra. Laboratory mixing experiments on Pee Dee River sediments show an increase in 226 Ra desorption with increasing salinities with maximum desorption occurring at or above 20 0 /oo salinity. Desorption and diffusion are the sources for 226 Ra in the estuarine systems. In Winyah Bay the 228 Ra/ 226 Ra activity ratio does not change significantly with salinity, averaging around 1.4, indicating desorption as the major source of 228 Ra. In the Yangtze River the 228 Ra/ 226 Ra activity ratio is constant (approx.1.90) until increasing linearly above 16 0 /oo. A diffusive flux from regeneration by 232 Th decay in shelf sediments is the source of the increase. In Delaware Bay 228 Ra increases faster than 226 Ra in the less than or equal to22 0 /oo water, indicating a source in addition to desorption. The increase can be balanced by a 0.33 dpm/cm 2 -year flux over the upper part of the Bay where fine grained sediments predominate. 224 Ra behavior is controlled by its 3.64 day half-life. In Winyah Bay a flux of around 0.4 dpm/cm 2 -day is necessary to support the standing crop of non-desorbed 224 Ra in the water column. In Delaware Bay the nearly constant 224 Ra in concentration over the 2.5 0 /oo to 12 0 /oo salinity range are maintained by regeneration from 228 Th in the turbidity maximum zones and diffusion from bottom sediments. Water leaving on ebb tide from a salt marsh on Delaware Bay had increases in all three radium isotopes ( 224 Ra > 228 Ra > 226 Ra) compared to water coming in on the flood tide. Excess 222 Rn concentrations in a fresh water section of the Pee Dee River show a decreasing downstream gradient. Using these gradients to determine evasion rates, stagnant film thicknesses range from 21μ to 62μ

  19. Epidemiological studies of German patients injected with Ra-224

    International Nuclear Information System (INIS)

    Mays, C.W.; Spiess, H.


    The health of 898 patients who received repeated injections of short-lived 224 Ra after World War II, mainly for the treatment of tuberculosis and ankylosing spondylitis has been followed. As of 1980, 53 of these patients had developed bone sarcoma vs only 0.2 cases expected naturally. Two patients with bone sarcoma subsequently developed an additional bone sarcoma. No new bone sarcomas have been reported since the end of 1974. For the patients in each category, the tumor rate at every year after 224 Ra injection was calculated by dividing the yearly number of bone sarcomas by the number of patients whose follow-up extended to that year. This corrected for the effects of death and incomplete follow-up. The yearly tumor rates were then summed to obtain the cumulative tumor rate. Dividing by the average skeletal dose in rads yielded the cumulative risk. The cumulative tumor risk was about 200 bone sarcomas/10 6 person rad of average skeletal dose and, with the dosimetric assumptions used, was not statistically different for (a) juveniles vs adults, (b) males vs females, or (c) TB patients vs spondylitic patients

  20. Dental extractions in relation to radiation therapy of 224 patients

    International Nuclear Information System (INIS)

    Makkonen, T.A.; Kiminki, A.; Makkonen, T.K.; Nordman, E.


    The case histories of 224 patients treated with radiation therapy for head and neck malignancies at the Radiotherapy Clinic of the Univesity Central Hospital in Turku during the years 1974-77 are reviewed. Of the 92 patients surviving for 5 years, 90 were available for re-examination. The median radiation dosage was 61 Gy in 6 to 8 weeks in patients with squamous cell carcinoma and othe solid tumours and 43 Gy in 5 weeks in patients with lymphoma. The oral status of the patients was examined clinically and radiographically. From these pationts 45 teeth had been extracted before irradiation and 94 after irradiation. In no case had this resulted in osteoradionecrosis of the jaws. It is evident that the repairing of patient's teeth before radiation treatment, coupled with continuous preventive care of caries, will prevent serious complications from arising. (author)

  1. MicroRNA-224 promotes the sensitivity of osteosarcoma cells to cisplatin by targeting Rac1. (United States)

    Geng, Shuo; Gu, Lina; Ju, Fang; Zhang, Hepeng; Wang, Yiwen; Tang, Han; Bi, ZhengGang; Yang, Chenglin


    Osteosarcoma is the most common primary bone tumour in children and adolescents. Accumulating evidence has shown that microRNAs (miRNAs) participate in the development of almost all types of cancer. Here, we investigated the role of miR-224 in the development and progression of osteosarcoma. We demonstrated that miR-224 was down-regulated in osteosarcoma cell lines and tissues. Lower miR-224 levels were correlated with shorter survivalin osteosarcoma patients. Furthermore, overexpression of miR-224 suppressed osteosarcoma cell proliferation, migration and invasion and contributed to the increased sensitivity of MG-63 cells to cisplatin. We identified Rac1 as a direct target gene of miR-224 in osteosarcoma. Rac1 expression was up-regulated in the osteosarcoma cell lines and tissues, and there was an inverse correlation between Rac1 and miR-224 expression in osteosarcoma tissues. Furthermore, rescuing Rac1 expression decreased the sensitivity of miR-224-overexpressing MG-63 cells to cisplatin. We also demonstrated that ectopic expression of Rac1 promoted the proliferation, migration and invasion of miR-224-overexpressing MG-63 cells. These data suggest that miR-224 plays a tumour suppressor role in the development of osteosarcoma and is related to the sensitivity of osteosarcoma to cisplatin. © 2016 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

  2. Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma

    International Nuclear Information System (INIS)

    He, Xiaoyan; Zhang, Zhimei; Li, Ming; Li, Shuo; Ren, Lihua; Zhu, Hong; Xiao, Bin; Shi, Ruihua


    Aberrant expression of miR-224 is associated with tumor development and progression. This study investigated the role of miR-224 in esophageal squamous cell carcinoma (ESCC) ex vivo and in vitro. A total of 103 esophageal intraepithelial neoplasia, ESCC tissue specimens, and their matched distant normal tissues were collected to test miR-224 expression using qRT-PCR analysis. Western blot was used to quantify the level of PH domain leucine-rich repeat protein phosphatase 1 (PHLPP1) and PHLPP2 in ESCC tissues. Cell viability, apoptosis, invasion, and colony formation assays were used to assess the altered phenotypes of esophageal cancer cell lines after miR-224 expression or inhibition. A luciferase reporter assay was used to confirm miR-224 binding to PHLPP1 and PHLPP2 mRNA. miR-224 was significantly overexpressed in esophageal intraepithelial neoplasia and ESCC tissues, while the expression of PHLPP1 and PHLPP2 proteins, the target genes of miR-224, was downregulated in ESCC tissues. miR-224 expression was associated with advanced clinical TNM stage, pathologic grade, and the level of PHLPP1 and PHLPP2 proteins in ESCC tissues. Ectopic overexpression of miR-224 promoted proliferation, migration, and invasion, but suppressed apoptosis of ESCC cells. miR-224 was able to bind to the 3′ untranslated region (3′-UTR) of PHLPP1 and PHLPP2 mRNA to suppress their expression. The current study demonstrated that miR-224 acts as an oncogenic miRNA in ESCC, possibly by targeting PHLPP1 and PHLPP2. The online version of this article (doi:10.1186/s12885-015-1581-6) contains supplementary material, which is available to authorized users

  3. 22 CFR 224.30 - The hearing and burden of proof. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The hearing and burden of proof. 224.30 Section 224.30 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD... mitigating factors by a preponderance of the evidence. (d) The hearing shall be open to the public unless...

  4. 22 CFR 224.31 - Determining the amount of penalties and assessments. (United States)


    ... assessments. 224.31 Section 224.31 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF... foreseeable consequential damages and the costs of investigation; (6) The relationship of the amount imposed... misconduct upon national defense, public health or safety, or public confidence in the management of...

  5. 50 CFR 224.104 - Special requirements for fishing activities to protect endangered sea turtles. (United States)


    ... activities to protect endangered sea turtles. 224.104 Section 224.104 Wildlife and Fisheries NATIONAL MARINE... endangered sea turtles. (a) Shrimp fishermen in the southeastern United States and the Gulf of Mexico who comply with rules for threatened sea turtles specified in § 223.206 of this chapter will not be subject...

  6. 22 CFR 224.26 - Form, filing and service of papers. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Form, filing and service of papers. 224.26... CIVIL REMEDIES ACT § 224.26 Form, filing and service of papers. (a) Form. (1) Documents filed with the ALJ shall include an original and two copies. (2) Every pleading and paper filed in the proceeding...

  7. Bone sarcoma induction by radium 224 in beagles: an interim report

    International Nuclear Information System (INIS)

    Mays, C.W.; Taylor, G.N.; Lloyd, R.D.; Bruenger, F.W.; Angus, W.


    Twenty beagles were given an injection of Ra 224 contaminated with 210 Pb and 228 Th. All have died, 8 with bone sarcoma. In a new study, 128 dogs were given purified Ra 224 in 1, 10 or 50 weekly injections from 1977-1979 (LD 50 for single injection ∼ 400 kBq 224 Ra/kg). As of 14 September 1987, at the highest skeletal dose of 3 Gy from 224 Ra, bone sarcomas had occurred in 5 of 6 dogs at an average of ± SD of 2069±302 days after the start of 50 injections (0 survivors), in 4 of 6 dogs at 2485±1110 days after the start of 10 injections (1 survivor), and in 1 of 8 dogs at 3066 days after a single injection (3 survivors). At 3 Gy, the toxicity of 224 Ra relative to 239 Pu, was 1.0 for 50 injections of 224 Ra, 0.7 for 10, and 0.4 for 1. The effectiveness per Gy of 224 Ra-equivalent dose from 1 injection of 224 Ra contaminated with 228 Th and 210 Pb was equal to that of 239 Pu. (UK)

  8. Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229

    African Journals Online (AJOL)


    Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229. 224. EFFECTS OF CHINESE MATERIA MEDICA-FUBAO DANGGUI JIAO ON EXPERIMENTAL. ENDOMETRIOSIS. Xing Sun*, Master; Lijue Chen, Master; Fanbo Zeng1,. Department of Pharmacy, Tongji Medical College, Huazhong. University of Science ...

  9. Automated measurement of 224Ra and 226Ra in water

    International Nuclear Information System (INIS)

    Dimova, N.; Burnett, W.C.; Horwitz, E.P.; Lane-Smith, D.


    We present a new simple approach for automated, non-destructive measurement of the alpha-emitting radium isotopes ( 223 Ra, 224 Ra, and 226 Ra) in water based on the emanation of their respective radon daughters ( 219 Rn, 220 Rn, and 222 Rn). The method combines the high adsorption uptake of MnO 2 Resin for radium (K d =2.4x10 4 ml/g) over a wide pH range with the simplicity of the activity registration using a commercial radon-in-air analyzer (RAD7, DURRIDGE Company, Inc). Radium is first adsorbed onto the MnO 2 Resin by passing a water sample through the resin packed in a gas-tight glass cartridge. The same cartridge is then connected to the radon analyzer via a simple tubing system to circulate air through the resin and a drying system. The efficiency of the proposed system is determined by running standards prepared in the same manner. Our results indicate that the efficiency for 226 Ra is >22% if both 218 Po and 214 Po counts are collected. This is comparable with typical efficiencies for alpha spectrometry but with much less sample preparation. We estimate that an MDA of 0.8 pCi/L for 226 Ra may be obtained with this new approach using a 1 L water sample and less than 4 h of counting

  10. MicroRNA-224 targets ERG2 and contributes to malignant progressions of meningioma

    International Nuclear Information System (INIS)

    Wang, Maomao; Deng, Xiaodong; Ying, Qi; Jin, Tingyan; Li, Ming; Liang, Chong


    MicroRNA-224 is overexpressed in various malignant tumors with poor prognosis, which plays a critical role in biological processes including cell proliferation, apoptosis and several developmental and physiological progressions. However, the potential association between miR-224 and clinical outcome in patients with meningiomas remains unknown. Here, we investigate miR-224 expression and biological functions in meningiomas. MiR-224 expression was measured by Northern blot analysis and quantitative reverse transcription-polymerase chain reaction (qRT-PCR) in meningioma and normal brain tissues. Kaplan–Meier analysis and Cox regression analysis were used to exam its correlation with clinicopathological features and prognostic value. The biological effects of miR-224 on the cell proliferation and apoptosis in meningioma cells were examined by MTT assay and apoptosis assay. We found the expression levels of miR-224 were significantly higher in meningioma tissues than that in normal brain, positively correlated with advanced pathological grade. Kaplan–Meier analysis indicated that meningioma patients with low miR-224 expression exhibited significantly prolonged overall and recurrence-free survival. Furthermore, we demonstrated that ERG2 was an identical candidate target gene of MiR-224 in vitro. Our results indicated that downregulation of miR-224 suppressed cell growth and resulted in the enhancement of cell apoptosis through activation of the ERG2-BAK-induced apoptosis pathway. Our findings imply the miR-224 expression could predict the overall survival and recurrence-free survival of patients with meningioma and it might be a promising therapeutic target for treating malignant meningiomas. - Highlights: • MiR-224 expression is correlates with prognosis in meningioma patients. • ERG2 is a novel downstream target of miR-224. • MiR-224 suppressed cell growth and enhanced apoptosis in IOMM-Lee and CH157 cells. • MiR-224 is an upstream regulator of the ERG2

  11. Clinical Study of 224 Patients with Hypertriglyceridemia Pancreatitis

    Directory of Open Access Journals (Sweden)

    Xiao-Li Zhang


    Full Text Available Background: Hypertriglyceridemia (HTG is the most common etiology of acute pancreatitis (AP after alcohol and gallstone-induced disease. Elevation of serum triglyceride (TG levels to ≥1000 mg/dl in a patient with AP strongly indicates HTG as the cause. The absolute risk of pancreatitis based on serum TG ≤1000 mg/dl has not been clearly defined. The aims of this study were to address the role of elevated TG levels between 500 and 1000 mg/dl in the clinical course of HTG pancreatitis (HTGP; and assess the relationship between the level of serum TG and disease severity. Methods: A total of 224 HTGP patients between 2007 and 2011 were divided into two subgroups. Totally, 122 patients in Group A had serum TG >1000 mg/dl; 102 patients in Group B had maximal TG levels between 500 and 1000 mg/dl accompanied by lactescent serum; 100 patients with biliary AP and 99 patients with alcoholic AP hospitalized during the study period were enrolled as controls. The clinical and biochemical data were analyzed. Results: The clinical presentation of HTG-induced pancreatitis was similar to other causes. Severe form of AP in Group A was higher than Group B (χ2 = 4.002, P = 0.045. The severity with HTGP was significantly higher as compared to biliary AP (χ2 = 33.533, P = 0.000 and alcoholic AP (χ2 = 7.179, P = 0.007. Systemic complications with HTGP were significantly higher than biliary AP (χ2 = 58.763, P = 0.000. Conclusions: The study demonstrated that TG level ≥500 mg/dl should raise a high degree of suspicion, especially if no other etiology of AP is apparent. The severity of HTGP seems to correlate directly with TG level. HTGP seems be more severe than other causes of AP.

  12. Bone sarcoma induction by {sup 224}Ra in Beagles: An interim report

    Energy Technology Data Exchange (ETDEWEB)

    Mays, C W [Radiation Epidemiology Branch, National Cancer Institute, Bethesda, MD (United States); Taylor, G N; Lloyd, R D; Bruenger, F W; Angus, W [Radiobiology Division, University of Utah School of Medicine, Salt Lake City, UT (United States)


    During 1963-1968, 20 young adult Beagle dogs were given a single intravenous injection of {sup 224}Ra that was unintentionally contaminated with {sup 210}Pb and {sup 228}Th. All of these dogs have died, eight with bone sarcomas. In addition, 128 Beagle dogs were given purified {sup 224}Ra in one, ten or fifty weekly injections during 1977-1979. The acute lethal dosage (LD{sub 50}) for a single injection was about 400 kBq {sup 224}Ra/kg (11 {mu}Ci {sup 224}Ra/kg). As of September 14, 1987, at the highest skeletal dose of 3 Gy from purified {sup 224}Ra, bone sarcomas occurred in 5 of 6 dogs at an average {+-} SD of 2069 {+-} 302 days after the start of injections (no survivors), in 4 of 6 dogs at 2485 {+-} 1,110 days after the start of 10 injections (healthy survivor) and in 1 of 8 dogs at 3066 days after a single injection (3 healthy survivors). At 3 Gy the toxicity of {sup 224}Ra relative to {sup 239}Pu, based on the ratio of skeletal doses at equal tumor appearance times, was 1.0 for 50 injections of {sup 224}Ra, 0.7 for 10 injections, and 0.4 for one injection. In contrast, the effectiveness per Gy of a {sup 224}Ra-equivalent dose from a single injection of {sup 224}Ra contaminated with {sup 228}Th and {sup 210}Pb was equal to that from {sup 239}Pu, assuming that the {sup 224}Ra-equivalent dose equaled the {sup 224}Ra dose plus the {sup 228}Th dose pus 0.1 of the {sup 210}Pb dose. A possible explanation is that protracted irradiation from the 1.91-yr half-life {sup 228}Th and the 22.3-yr half-life {sup 210}Pb may have 'activated' residual damage from the short-lived, 3.62 day half-life {sup 224}Ra, possibly by stimulating the division of damaged stem cells to replace the bone cells killed by the protracted alpha particle irradiation. An important spin off from the study is experimental support for the assumption that the bone sarcoma effectiveness for {sup 210}Pb is similar to that from long-lived, 1600 yr half-life {sup 226}Ra. (author)

  13. Bone sarcoma induction by 224Ra in Beagles: An interim report

    International Nuclear Information System (INIS)

    Mays, C.W.; Taylor, G.N.; Lloyd, R.D.; Bruenger, F.W.; Angus, W.


    During 1963-1968, 20 young adult Beagle dogs were given a single intravenous injection of 224 Ra that was unintentionally contaminated with 210 Pb and 228 Th. All of these dogs have died, eight with bone sarcomas. In addition, 128 Beagle dogs were given purified 224 Ra in one, ten or fifty weekly injections during 1977-1979. The acute lethal dosage (LD 50 ) for a single injection was about 400 kBq 224 Ra/kg (11 μCi 224 Ra/kg). As of September 14, 1987, at the highest skeletal dose of 3 Gy from purified 224 Ra, bone sarcomas occurred in 5 of 6 dogs at an average ± SD of 2069 ± 302 days after the start of injections (no survivors), in 4 of 6 dogs at 2485 ± 1,110 days after the start of 10 injections (healthy survivor) and in 1 of 8 dogs at 3066 days after a single injection (3 healthy survivors). At 3 Gy the toxicity of 224 Ra relative to 239 Pu, based on the ratio of skeletal doses at equal tumor appearance times, was 1.0 for 50 injections of 224 Ra, 0.7 for 10 injections, and 0.4 for one injection. In contrast, the effectiveness per Gy of a 224 Ra-equivalent dose from a single injection of 224 Ra contaminated with 228 Th and 210 Pb was equal to that from 239 Pu, assuming that the 224 Ra-equivalent dose equaled the 224 Ra dose plus the 228 Th dose pus 0.1 of the 210 Pb dose. A possible explanation is that protracted irradiation from the 1.91-yr half-life 228 Th and the 22.3-yr half-life 210 Pb may have 'activated' residual damage from the short-lived, 3.62 day half-life 224 Ra, possibly by stimulating the division of damaged stem cells to replace the bone cells killed by the protracted alpha particle irradiation. An important spin off from the study is experimental support for the assumption that the bone sarcoma effectiveness for 210 Pb is similar to that from long-lived, 1600 yr half-life 226 Ra. (author)

  14. 47 CFR 25.224 - Protection of receive-only earth stations in the 17/24 GHz BSS. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Protection of receive-only earth stations in the 17/24 GHz BSS. 25.224 Section 25.224 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.224 Protection of...

  15. 25 CFR 1000.224 - How can a Tribe/Consortium expedite the review of a regulation waiver request? (United States)



  16. 5 CFR 591.224 - How does OPM adjust price indexes between surveys? (United States)


    ... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.224 How does OPM adjust price indexes between surveys? (a) OPM adjusts...

  17. Skeletal 212Pb retention following 224Ra injection: extrapolation of animal data to adult humans

    International Nuclear Information System (INIS)

    Schlenker, R.A.


    Two methods of interspecies extrapolation, one based on a correlation of skeletal 212 Pb/ 224 Ra with body weight, the other based on the mechanistic relationship between skeletal 212 Pb/ 224 Ra and reciprocal bone surface-to-volume ratio, lead to the conclusion that the retention of 212 Pb in the adult human skeleton is approximately complete a few days after injection. The correlation-based method gives most probable values for 212 Pb/ 224 Ra of 1.0 and 1.1 at 2 d and 7 d after injection, compared with values of 1.05 and 1.27 expected at these same times if the retention of 212 Pb were complete from the time of injection and if no 212 Pb were in the injection solution. The range of values corresponding to one geometric standard error on either side of the most probable value is 0.87 to 1.21 at 2 d post-injection. With the method based on the reciprocal bone surface-to-volume ratio, the best estimate of 212 Pb/ 224 Ra at 2 d after injection is 0.88, equal to the value observed in young adult beagles. An alternative interpretation of the results of this latter method leads to the conclusion that retention is complete, with 212 Pb/ 224 Ra equal to 1.0 for a 212 Pb-free injection solution and 1.1 for a solution containing 212 Pb in secular equilibrium with 224 Ra. This work, which uses 224 Ra daughter product retention data from mice, rats and dogs following 224Ra injection, provides a scientific foundation for retention assumptions made in the calculation of mean skeletal dose for adult humans. There now appear to be few uncertainties in these latter dose values, stemming from inaccurate retention assumptions; but substantial uncertainties remain in the mean skeletal dose values for juveniles and in the endosteal tissue doses regardless of age

  18. 30 CFR 285.224 - What happens if MMS accepts my bid? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What happens if MMS accepts my bid? 285.224... Renewable Energy Leases Competitive Lease Award Process § 285.224 What happens if MMS accepts my bid? If we... withdraw an OCS area in which we have held a lease sale before you and MMS execute the lease in that area...

  19. Brief history of /sup 224/Ra usage in radiotherapy and radiobiology

    Energy Technology Data Exchange (ETDEWEB)

    Schales, F [Gesellschaft fuer Strahlen- und Umweltforschung m.b.H., Neuherberg (Germany, F.R.)


    Attempts were made a short time after its discovery to introduce /sup 224/Ra in therapy. Besides its external application in dermatology the treatment of rheumatic diseases seemed to be promising. From 1944-1952 about 2000 patients, most of them with tuberculosis or ankylosing spondylitis were treated in a German hospital with repeated intravenous injections of Peteosthor, a combination containing /sup 224/Ra with traces of platinum and eosin, totalling about 4000 224/Ra. Different lesions were observed which were suspected to be due to irradiation. The treatment has nevertheless continued. A group of 1500 additional patients, exclusively adults, has received rather low amounts (250-300 of /sup 224/Ra and are now under study. Based on linear hypothetical dose-effect relationships in this group an osteosarcoma incidence of 3-5 per 1000 patients could be expected during the first 20 years following average skeletal doses of 56 rad. In experiments started in 1965 in Neuherberg, Germany, the acute and late effects of /sup 224/Ra and /sup 227/Th in rats and mice are investigated. Similar experiments are under way in Czechoslovakia. In Salt Lake City, Utah, in connection with studies on boneseeking radioisotopes using dogs, a pilot study on /sup 224/Ra was started in 1963. Together with studies of Ra and Th toxicity a mock dial paint containing /sup 224/Ra and /sup 234/Th was developed. As /sup 224/Ra is a /sup 232/Th decay product, it might play a certain role in the Thorotrast problem.

  20. Indication for the Ra-224 therapy in ankylosing spondylitis (Morbus Struempell-Bechterew-Marie)

    International Nuclear Information System (INIS)

    Koch, W.


    For a better understanding of the effects of corpuscular α- and β-rays of 224 Ra on growing and matured bone tissue the results of animal experiments are briefly introduced and compared with clinical observations made in humans. The therapeutic effect of 224 Ra-injection on Bechterew's disease is proved, but indication and eventual contra-indications should be observed with attention. (MG) [de

  1. Antipneumococcal activity of DW-224a, a new quinolone, compared to those of eight other agents. (United States)

    Kosowska-Shick, Klaudia; Credito, Kim; Pankuch, Glenn A; Lin, Gengrong; Bozdogan, Bülent; McGhee, Pamela; Dewasse, Bonifacio; Choi, Dong-Rack; Ryu, Jei Man; Appelbaum, Peter C


    DW-224a is a new broad-spectrum quinolone with excellent antipneumococcal activity. Agar dilution MIC was used to test the activity of DW-224a compared to those of penicillin, ciprofloxacin, levofloxacin, gatifloxacin, moxifloxacin, gemifloxacin, amoxicillin-clavulanate, cefuroxime, and azithromycin against 353 quinolone-susceptible pneumococci. The MICs of 29 quinolone-resistant pneumococci with defined quinolone resistance mechanisms against seven quinolones and an efflux mechanism were also tested. DW-224a was the most potent quinolone against quinolone-susceptible pneumococci (MIC(50), 0.016 microg/ml; MIC(90), 0.03 microg/ml), followed by gemifloxacin, moxifloxacin, gatifloxacin, levofloxacin, and ciprofloxacin. beta-Lactam MICs rose with those of penicillin G, and azithromycin resistance was seen mainly in strains with raised penicillin G MICs. Against the 29 quinolone-resistant strains, DW-224a had the lowest MICs (0.06 to 1 microg/ml) compared to those of gemifloxacin, clinafloxacin, moxifloxacin, gatifloxacin, levofloxacin, and ciprofloxacin. DW-224a at 2x MIC was bactericidal after 24 h against eight of nine strains tested. Other quinolones gave similar kill kinetics relative to higher MICs. Serial passages of nine strains in the presence of sub-MIC concentrations of DW-224a, moxifloxacin, levofloxacin, ciprofloxacin, gatifloxacin, gemifloxacin, amoxicillin-clavulanate, cefuroxime, and azithromycin were performed. DW-224a yielded resistant clones similar to moxifloxacin and gemifloxacin but also yielded lower MICs. Azithromycin selected resistant clones in three of the five parents tested. Amoxicillin-clavulanate and cefuroxime did not yield resistant clones after 50 days.

  2. Study of the hydrolysis of protactinium (V), at tracer scale, by solvent extraction method with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. Characterization of the partition of TTA in the system TTA / H2O / toluene / Na+ / H+ / ClO4-

    International Nuclear Information System (INIS)

    Jaussaud, Ch.


    Hydrolysis of protactinium (V) according to the reactions: PaO(OH) 2+ +H 2 O ↔ PaO(OH) 2 + + H + (K 2 ] PaO(OH) 2+ +2H 2 O ↔ PaO(OH) 5 + H + (K 3 ) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na + /H + /ClO 4 - system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients ε (i,j) as well as the Pitzer parameters β (0) and β (1) were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)

  3. Incidence of tumours of the skeleton in 224Ra-treated ankylosing spondylitis patients

    International Nuclear Information System (INIS)

    Wick, R.R.; Goessner, W.


    We are following 1426 ankylosing spondylitis (a.sp.) patients treated with 224 Ra and 1556 control patients with a.sp. not treated with any form of ionizing radiation. The average follow-up time of the exposure group is 16 years and the average α-dose to the skeleton is 65 rad, resulting from intravenous injection of 4.8μCi/kg 224 Ra on average within a medium injection span of 12 weeks. Injections normally have been performed once a week, and in some cases also half-weekly with a correspondingly shorter injection span. Since 1970 three cases of malignant tumours in the skeleton have been observed in the exposure group in patients with skeletal α-doses below 90 rad compared with 0.6 expected. (No bone tumour has occurred in the control group.) Two of the three cases observed were tumours of the bone marrow. The incidence of leukaemias in both exposure and control groups is discussed with respect to phenylbutazone treatment and α-radiation from 224 Ra. An effect of 224 Ra on the bone marrow not yet detected in the Spiess series of patients treated with higher amounts of 224 Ra cannot be excluded. (author)

  4. Bone sarcoma induction by radium 224 in C57BL/Do mice

    International Nuclear Information System (INIS)

    Mays, C.W.; Lloyd, R.D.; Taylor, G.N.; Jones, C.W.


    Ninety-five C57BL/Do mice received radium 224 in ten weekly intraperitoneal injections. Doses ranged from 0.5 to 11.6 Gy. Twelve mice developed bone sarcoma. The risk coefficient ±SD was 2.8 ± 0.8%/Gy and the toxicity of shortlived radium 224 relative to longlived radium 226 was 5.4 ± 2.0. Concurrently, a single injection of 33 kBq/kg plutonium 239 was given to 47 similar mice which had a bone sarcoma risk coefficient of 8.4 ± 0.8%/Gy and toxicity relative to longlived radium 226 of 16 ± 4. Based on the studies of Mueller et al that established the increase in effectiveness with increased protraction of radium 224 dose, it is possible, if the radium 224 total dose had been spread continually over about 1 year, that the toxicity of the radium 224 might have been similar to that of plutonium 239. (author)

  5. Long-term clinical investigation of patients with ankylosing spondylitis treated with /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, E [Universitatsklinik Friedrichsheim, Frankfurt, West Germany; Ruckbeil, C; Wick, R R


    Between 1952 and 1980 about 250 patients with ankylosing spondylitis were treated with /sup 224/Ra at the Orthopaedic University Hospital of Frankfurt/M. In 1970, 119 of them were examined and X-rayed as was another group of 40 patients in 1980. The results of those examined could be compared with a group of 40 patients treated without /sup 224/Ra. Patients with /sup 224/Ra demonstrated a long-lasting period of subjective improvement after the treatment, with reduced consumption of antirheumatoid and analgesic drugs, on the average. Blood examinations show inflammatory activities. Nevertheless, the ankylosing spondylitis proceeded. In the final stages of the disease, neither the clinical aspects nor the X-rays showed any specific changes. We observed no case of malignant bone tumor. Of the 169 examined patients, 22 had a total of 32 children after the treatment with /sup 224/Ra. Among these was a set of twins with cerebral palsy and diabetes insipidus renalis. In conclusion, /sup 224/Ra in ankylosing spondylitis is a recommended treatment without higher risk compared to the common therapy with drugs.

  6. Soft-tissue effects following /sup 224/Ra injections into humans

    Energy Technology Data Exchange (ETDEWEB)

    Spiess, H; Gerspach, A [Muenchen Univ. (Germany, F.R.). Kinderklinik; Mays, C W


    Following the Second World War, repeated intravenous injections of /sup 224/Ra were given to German children and adults for the intended treatment of tuberculosis, ankylosing spondylitis and a few other diseases. We have ascertained the health status of 204 juveniles and 612 adults for whom both dosage and injection span are known. /sup 224/Ra is known as a skeletal-seeker, and has induced malignant bone sarcomas, benign exostoses, tooth breakage, and growth retardation. But because of its short 3.62-day half-life, /sup 224/Ra also decays to an appreciable extent in soft tissues, as do the injected atoms of its decay products. Evidence is presented suggesting that some, but certainly not all, of the observed cases of soft-tissue neoplasms, kidney diseases, liver cirrhosis, and cataracts may be related to the /sup 224/Ra therapy. Of particular interest are the 8 cases of cataracts reported at 14-46 years of age (33 yr average) among the 204 patients injected with /sup 224/Ra as juveniles. Due to the rarity of naturally-occurring cataracts at young ages, perhaps all of these 8 cases can be regarded as induced.

  7. Age-related and 224Ra-induced abnormalities in the teeth of male mice

    International Nuclear Information System (INIS)

    Humphreys, E.R.; Stones, V.A.


    A high incidence of incisor abnormalities was found in aged control and aged 224 Ra-treated male CBA mice. Visual examination of the abnormalities in both controls and treated mice revealed extreme shortening of the upper incisors and hypoplastic, grooved or undulating enamel. The administration of 865 or 1730 nCi of 224 Ra hastened the onset of incisor abnormalities although no specific feature was attributable solely to radium toxicity. Radiography and histology revealed corrugated incisors, obliteration of the pulp cavity, extension and disorganized growth of incisors basally, secondary incisors, open pulp and fractures within the alveoli. There was a statistically-significant reduction in the number of molars present in animals given 432, 865 or 1730 nCi 224 Ra. (author)

  8. Functionalized NaA nanozeolites labeled with 224,225Ra for targeted alpha therapy. (United States)

    Piotrowska, Agata; Leszczuk, Edyta; Bruchertseifer, Frank; Morgenstern, Alfred; Bilewicz, Aleksander


    The 223 Ra, 224 Ra, and 225 Ra radioisotopes exhibit very attractive nuclear properties for application in radionuclide therapy. Unfortunately the lack of appropriate bifunctional ligand for radium is the reason why these radionuclides have not found application in receptor-targeted therapy. In the present work, the potential usefulness of the NaA nanozeolite as a carrier for radium radionuclides has been studied. 224 Ra and 225 Ra, α-particle emitting radionuclides, have been absorbed in the nanometer-sized NaA zeolite (30-70 nm) through simple ion exchange. 224,225 Ra-nanozeolites exhibited very high stability in solutions containing physiological salt, EDTA, amino acids, and human serum. To make NaA nanozeolite particles dispersed in water their surface was modified with a silane coupling agent containing poly(ethylene glycol) molecules. This functionalization approach let us covalently attach a biomolecule to the NaA nanozeolite surface.

  9. 224Ra and 226Ra experimentally induced dental changes in rats

    International Nuclear Information System (INIS)

    Reichart, P.A.; Althoff, J.; Eckhardt, W.; Rippel, W.


    Sprague-Dawley rats received intragastrically a single dose of 226 Ra or 224 Ra once weekly for 21 weeks. During this period the animals of both groups were thus exposed to comparable doses. After 12 weeks, a shortening of the maxillary incisors was observed, and this progressed during the course of the 55-week experiment. Radiologically, a loss of pulpal transparency and an apical irregular opacity in the maxillary incisors were demonstrable. Histologically, dysplastic changes of the maxillary incisors and multiple resorptions at the cemento-enamel junction of the molars were seen. The observed alterations were more pronounced in the 226 Ra group than in the 224 Ra treated group. The experimentally induced resorptions were comparable to those observed in patients who had incorporated 224 Ra or 226 Ra. Clinical, radiological, histological, γspecrometrical, and autoradiographical findings, as well as dose-estimations, are described. (author)

  10. Late effects of radium-224 injected in children and adults survey and comment of a paediatrician

    Energy Technology Data Exchange (ETDEWEB)

    Spiess, H. [Poliklinik Muenchen (Germany)


    Radium-224 (Ra-224) was already used as medicament before world war I; but because of serious side effects soon abandoned. It was revived as a remedy for tuberculosis and ankylosing spondylitis after world war II by a country doctor called Troch, supported by the Insurance Company ''Braunschweiger Landesversicherungsanstalt'' and over enthusiastic press reports. The 'new' medicine called 'Peteosthor' was a mixture of Ra-224 with traces of the red dye cosine and platinsol. The propaganda in favour of this therapy was so strong, that the government of Lower Saxony asked the University of Goettingen and others to examine this new 'wonderdrug'. Dr. Troch demanded that it should be used only under his personal supervision. As youngest assistent at the university childrens hospital of the University Goettingen I was sent in 1948 to this hospital in Hildesheim to examine 'Peteosthor'. (orig.)

  11. Myeloid leukaemia/osteosarcoma ratio in CBA/H mice given radium 224

    International Nuclear Information System (INIS)

    Humphreys, E.R.; Stones, V.A.


    Four groups of 400 12-week-old CBA/H mice were injected intraperitoneally with mean amounts of 69, 139, 280 and 550 Bq/g -1 radium 224. A further group of 400 mice were injected intraperitoneally with diluting solution only. The mice were allowed unrestricted access to food and water until they died or were killed. To date (September 1988) about 40% of the mice are dead, and 28 cases of myeloid leukaemia and four cases of osteosarcoma have been diagnosed in the animals given radium 224. The relationship between the yield of myeloid leukaemia and the amount of radium 224 injected was found to be curvilinear. The determined value of the myeloid leukaemia:osteosarcoma ratio is discussed. (author)

  12. Prognostic Value of microRNA-224 in Various Cancers: A Meta-analysis. (United States)

    Zhang, Yue; Guo, Cong-Cong; Guan, Dong-Hui; Yang, Chuan-Hua; Jiang, Yue-Hua


    During previous studies, microRNA-224 (miR-224) was frequently investigated and discovered to be of vital significance to prognosis of patients with various cancers. However, its accurate prognostic value has not been estimated worldwide. Herein, we performed meta-analysis to assess its potential predictive value in a variety of human tumors. Qualified researches were identified up to March 1, 2017 through performing online searches in PubMed, EMBASE, Web of Science and Cochrane Database of Systematic Reviews. Overall survival (OS), disease-free survival (DFS) or progression-free survival (PFS) as a prognosis for various cancers were extracted and calculated, if available. Pooled hazard ratios (HR) and 95% confidence intervals (CI) were calculated using Stata version 13.0 (StataCorp, College Station, Texas, USA). 22 eligible studies with 3000 patients were ultimately brought into the current meta-analysis. It suggested that high miR-224 expression was significantly associated with poor OS in tissue (HR = 1.43, 95% CI = 1.00-2.03). During multivariate analysis, high miR-224 expression was more significantly associated with OS in tissue (HR = 2.81, 95% CI = 1.91-4.13). Likewise, there were significant associations between tissue miR-224 expression and colorectal cancer (CRC), diffuse large B-cell lymphoma (DLBCL) and gastric cancer (GC) patients (p present researches are concerned, tissue miR-224 has a significantly prognostic value in various cancers, especially in CRC, DLBCL and GC. Due to the complicated pathogenesis of cancers, more large-scale and standard researches are requisite. Copyright © 2017 IMSS. Published by Elsevier Inc. All rights reserved.

  13. Collective excitations in the transitional nuclei /sup 224,226,228,230 /Ra

    CERN Document Server

    Kurcewicz, W; Kaffrell, N; Nyman, G H; Ruchowska, E


    The gamma -rays following the beta -decay of /sup 224,226,228,230/Fr have been investigated by means of gamma -ray singles (including multispectrum analysis) and gamma gamma coincidence measurements using Ge(Li) spectrometers. The study of the excited levels in /sup 224,226,228,230/Ra is focused on the properties of collective states. The analysis of the results leads one to the conclusion that a ground- state octupole deformation is the most likely explanation for the special features of the collective excitations in Ra and some neighbouring nuclei in the N136 region. (15 refs).

  14. Analysis of pellet center temperatures measured in HALDEN IFA-224 using program FREG-3

    International Nuclear Information System (INIS)

    Harayama, Yasuo; Izumi, Fumio


    To verify the program FREG-3, we compared the calculations by FREG-3 with those by measurement in a HALDEN instrumented fuel assembly, IFA-224. FREG-3 generally gives higher pellet center temperatures than the measurement. The temperature distribution calculated by FREG-3 to estimate the stored energy in fuel rods results in safety side. (auth.)

  15. 224-T Transuranic Waste Storage and Assay Facility dangerous waste permit application

    International Nuclear Information System (INIS)


    Westinghouse Hanford Company is a major contractor to the US Department of Energy Richland Field Office and serves as cooperator of the 224-T Transuranic Waste Storage and Assay Facility, the storage unit addressed in this permit application. At the time of submission of this portion of the Hanford Facility. Dangerous Waste Permit Application covering the 224-T Transuranic Waste Storage and Assay Facility, many issues identified in comments to the draft Hanford Facility Dangerous Waste Permit remain unresolved. This permit application reflects the positions taken by the US Department of Energy, Company on the draft Hanford Facility Dangerous Waste Permit and may not be read to conflict with those comments. The 224-T Transuranic Waste Storage and Assay Facility Dangerous Waste Permit Application (Revision 0) consists of both a Part A and Part B permit application. An explanation of the Part A revisions associated with this unit, including the Part A revision currently in effect, is provided at the beginning of the Part A section. The Part B consists of 15 chapters addressing the organization and content of the Part B Checklist prepared by the Washington State Department of Ecology (Ecology 1987). The 224-T Transuranic Waste Storage and Assay Facility Dangerous Waste Permit Application contains information current as of March 1, 1992

  16. Intravenous injection of Ra-224 as a treatment in Morbus Paget

    International Nuclear Information System (INIS)

    Koch, W.


    Between 1956 and 1973, 21 patients with histologically verified Morbus Paget were treated at the author's hospital with low dosage 224 Ra. In none of these patients an immediate or late impairment of the hematogenic or parenchymal organs was observed. (MG) [de

  17. [2-(2,4-dimethylphenylthio)phenyl] aniline and its amide derivatives ...

    Indian Academy of Sciences (India)



    Feb 15, 2018 ... These derivatives could be considered as a precursor structure for further design of antituberculosis agent. Keywords. [2-(2,4-dimethylphenylthio)phenyl] aniline; antituberculosis activity; cytotoxicity. 1. Introduction. Tuberculosis (TB) is a contagious disease caused by the. Mycobacterium tuberculosis (MTB).

  18. Use of nuclear recoil for separating 228Ra, 224Ra, and 233Pa from colloidal thorium

    International Nuclear Information System (INIS)

    Beydon, J.; Gratot, I.


    By using α-recoil it is possible to separate by dialysis the α disintegration products (224 Ra; 228 Ra) of thorium from colloidal thorium hydroxide.The use of n, γ recoil allows the separation of 233 Pa produced by the neutron irradiation of thorium, on condition that the colloidal thorium hydroxide is irradiated in the presence of a dispersing. (author) [fr

  19. Rapid determination of radium-224/226 in seawater sample by alpha spectrometry. (United States)

    Song, Lijuan; Yang, Yonggang; Luo, Maoyi; Ma, Yan; Dai, Xiongxin


    A new radiochemical separation method has been developed for rapid determination of alpha-emitting radium isotopes in seawater samples. This method can be applied for the measurement of 226 Ra in seawater samples when 224 Ra is used as tracer for chemical recovery correction. Likewise, 226 Ra can also be added as tracer for the determination of 224 Ra in seawater sample. In the method, radium is first pre-concentrated with hydrous titanium oxide (HTiO) and is purified by combined anion/cation exchange column chromatographic separation. The radium in the eluate is then co-precipitated with HTiO, dissolved in 9 M H 2 SO 4 , and followed through a BaSO 4 micro-precipitation step to prepare a thin-layer counting source to determine the activities of 224 Ra/ 226 Ra by alpha spectrometry. Replicate spike and blank samples were measured to evaluate the performance of the procedure. The minimum detectable activity concentration was determined to be 0.5 mBq·L -1 for 226 Ra and 0.4 mBq·L -1 for 224 Ra in 1 L of seawater sample with a counting time of 48 h. The method is a promising candidate for rapid measurement for alpha-emitting Ra isotopes in a large population of environment water samples. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. A model for the induction of bone cancer by 224Ra

    International Nuclear Information System (INIS)

    Groer, P.G.; Marshall, J.H.


    A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by α-irradiation is applied to 224 Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transformig events is the killing of any endosteal cell by α-irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human 224 Ra cases. 1) After the decay of 224 Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate. 2) For exposure to the same dose the model predicts an increased number of tumors for protacted exposure (i.e. exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by 224 Ra in man. (orig.) [de

  1. 224Ra: Risk to bone and haematopoietic tissue in ankylosing spondylitis patients

    International Nuclear Information System (INIS)

    Wick, R.R.; Goessner, W.; Chmelevsky, D.


    This follow-up study includes 1501 adult patients, who received repeated intraveneous injections of 224 Ra as a treatment for ankylosing spondylitis (a.sp), and a control group of 1557 a.sp. patients not treated with radioactive drugs or X-rays. The average total injected activity for the patients of the exposure group was 4.8 μCi of 224 Ra per kg body weight; the resulting average skeletal dose of α-rays has been 0.65 Gy. The mean duration of the 224 Ra treatment was 12 weeks with the mode at 10 weeks. At present, the mean follow-up time in the group of exposed patients is 16 years, and three cases of malignant skeletal tumours have been observed in patients with α-doses to the skeleton below 0.9 Gy (the lowest skeletal dose found to be associated with a bone tumour in the high dose group followed by Spiess and Mays). Based on general population statistics the expected number of bone tumours (ICD 170) was 0.4-0.7 . A recent risk estimate from data of Spiess and Mays suggests 5.8 radiation induced bone tumours for the present follow-up time. It is, furthermore, notable that 2 of the 3 observed skeletal tumours are tumours of the bone marrow; in the high dose group of Spiess and Mays there has been only 1 bone marrow tumour among 55 bone tumours. No malignant bone tumours have occurred, until now, in the control group. In the 224 Ra-group and the control group there have been 6 and 5 leukaemias, respectively,. Among the 6 leukaemias in the 224 R group 3 were chronic myeloid leukaemias while among the 5 leukaemias in the control group there was no chronic myeloid leukaemia. (orig.)

  2. A new determination method of 226Ra, 224Ra, and 228Th in water

    International Nuclear Information System (INIS)

    Horiuchi, Kimiko; Murakami, Yukio.


    A new method for the determination of 226 Ra, 224 Ra and 228 Th in water samples is described. It consists of extraction of 222 Rn and 220 Rn into a scintillator-toluene solution in equilibrium with 226 Ra and 224 Ra and the application of integral counting techniques with a liquid scintillation counter. One liter water sample, weakly acidified with hydrochloric acid, is transferred to a glass bottle, and vigorously bubbled with a stream of nitrogen to expel any radon or thoron in the water sample. Twenty five ml of the scintillator-toluene solution is added to the bottle (time is recorded). The bottle is stoppered with a Teflon stopper and kept at an upside-down position for a given period of time (usually 4 -- 16 days) to allow radon and thoron in partial equilibrium with their parent nuclides. Then, the sample system is vigorously shaken for 2 m and the organic layer is gently transferred to a counting vial through a specially devised transferring tube which is connected to the bottle. The initial counting time is set at 4 h after the separation of organic layer. The measurements are repeated 3 times each immediately and after 106 h from the initial counting time. From these results, the integral counting rates of radon and thoron at the initial counting time are easily obtained. The activities of 226 Ra, 224 Ra and 228 Th in the water sample are calculated from these integral counting rates by the proposed formulas. Some data on the 226 Ra and 224 Ra contents of mineral springs are presented. The lowest detection limits for 226 Ra and 224 Ra were 1.10 x 10 -12 and 1.47 x 10 -9 Ci, respectively. The present method is rapid, easy and accurate and eliminates a time-consuming sealing of the sample in Curie bottle and tedious procedure to transfer the sample gas through a vacuum system to the detector. (author)

  3. The study of structure in 224–234 thorium nuclei within the framework IBM

    Directory of Open Access Journals (Sweden)

    Lee Su Youn


    Full Text Available An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3 limit of the interacting boson model(IBM in the algebraic nuclear model. Furthermore, 224−232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5 symmetry. However, as 226−230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3 limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5 limit to the SU(3 Hamiltonian in IBM. We compared the results with experimental data of 224−234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224−234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.

  4. 10 CFR 431.224 - Uniform test method for the measurement of energy consumption for traffic signal modules and... (United States)


    ... 10 Energy 3 2010-01-01 2010-01-01 false Uniform test method for the measurement of energy consumption for traffic signal modules and pedestrian modules. 431.224 Section 431.224 Energy DEPARTMENT OF... measurement of energy consumption for traffic signal modules and pedestrian modules. (a) Scope. This section...

  5. Closure Report for Corrective Action Unit 224: Decon Pad and Septic Systems, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration


    Corrective Action Unit (CAU) 224 is located in Areas 02, 03, 05, 06, 11, and 23 of the Nevada Test Site, which is situated approximately 65 miles northwest of Las Vegas, Nevada. CAU 224 is listed in the Federal Facility Agreement and Consent Order (FFACO) of 1996 as Decon Pad and Septic Systems and is comprised of the following nine Corrective Action Sites (CASs): CAS 02-04-01, Septic Tank (Buried); CAS 03-05-01, Leachfield; CAS 05-04-01, Septic Tanks (4)/Discharge Area; CAS 06-03-01, Sewage Lagoons (3); CAS 06-05-01, Leachfield; CAS 06-17-04, Decon Pad and Wastewater Catch; CAS 06-23-01, Decon Pad Discharge Piping; CAS 11-04-01, Sewage Lagoon; and CAS 23-05-02, Leachfield. The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 02-04-01, 03-05-01, 06-03-01, 11-04-01, and 23-05-02 is no further action. As a best management practice, the septic tanks and distribution box were removed from CASs 02-04-01 and 11-04-01 and disposed of as hydrocarbon waste. The NDEP-approved correction action alternative for CASs 05-04-01, 06-05-01, 06-17-04, and 06-23-01 is clean closure. Closure activities for these CASs included removing and disposing of radiologically and pesticide-impacted soil and debris. CAU 224 was closed in accordance with the NDEP-approved CAU 224 Corrective Action Plan (CAP). The closure activities specified in the CAP were based on the recommendations presented in the CAU 224 Corrective Action Decision Document (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2005). This Closure Report documents CAU 224 closure activities. During closure activities, approximately 60 cubic yards (yd3) of mixed waste in the form of soil and debris; approximately 70 yd 3 of sanitary waste in the form of soil, liquid from septic tanks, and concrete debris; approximately 10 yd 3 of hazardous waste in the form of pesticide-impacted soil; approximately 0.5 yd 3 of universal waste in the form of

  6. Inclusive neutral particle production in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.


    The differential distributions over longitudinal and transvers Feynman variables for inclusive γ, Ksub(s)sup(0), Λ production in anti pp interactions at 22.4 GeV/c are presented. The rapidity distributions in the c.m.s. for γ and K 0 /K 0 particles are well described by the quark-antiquark fusion model. In the central region there is some evidence for scaling behaviour of the invariant differential cross sections F for the anti pp → γ+all in the range from 22.4 GeV/c to 100 GeV/c while for the K 0 / K 0 tilde production Frises in this energy interval. A non-zero Λ polarization of -0.414+-0.206 was measured

  7. Biological effects of 224Ra. Benefit and risk of therapeutic application

    International Nuclear Information System (INIS)

    Mueller, W.A.; Ebert, H.G.


    The Second Symposium on the Biological effects of 224 Ra, held at Neuherberg, was focused on two topical aspects of radiation protection. One aspect was the long-term effects of high-LET ionizing radiations on man and the quantitative data involved in risk assessment at low doses. The evaluation of epidemiological studies and experimental research was discussed in order to provide facts and figures contributing to an objective assessment of the radiation hazard from incorporated radionuclides. The other aspect was that of radiation protection in medicine. In the case of 224 Ra treatment of ankylosing spondylitis the questions of benefit and risk of this therapeutic use of ionizing radiations were discussed, the aim being to achieve the therapeutic effect while reducing radiation exposure - and therefore the hazard - to a minimum. The proceedings contain the complete texts of 23 papers as well as the final round table discussions

  8. Observation of unexpectedly small E1 moments in sup 224 Ra

    Energy Technology Data Exchange (ETDEWEB)

    Poynter, R.J.; Butler, P.A.; Clarkson, N.; Hoare, T.H.; Jones, G.D.; White, C.A. (Liverpool Univ. (UK). Oliver Lodge Lab.); Cline, D. (Rochester Univ., NY (USA). Nuclear Structure Research Lab.); Connell, K.A.; Cunningham, R.A.; Simpson, J. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Goettig, L. (Warsaw Univ. (Poland). Inst. Fizyki Doswiadczalnej); Hughes, J.R.; Jarvis, N.S.; Mullins, S.M.; Wadsworth, R.; Watson, D.L. (York Univ. (UK). Dept. of Physics); Juutinen, S. (Jyvaeskylae Univ. (Finland). Dept. of Physics); Pass, C.N. (Oxford Univ. (UK). Dept. of Nuclear Physics)


    The {alpha}-decay of {sup 228}Th and the reaction {sup 226}Ra({sup 58}Ni, {sup 60}Ni){sup 224}Ra have been employed to populate states in {sup 224}Ra up to I{sup {pi}}=12{sup +}. Values of the intrinsic electric dipole moment vertical strokeQ{sub 1}vertical stroke have been deduced from the observed B(E1)/B(E2) branching ratios. These values are < or approx.0.1 e fm for spins up to I{sup {pi}}=9{sup -}, and are thus smaller than those in {sup 218,220}Ra or {sup 226}Ra. The behaviour of Q{sub 1} suggests that shell effects are important in this mass region, although theoretical calculations which include these effects do not reproduce the observed pattern. (orig.).

  9. Alkali activated materials state-of-the-art report, RILEM TC 224-AAM

    CERN Document Server

    Deventer, Jannie


    This is a State of the Art Report resulting from the work of RILEM Technical Committee 224-AAM in the period 2007-2013. The Report summarises research to date in the area of alkali-activated binders and concretes, with a particular focus on the following areas: binder design and characterisation, durability testing, commercialisation, standardisation, and providing a historical context for this rapidly-growing research field.

  10. Azimuthal correlations in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Reimer, P.

    Data are presented on azimuthal two particle correlations and the effect is estimated of resonance production on these correlations in anti pp interactions at 22.4 GeV/c. Attention is paid to correlations between two charged pions produced in the process anti p+p→ two charged pions + anything. The dependence is described of the azimuthal asymmetry parameter on rapidity difference. (Z.J.)

  11. Clinical, para-clinical and subjective quality of life modifications after[224Ra] radium-chloride-therapy (224 SpondylAT) in ankylosing spondylitis (Bechterew's disease)

    International Nuclear Information System (INIS)

    Straube, F.; Sagner, K.; Mende, T.; Tutar, K.


    Aim: The ankylosing spondylitis is a painful, chronically inflammatory illness which mainly manifests itself at the spine, and in addition at the peripheral joints with a pronounced inclination to reinforcement. Over the last years we again have been having the possibility to help the patients with a [ 224 Ra]radium treatment to reduce the pain and probably stop the progress of the disease. The purpose was to examine the analgetic effect in connection with the para-clinical inflammation parameters and subjective modifications of the quality of life. Material and Methods: In our clinic, 5 patients (1 woman, 4 men) (age median 43,4 years) were treated over a period of 10 weeks with one weekly injection of 1 MBq [ 224 Ra]radium chloride ( 224 SpondylAT). Before the therapy, at the last day of treatment, and 3 and 6 month after the therapy we documented the pain score (scale 1 to 10) of patients and the laboratory-chemical data (hemoglobin, leukocytes, neutrophile leukocytes, thrombocytes, CRP, blood sedimentation). Physical operability, psychological fortunes and the social role behavior was measured with the clinical test p rofile of quality of life chronically patients . The patients were asked retrospectively (approx. 5 to 15 months) to estimate their pre- and post-therapeutic situation. Results: Before the therapy, the inflammation parameters CRP (average 24.5) and BSR (average 47) of all patients were clearly increased. After 3 months, the CRP value showed a descending tendency, after 6 months however the starting value was almost reached again. The blood sedimentation rate was lowest 3 months after therapy; at a check after 6 months it was somewhat more higher, however still under the outgoing value. After 3 months, the pain score indicated by the patients was reduced from the first value of 7 significantly to 5,3, and after 6 months to 3,7. A significant modification of the blood cell parameters did not occur during the investigation period. 4 of 5 patients

  12. Fine structures in 14C emission of 223Ra and 224Ra

    International Nuclear Information System (INIS)

    Hourani, E.; Rosier, L.; Berrier-Ronsin, G.; Elayi, A.; Mueller, A.C.; Rappenecker, G.; Rotbard, G.; Renou, G.; Liebe, A.; Stab, L.


    The measurement of the energy spectrum of 14 C nuclei emitted in the spontaneous radioactivity from 223 Ra and 224 Ra has been carried out, using thin and intense sources (480 MBq for 223 Ra and 3550 MBq for 224 Ra). The sources were obtained by implanting mass-separated beams from ISOLDE (CERN) into Al and vitreous C catchers. The measurement was performed with the supraconducting solenoidal spectrometer SOLENO installed at Orsay. The discovery, of a fine structure in the energy spectrum of 14 C emission from 223 Ra, which is analogous to the one known for α emission, is confirmed. Only 13% of the branching ratio in 14 C decay leads to the ground state of the residual nucleus, while 8l% to the first excited state. For 14 C emission of 224 Ra, a lower limit of 2 for the hindrance factor has been measured for the transition to the first excited state in the residual nucleus. Also, a precise identification in Z with a E·ΔE telescope has been performed for the radiation from the 223 Ra source. (author) 22 refs., 11 figs., 1 tab

  13. Phthalocyaninato complexes of thorium, protactinium and uranium

    International Nuclear Information System (INIS)

    Beck, O.F.


    For the preparation of Bis(phthalocyaninato)-actinoid(IV) complexes, AnPc 2 , a new optimizing synthesis procedure was developed, with which it was possible to prepare spectrally pure, that is, H 2 Pc-free, ThPc 2 , UPc 2 and the isostructurally similar 231 PaPc 2 .PaPc 2 . This was verified with the help of electron spectra, which were compared to preparations which were synthesized in another manner. The corresponding perfluorinated compounds were also produced for thorium and uranium by use of tetrafluorophthalic acid nitrile instead of phthalic acid nitrile as initial product. Electron and infrared spectra show the typical bands of the non-substituted complexes. By the attempt to produce a mono(phthalocyaninato)-thorium complex with the use of ThI 4 as initial material a pyridine-extracted pure ThPcI 2 (py) 2 was obtained with a typical mono(phthalocyaninato) complex electron spectrum, an extremely moisture sensitive compound which in water or acids decomposes and produces H 2 Pc. (orig./RB) [de

  14. 224Ra distribution in surface and deep water of Long Island Sound: sources and horizontal transport rates

    International Nuclear Information System (INIS)

    Torgersen, T.; O'Donnell, J.; DeAngelo, E.; Turekian, K.K.; Turekian, V.C.; Tanaka, N.


    Measurements of surface water and deep water 224 Ra(half-life 3.64 days) distributions in Long Island Sound (LIS) were conducted in July 1991. Because the pycnocline structure of LIS had been in place for about 50 days in July (long compared to the half-life of 224 Ra) in the surface water and the deep water operate as separate systems. In the surface water, the fine-grain sediments of nearshore and saltmarsh environments provide a strong source of 224 Ra, which is horizontally mixed away from the short to central LIS. A one-dimensional model of 224 Ra distribution suggests a cross-LIS horizontal eddy dispersivity of 5-50 m 2 s -1 . In the deep water, the mid-LIS sediment flux of 224 Ra is enhanced by ∼ 2x relative to the periphery, and the horizontal eddy flux is from central LIS to the periphery. A second one-dimensional model suggests a cross-LIS horizontal eddy dispersivity below the thermocline of 5-50 m 2 -1 . 224 Ra fluxes into the deep water of the central LIS are likely enhanced by (1) inhomogeneous sediment or (2) a reduced scavenging of 224 Ra in the sediments of central LIS brought about by low oxygen conditions (hypoxia) and the loss of the MnO 2 scavenging layer in the sediments. These rates of horizontal eddy dispersivity are significantly less than the estimate of 100-650 m 2 s -1 (Riley, 1967) but are consistent with the transport necessary to explain the dynamics of oxygen depletion in summer LIS. These results demonstrate the use of 224 Ra for quantifying the parameters needed to describe estuarine mixing and transport. (Author)

  15. Auditable safety analysis for the surveillance and maintenance of the 224-B building

    International Nuclear Information System (INIS)

    Cuneo, V.J.


    The Plutonium Concentration Facility (224-B Building) is an inactive, surplus facility that operated from 1945 until 1976. This document provides the auditable safety analysis (ASA) for the post-deactivation, long-term surveillance and maintenance phase of the abovegrade structures of the 224-B Building. In this ASA, the ability of the existing facilities to withstand the effects of natural phenomena hazard events is evaluated and the support systems used to maintain ventilation and/or prevent the spread of contamination are described. The purpose of the S ampersand M phase is as follows: Maintain confinement of residual inventories of radioactive materials and other contaminants until the facility is ultimately dispositioned; Prevent deterioration of confinement structures; Respond to potential accident conditions requiring response and mitigation; Provide for the safety of workers involved in the S ampersand M phase; and Provide the basis for evaluation and selection of ultimate disposal alternatives. In this ASA, the ability of the existing facilities to withstand the effects of natural phenomena hazard (NPH) events is evaluated and the support systems used to maintain ventilation and/or prevent the spread of contamination are described. This document also evaluates S ampersand M activities that are routinely required (i.e., the S ampersand M of facility barriers, equipment, structures, and postings [including repair and upgrade]; measures to identify, remove, or repair damaged asbestos; measures to identify, remove, or appropriately manage existing containers of hazardous substances; nondestructive assay, waste characterization and sampling; and the performance of spill response measures as needed). The type and nature of the hazards presented by the 224-B Building and specific controls that are required to maintain these hazards to acceptable levels are also identified

  16. Inclusive neutral particle production in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.


    The results of an analysis of inclusive production of γ(πsup(0)), Ksub(s)ysup(0), Λ, anti Λ particles in anti pp interaction at 22.4 GeV/c are presented. The total and topological inclusive cross sections of neutral particles were obtained. The charged multiplicity dependences of the mean number of πsup(0), Ksup(0)/ anti Ksup(0), Λ/ anti Λ productions were studied. The mean number of Λ/ anti Λ particles decreases with increasing charged multiplicity. The KNO scaling hypothesis for πsup(0), Ksub(s)sup(0), Λ particles was confirmed

  17. Cervical spondylomyelopathy ('wobbler' syndrome) in the dog: a study based on 224 cases

    International Nuclear Information System (INIS)

    Lewis, D.G.


    Over the past 10 to 12 years, cervical spondylomyelopathy has been increasingly recognised in large breed dogs. The breeds mainly affected are dobermanns, great danes and basset hounds. Factors such as age, sex and location of the lesions are discussed in detail based on findings from 224 cases seen at the University of Liverpool Small Animal Hospital. The anatomical changes responsible for the signs show some striking similarities in young dogs of all the breeds affected. Where the condition is commoner later in life, such as in the dobermann, the changes and their effect on the spinal cord show considerable differences. These different findings are compared, and an attempt made to explain them

  18. Inclusive rho0 production in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Ermilova, D.I.; Filippova, V.V.; Samojlov, V.V.


    Inclusive rho 0 production has been investigated in anti pp reactions at 22.4 GeV/c. The total cross section for rho 0 production is 8.1+-2.0 mb. The average number of rhosup(0') s per event is 0.17+-0.03. The average transverse momentum, as obtained by extrapolation of a simple exponential to the psub(T)sup(2) distribution, is 0.52+-0.12 GeV. The Feynman x and center of mass rapidity distributions show rho 0 to be ''centrally'' produced

  19. Analysis of elastic scattering in anti pp interactions at 22.4 Gev/c

    International Nuclear Information System (INIS)

    Batyunya, E.V.; Boguslavskij, I.V.; Bruntsko, D.


    Results are presented on measuring the anti pp elastic scattering differential cross section at 22.4 GeV/c over a region of 0.05 2 . The results have been obtained from pictures of the HBC ''Ludmila''. The total elastic cross section σsub(el)=9.0+-0.3 mb and the slope parameter b(s, t=0)=13.1+-0.8 GeVsup(-2) have been found from the data approximated by a quadratic exponential function. The results are compared with the data at similar energies

  20. Determination of 226Ra and 224Ra in drinking waters by liquid scintillation counting

    International Nuclear Information System (INIS)

    Manjon, G.; Vioque, I.; Moreno, H.; Garcia-Tenorio, R.; Garcia-Leon, M.


    A method for the determination of Ra-isotopes in water samples has been developed. Ra is coprecipitated with Ba as sulphate. The precipitate is then dissolved with EDTA and counted with a liquid scintillation system after mixing with a scintillation cocktail. The study of the temporal evolution of the separated activity gives the isotopic composition of the sample, i.e. the 224 Ra and 226 Ra contribution to the total activity. The method has been applied to some Spanish drinking waters. (author)

  1. Risk of somatic late effects in man following incorporation of 224Ra(thorium X)

    International Nuclear Information System (INIS)

    Wick, R.R.; Chmelevsky, D.


    1568 ankylosing spondylitis patients, injected with repeated injections of 224 Ra for treatment of their disease, have been observed in the GSF (study II). By the end of 1985 3 cases of malignant tumours in the skeleton had been observed, compared to 0 cases in a control group. According to the cancer mortality statistics for the FRG the age-corrected number of spontaneous bone tumours expected would be 0.4-0.7. In contrast, a recent risk estimate from the data of the patient group of study I (SPIESS/MAYS) who were treated with considerably higher doses, suggests an expected number of 5.8 radiation induced bone tumours for the present follow-up time. Latest observations from that group show that bone tumours may occur up to 33 yr after treatment with 224 Ra. Thus, the possibility of additional cases of bone tumours occurring in study II cannot be excluded. One striking observation was that 2 of the 3 skeletal tumours observed in study II were tumours of the bone marrow; there has been only 1 bone marrow tumour in the high dose group (study I) among 56 bone tumours. In addition there have been 6 and 5 leukaemias in the exposure and control group respectively. Of the 6 leukaemias in the exposure group 3 were chronic myeloid leukaemias (CML), whereas among the 5 leukaemias in the control group there was no CML. (orig./MG) [de

  2. Long-range psu(2,2|4) Bethe ansatze for gauge theory and strings

    International Nuclear Information System (INIS)

    Beisert, Niklas; Staudacher, Matthias


    We generalize various existing higher-loop Bethe ansatze for simple sectors of the integrable long-range dynamic spin chain describing planar N=4 super-Yang-Mills theory to the full psu(2,2|4) symmetry and, asymptotically, to arbitrary loop order. We perform a large number of tests of our conjectured equations, such as internal consistency, comparison to direct three-loop diagonalization and expected thermodynamic behavior. In the special case of the su(1|2) subsector, corresponding to a long-range t-J model, we are able to derive, up to three loops, the S-matrix and the associated nested Bethe ansatz from the gauge theory dilatation operator. We conjecture novel all-order S-matrices for the su(1|2) and su(1,1|2) subsectors, and show that they satisfy the Yang-Baxter equation. Throughout the paper, we muse about the idea that quantum string theory on AdS 5 xS 5 is also described by a psu(2,2|4) spin chain. We propose asymptotic all-order Bethe equations for this putative ''string chain'', which differ in a systematic fashion from the gauge theory equations

  3. Theoretical stusy of the reaction between 2,2',4' - trihydroxyazobenzene-5-sulfonic acid and zirconium (United States)

    Fletcher, Mary H.


    Zirconium reacts with 2,2',4'-trihydroxyazobenzene-5-sulfonic acid in acid solutions to Form two complexes in which the ratios of dye to zirconium are 1 to 1 and 2 to 1. Both complexes are true chelates, with zirconium acting as a bridge between the two orthohydroxy dye groups. Apparent equilibrium constants for the reactions to form each of the complexes are determined. The reactions are used as a basis for the determination of the active component in the dye and a graphical method for the determination of reagent purity is described. Four absorption spectra covering the wave length region from 350 to 750 mu are given, which completely define the color system associated with the reactions in solutions where the hydrochloric acid concentration ranges from 0.0064N to about 7N.

  4. Growth of methyl 2-(2,4-dinitrophenyl)aminopropanoate single crystals (United States)

    Perigaud, A.; Nicolau, Y. F.


    Methyl 2-(2,4-dinitrophenyl)aminopropanoate single crystals, 1 cm in diameter and 7 cm in length have been grown by a travelling-heater-Bridgman method in polyethylene tubes introduced into glass ampoules, at a growth rate of 1.5-6 mm/day. The starting material was synthesised and purified by recrystallization from methanol and by vacuum evaporation to a purity of 99.994%. The period of growth, and hence the length of the crystal, is limited due to melt decomposition and polycondensation. The b-axis of the crystals is always oriented at about 72° to the ampoule axis. Good quality single crystals have been obtained giving a FWHM of the Cu Kα (040) rocking curve of about 1'.

  5. Epidemiological assessment of lens opacifications that impaired vision in patients injected with radium-224

    International Nuclear Information System (INIS)

    Chmelevsky, D.; Mays, C.W.; Spiess, H.; Stefani, F.H.; Kellerer, A.M.


    The incidence of lens opacifications that impaired vision (cataract) was analyzed among 831 patients who were injected with known dosages of 224 Ra in Germany shortly after World War II. The dependence of the incidence on dosage, i.e., injected activity per unit body weight, and on time after treatment was determined. The observations are equally consistent with proportionality of the incidence of cataract to the square of dosage or with a linear dependence beyond a threshold of 0.5 MBq/kg. The possibility of a linear dependence without threshold was strongly rejected (P less than 0.001). The analysis of temporal dependences yielded a component that was correlated with the injected amount of 224 Ra and a component that was uncorrelated. The former was inferred by a maximum likelihood analysis to increase approximately as the square of the time after treatment. The component unrelated to the treatment was found to increase steeply with age and to become dominant within the collective of patients between age 50 and 60. The relative magnitudes of the two components were such that a fraction of 55 to 60% of the total of 58 cataracts had to be ascribed to the dose-related incidence. Impaired vision due to cataract was diagnosed before age 54 in 25 cases. In terms of injected activity per unit body weight no dependence of the sensitivity on age was found; specifically there was no indication of a faster occurrence of the treatment-related cataracts in patients treated at older ages

  6. [Clinical characteristics and surgical treatment of idiopathic congenital nystagmus in 224 patients]. (United States)

    Ding, J; Zhao, K X; Li, Y P; Ma, H Z; Chen, X; Guo, X; Zhu, L N; Li, N D; Zhang, W


    To study clinical characteristics and surgical treatment of idiopathic congenital nystagmus (ICN). A retrospective study was conducted in 224 patients with ICN in Tianjin eye hospital from July 2007 to February 2013. There were 224 patients, 158 (70.54%) males and 66 (29.5%) females, mean age was (11.6±8.4) years and (11.4±6.4) years separately. Horizontal nystgamus happened in 215 cases, 3 cases were vertical type and 6 cases were mixed. 214 cases were with no history of operation and 10 patients had ever underwent surgeries before. Furthermore, 151 patients combined with strabismus and refractive error, anterior segment or retinal disorders, which accounting for 67.4% of all the patients. 48 patients were associated myopia, 30 patients with hyperopia, 43 patients with strabismus. Among them, 153 cases of compensatory head position direction were horizontal with face turn, 43 cases (43/153, 28.1%) showed face turning to the left, 110 cases (110/153, 71.9%) showed face turning to the right. Surgeries were designed according to the compensatory head position and head retroversion angle. For 15 patients with double intermediate zones, the position which was often used with good visual function was chosen for operation design. As for the patients with nystagmus and strabismus, the transfer null zone to primary position for the dominant eye and strabismus surgery for the other eye was chosen. And for complicated patients with compensative head position, the dominant head posture were designed for surgery. ICN is dominated by male with variable clinical manifestations. Surgical choice for ICN depends on the direction of head position and if there is strabismus accompanying it.The aim of ocular muscle surgery is to transfer null zone to primary position. (Chin J Ophthalmol, 2016, 52: 574-578).

  7. Comparison of estimated energy intake from 224-hour recalls and a seven-day food record with objective measurements of energy expenditure in children

    DEFF Research Database (Denmark)

    Rothausen, Berit Worm; Matthiessen, Jeppe; Groth, Margit Velsing


    % limits of agreement were 438 and 3.52 MJ/d for the 224-HDRs, and 5.90 and 2.94 MJ/d for the 7-dFR. Pearson correlation coefficients between EI and EE were 0.51 for EI224-HDR and 0.29 for EI7-dFR, respectively. The proportion classified in the same or adjacent quartiles was 76% for EI224-HDR and 73...

  8. Measuring the radium quartet (228Ra, 226Ra, 224Ra, 223Ra) in seawater samples using gamma spectrometry

    International Nuclear Information System (INIS)

    Beek, P. van; Souhaut, M.; Reyss, J.-L.


    Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While 228 Ra and 226 Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ( 224 Ra and 223 Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report 226 Ra, 228 Ra, 224 Ra, 223 Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The 223 Ra and 224 Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the 224 Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low 223 Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

  9. 25 CFR 224.40 - How does the Act or a TERA affect the Secretary's trust responsibility? (United States)


    ... or other Federal law. (c) The Act and this part preserve the Secretary's trust responsibility to... 25 Indians 1 2010-04-01 2010-04-01 false How does the Act or a TERA affect the Secretary's trust... DETERMINATION ACT General Provisions § 224.40 How does the Act or a TERA affect the Secretary's trust...

  10. 48 CFR 1552.224-70 - Social security numbers of consultants and certain sole proprietors and Privacy Act statement. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Social security numbers of... CONTRACT CLAUSES Texts of Provisions and Clauses 1552.224-70 Social security numbers of consultants and... provision in all solicitations. Social Security Numbers of Consultants and Certain Sole Proprietors and...

  11. Acute inhalation of 2,2,4-trimethylpentane alters visual evoked potentials and signal detection behaviour of rats. (United States)

    The volatile organic compound 2,2,4-trimethylpentane (TMP, “isooctane”) is a primary constituent of gasoline for which the current health effects data are insufficient to permit EPA to conduct a risk assessment. We evaluated potential neurological impairment from acute inhalati...

  12. Acute Inhalation of 2,2,4-Trimethylpentane Alters Visual Evoked Potentials and Signal Detection Behavior in Rats (United States)

    The volatile organic compound 2,2,4-trimethylpentane (TMP, "isooctane") is a constituent of gasoline for which the current health effects data are insufficient to permit the US Environmental Protection Agency to conduct a risk assessment. The potential neurological impairment fro...

  13. ATN-224 enhances antitumor efficacy of oncolytic herpes virus against both local and metastatic head and neck squamous cell carcinoma

    Directory of Open Access Journals (Sweden)

    Ji Young Yoo

    Full Text Available Head and neck squamous cell carcinoma (HNSCC is the sixth most frequent cancer worldwide, and the 5-year survival rates are among the worst of the major cancers. Oncolytic herpes simplex viruses (oHSV have the potential to make a significant impact in the targeted treatment of these patients. Here, we tested antitumor efficacy of RAMBO, an oHSV armed with the antiangiogenic Vstat120, alone and in conjunction with ATN-224, a copper chelator against HNSCC in vitro and in vivo animal models. We found that all tested HNSCC cells responded well to virus treatment and were sensitive to RAMBO-mediated oncolytic destruction. In vivo, RAMBO had a significant antiangiogenic and antitumorigenic effect. Physiologic levels of copper inhibited viral replication and HNSCC cell killing. Chelation of copper using ATN-224 treatment significantly improved serum stability of RAMBO and permitted systemic delivery in HNSCC tumor xenografts models. Furthermore, our results show that the combination of ATN-224 and RAMBO strongly inhibits lung metastases in a mouse model of HNSCC. These findings suggest that combining ATN-224 with RAMBO has potential for clinical trials in both early and advanced HNSCC patients.

  14. 25 CFR 224.82 - What activities will the Department continue to perform after approval of a TERA? (United States)


    ... assist the tribe in evaluating the physical, economic, financial, cultural, social, environmental, and... AND SELF DETERMINATION ACT Implementation of Tribal Energy Resource Agreements Applicable Authorities and Responsibilities § 224.82 What activities will the Department continue to perform after approval...

  15. Inelastic anti pp interactions at 22.4 GeV/c compared with e+e- annihilation into hadrons

    International Nuclear Information System (INIS)

    Boos, E.G.; Ermilova, D.I.; Samoilov, V.V.; Temiraliev, T.


    The 22.4 GeV/c anti pp interactions with the leading particle and the slow proton subtracted are used as data on soft processes. Considerable similarity between them and hard processes, such as e + e - annihilation into hardrons, is found by means of studying charged multiplicities. KNO scaling and longitudinal as well as transverse spectra. (orig.)

  16. The properties of Hα emission-line galaxies at z = 2.24

    International Nuclear Information System (INIS)

    An, Fang Xia; Zheng, Xian Zhong; Wang, Wei-Hao; Huang, Jia-Sheng; Kong, Xu; Wang, Jun-Xian; Zhu, Feifan; Fang, Guan Wen; Gu, Qiu-Sheng; Wu, Hong; Hao, Lei; Xia, Xiao-Yang


    Using deep narrowband H 2 S1 and K s -band imaging data obtained with CFHT/WIRCam, we identify a sample of 56 Hα emission-line galaxies (ELGs) at z = 2.24 with the 5σ depths of H 2 S1 = 22.8 and K s = 24.8 (AB) over a 383 arcmin 2 area in the Extended Chandra Deep Field South. A detailed analysis is carried out with existing multi-wavelength data in this field. Three of the 56 Hα ELGs are detected in Chandra 4 Ms X-ray observations and two of them are classified as active galactic nuclei. The rest-frame UV and optical morphologies revealed by HST/ACS and WFC3 deep images show that nearly half of the Hα ELGs are either merging systems or have a close companion, indicating that the merging/interacting processes play a key role in regulating star formation at cosmic epoch z = 2-3. About 14% are too faint to be resolved in the rest-frame UV morphology due to high dust extinction. We estimate dust extinction from spectral energy distributions. We find that dust extinction is generally correlated with Hα luminosity and stellar mass. Our results suggest that Hα ELGs are representative of star-forming galaxies. Applying extinction corrections to individual objects, we examine the intrinsic Hα luminosity function (LF) at z = 2.24, obtaining a best-fit Schechter function characterized by a faint-end slope of α = – 1.3. This is shallower than the typical slope of α ≅ –1.6 in previous works based on constant extinction correction. We demonstrate that this difference is mainly due to the different extinction corrections. The proper extinction correction is thus the key to recovering the intrinsic LF as the extinction globally increases with Hα luminosity. Moreover, we find that our Hα LF mirrors the stellar mass function of star-forming galaxies at the same cosmic epoch. This finding indeed reflects the tight correlation between star formation rate and stellar mass for star-forming galaxies, i.e., the so-called main sequence.

  17. Population of 224 realistic human subject-based computational breast phantoms

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, David W. [Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Wells, Jered R., E-mail: [Clinical Imaging Physics Group and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Sturgeon, Gregory M. [Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 (United States); Samei, Ehsan [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Physics, Electrical and Computer Engineering, and Biomedical Engineering, and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Dobbins, James T. [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Physics and Biomedical Engineering and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Segars, W. Paul [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Lo, Joseph Y. [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Electrical and Computer Engineering and Biomedical Engineering and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States)


    Purpose: To create a database of highly realistic and anatomically variable 3D virtual breast phantoms based on dedicated breast computed tomography (bCT) data. Methods: A tissue classification and segmentation algorithm was used to create realistic and detailed 3D computational breast phantoms based on 230 + dedicated bCT datasets from normal human subjects. The breast volume was identified using a coarse three-class fuzzy C-means segmentation algorithm which accounted for and removed motion blur at the breast periphery. Noise in the bCT data was reduced through application of a postreconstruction 3D bilateral filter. A 3D adipose nonuniformity (bias field) correction was then applied followed by glandular segmentation using a 3D bias-corrected fuzzy C-means algorithm. Multiple tissue classes were defined including skin, adipose, and several fractional glandular densities. Following segmentation, a skin mask was produced which preserved the interdigitated skin, adipose, and glandular boundaries of the skin interior. Finally, surface modeling was used to produce digital phantoms with methods complementary to the XCAT suite of digital human phantoms. Results: After rejecting some datasets due to artifacts, 224 virtual breast phantoms were created which emulate the complex breast parenchyma of actual human subjects. The volume breast density (with skin) ranged from 5.5% to 66.3% with a mean value of 25.3% ± 13.2%. Breast volumes ranged from 25.0 to 2099.6 ml with a mean value of 716.3 ± 386.5 ml. Three breast phantoms were selected for imaging with digital compression (using finite element modeling) and simple ray-tracing, and the results show promise in their potential to produce realistic simulated mammograms. Conclusions: This work provides a new population of 224 breast phantoms based on in vivo bCT data for imaging research. Compared to previous studies based on only a few prototype cases, this dataset provides a rich source of new cases spanning a wide range

  18. 25 CFR 224.137 - What must the Director do if a tribe's noncompliance has resulted in harm or the potential for... (United States)


    ... potential for harm to a physical trust asset? If, because of the tribe's noncompliance with Federal law or... resulted in harm or the potential for harm to a physical trust asset? 224.137 Section 224.137 Indians... physical trust asset that does not rise to the level of imminent jeopardy to a physical trust asset, the...

  19. 25 CFR 224.138 - What must the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical... (United States)


    ... noncompliance with the TERA or a Federal law has caused imminent jeopardy to a physical trust asset. ... caused imminent jeopardy to a physical trust asset? 224.138 Section 224.138 Indians BUREAU OF INDIAN... the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical trust asset? If...

  20. Determination of 226Ra and 224Ra in sediments samples by liquid scintillation counting

    International Nuclear Information System (INIS)

    Villa, M.; Moreno, H.P.; Manjon, G.


    An experimental procedure has been developed for a rapid determination of the activity concentration of 226 Ra and 224 Ra in sediments by liquid scintillation counting. The importance of the method lies in its application to the measurement of sediments where the Ra-isotopes activity concentration has been increased due to an anthropomorphic enhancement based on releases of naturally occurring radioactive material (NORM). A sample pre-treatment, including a digestion with aqua regia and a precipitation of hydroxides, was applied to samples before the radium extraction, which was made by co-precipitation with barium. Measurements were done in a low background scintillation spectrometer Quantulus 1220, which can separate and detect simultaneously α and β particles. Additionally, some improvements are suggested for a better α and β interference correction of the results. The obtaining of radiochemical yields is also improved using 133 Ba as tracer, which decays by emission of conversion electrons and γ-rays; the wide range of radiochemical yields obtained confirms the need of this analyses. The procedure has been applied to the measurement of riverbed sediments from an estuary in the south-west of Spain, affected in the past by direct and indirect phosphogypsum discharges

  1. Epidemiological statistics on late lesions in persons treated with radium-224

    International Nuclear Information System (INIS)

    Mueller, W.A.


    A brief survey of the so-called Schales study is given which is to be continued now after the death of its author. The main problem of these investigations consists in an exact radiation dosimetry. Exact data on Thorium-X-treatment are mostly not available. Therefore, in most cases, only an average skeleton dose can be indicated. The dose which had usually been applied earlier was meanwhile considerably reduced and lies now normally about 10 injections of 28μCi 224 Ra each, which brings a skeletal exposure of 56 rad for a medium weight. Out of 1850 Bechterew patients, more than 1100 could be directly asked in the investigation. A table of the skeletal doses of 1625 patients is introduced. Of the 418 deaths seen up to date, 14% were due to neoplasiae - a percentage lower than in the normal population; 4 osteosarcomas are among them. Genetical damage caused by radiation also seems to be very unlikely. A risk estimation for osteosarcoma is given. (MG) [de

  2. The reverse protraction factor in the induction of bone sarcomas in radium-224 patients

    International Nuclear Information System (INIS)

    Chmelevsky, D.; Spiess, H.; Mays, C.W.; Kellerer, A.M.


    More than 50 bone sarcomas have occurred among a collective of about 800 patients who had been injected in Germany after World War II with large activities of radium-224 for the intended treatment of bone tuberculosis and ankylosing spondylitis. In an earlier analysis it was concluded that, at equal mean absorbed doses in the skeleton, patients with longer exposure time had a higher incidence of bone sarcomas. The previous analysis was based on approximations; in particular, it did not account for the varying times at risk of the individual patients. In view of the implications of a reverse protraction factor for basic considerations in radiation protection, the need was therefore felt to reevaluate the data from the continued follow-up by more rigorous statistical methods. A first step of the analysis demonstrates the existence of the reverse dose-rate effect in terms of a suitably constructed rank-order test. In a second step of the analysis it is concluded that the data are consistent with a linear no-threshold dose dependence under the condition of constant exposure time, while there is a steeper than linear dependence on dose when the exposure times increase proportionally to dose. A maximum likelihood fit of the data is then performed in terms of a proportional hazards model that includes the individual parameters, dose, treatment duration, and age at treatment. The fit indicates proportionality of the tumor rates to mean skeletal dose with an added factor (1 + 0.18.tau), where tau is the treatment time in months. This indicates that a protraction of the injections over 15 months instead of 5 months doubles the risk of bone sarcoma

  3. Purification, crystallization and preliminary crystallographic characterization of the α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224

    International Nuclear Information System (INIS)

    Okino, Nozomu; Kakuta, Yoshimitsu; Kajiwara, Hitomi; Ichikawa, Masako; Takakura, Yoshimitsu; Ito, Makoto; Yamamoto, Takeshi


    Crystallization of the α2,6-sialyltransferase from Photobacterium. Sialyltransferases transfer sialic acid from cytidine-5-monophospho-N-acetylneuraminic acid (CMP-NeuAc) to the nonreducing termini of the oligosaccharyl structures of various glycoproteins and glycolipids. The newly cloned α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224 (from the Vibrionaceae family) is composed of two domains: an unknown N-terminal domain and a catalytic C-terminal domain which shares significant homology with the Pasteurella multocida multifunctional sialyltransferase. The putative mature form of JT-ISH-224 α2,6-sialyltransferase was overproduced in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method at 293 K. The crystal belonged to space group P3 1 21 or P3 2 21, with unit-cell parameters a = b = 90.29, c = 204.33 Å. X-ray diffraction data were collected to 2.5 Å resolution

  4. Effect of temperature and pressure on excess electron mobility in n-hexane, 2,2,4-trimethylpentane, and tetramethylsilane

    International Nuclear Information System (INIS)

    Munoz, R.C.; Holroyd, R.A.


    Measurements of excess electron mobility are reported for liquid n-hexane, 2,2,4-trimethylpentane, and tetramethylsilane for pressures from 1 to 2500 bar and for temperatures from 18 to 120 0 C. For tetramethylsilane, a liquid that exhibits a high electron mobility, the mobility at constant density is proportional to T/sup -0.9/ between 25 and 100 0 C. The results are compared with the Basak--Cohen deformation potential theory. For n-hexane, where the mobility is low, Arrhenius behavior is observed. The isochoric activation energy increases with density. The results in this case are consistent with both the two-state and hopping models. In 2,2,4-trimethylpentane the mobility increases with increasing pressure at room temperature and decreases at high temperature. At 2500 bar and at intermediate temperatures (70--80 0 C) the mobility is approximately constant

  5. Early injuries on the tibia and vertebrae of the mouse after incorporation of thorium 227 and radium 224

    Energy Technology Data Exchange (ETDEWEB)

    Poemsl, H


    After incorporation of 5 and 50 thorium 227 as well as 25 radium 224, the tibia and lumbar vertebrae of the mouse were histologically and, using cell counting, morphometrically investigated within a period of 12 weeks. Osteoblasts and mesenchymal cells proved to be the most sensitive to radiation. They were temporarily decimated after 25 radium 224 in the tibial metaphysis, but soon regenerated. After 5 thorium 227, osteoblasts and mesenchymal cells were only slightly reduced, but more so in the lumbar vertebrae than in the tibia. The cells of osteogenic tissue were almost completely killed by 50 thorium 227. In the subsequent regeneration phase, larger regions of atypical bone occured in the tibia metaphysis which was pushed off in the further course by newly formed compact substance of epiphysial cartilage.

  6. Multiplicities and forward-backward correlations in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Samojlov, V.V.; Tashimov, M.A.


    Forward-backward multiplicity correlations in anti pp -interactions at 22.4 GeV/c and multiplicities in a simple icle multiplicity distribution is divided into even and odd components, the probability of producting an odd state is found to be higher than that of producing an even state, which may be interpreted to be due to diffraction forward-backward and to everall multiplicities is discussed

  7. VizieR Online Data Catalog: Spectrum of VY CMa in 220.65-224.25GHz range (Kaminski+, 2013) (United States)

    Kaminski, T.; Gottlieb, C. A.; Menten, K. M.; Patel, N. A.; Young, K. H.; Brunken, S.; Muller, H. S. P.; McCarthy, M. C.; Winters, J. M.; Decin, L.


    A spectrum of VY Canis Majoris obtained with the Plateau de Bure Interferometer on 22 April and 13 October 2012 in the frequency range 220.65-224.25GHz. The interferometer was used in its D configuration with six antennas and the synthesized beam was 4.9x2.2-arcsec. The spectrum was extracted from the central pixel of the map obtained with the gridding of 0.65-arcsec. (2 data files).

  8. Long-term investigation of the risk of malignant diseases following intravenous radium-224 treatment for ankylosing spondylitis; Langzeituntersuchung zum Risiko maligner Erkrankungen nach intravenoeser Behandlung des Morbus Bechterew mit Radium-224

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Tobias L. [Klinik und Poliklinik fuer Allgemeine Orthopaedie und Tumororthopaedie, Universitaetsklinikum Muenster (Germany); Nekolla, Elke A. [Bundesamt fuer Strahlenschutz (BfS), Neuherberg (Germany); Wick, Roland R. [Inst. fuer Strahlenbiologie, Helmholtz-Zentrum Muenchen, Deutsches Forschungszentrum fuer Gesundheit und Umwelt, Neuherberg (Germany)


    Background and purpose: in German-speaking countries, the intravenous treatment of ankylosing spondylitis (AS) with radium-224 ({sup 224}Ra) was common between the late 1940s and 2005. In this long-term investigation, the risk of malignant diseases following intravenous {sup 224}Ra treatment for AS was assessed. Patients and methods: in a prospective long-term study, 1,471 patients with AS who were treated with {sup 224}Ra between 1948 and 1975 have been followed together with a control group of 1,324 AS patients treated neither with radioactive drugs nor with X-rays. Standardized questionnaires to evaluate the patients' health status were used. Observed numbers of malignant diseases were compared with those of the control group as well as with expected numbers for a normal population. Results: After 26 years of follow-up, causes of death have been certified for 1,006 patients of the exposure group (control group: 1,072 patients). Significantly increased rates of myeloid leukemia (12 cases observed vs. 2.9 expected; p < 0.001), kidney cancer (18 vs. 9.1; p < 0.01), thyroid cancer (4 vs. 1.2; p = 0.03) and borderline significantly increased rates of cancer of female genital organs (10 vs. 5.6; p = 0.06) were found in the exposure group in contrast to no significant increases of these diseases in the control group. Rates of pulmonary and gastrointestinal malignancies were not increased. Lymphatic leukemia (exposure group: 8 vs. 2.7; p < 0.01; control group: 7 vs. 3; p = 0.03) was significantly elevated due to a high rate of chronic lymphatic leukemia in both, the exposure as well as the control group. Conclusion: treatment of AS with {sup 224}Ra led to increased incidences of myeloid leukemia and malignancies of kidneys, thyroid and female genital organs. Although this kind of therapy is now abandoned, there is a need for close follow-up of patients who received it. (orig.)

  9. Early diagnostic evaluation of miR-122 and miR-224 as biomarkers for hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Khalda S. Amr


    Full Text Available Hepatocellular carcinoma (HCC is one of the common lethal types of tumor all over the world. The lethality of HCC accounts for many reasons. One of them, the lack of reliable diagnostic markers at the early stage, in this context, serum miRNAs became promising diagnostic biomarkers. Herein, we aimed to identify the predictive value of two miRNAs (miR-122 and miR-224 in plasma of patients with HCC preceded by chronic HCV infection. Taqman miRNA assays specific for hsa-miR-122 and hsa-miR-224 were used to assess the expression levels of the chosen miRNAs in plasma samples collected from three groups; 40 patients with HCC related to HCV, 40 with CHC patients and 20 healthy volunteers. This study revealed that the mean plasma values of miRNA-122 were significantly lower among HCC group when compared to CHC and control groups (P 1.2 (RQ and (AUC = 0.93, P < 0.001, while the accuracy of AFP to diagnose HCC was (AUC: 0.619; P = 0.06. In conclusion, the expression plasma of miR-122 and miR-224 could be used as noninvasive biomarkers for the early prediction of developing HCC at the early stage.

  10. Risk of leukaemia following intravenous treatment with {sup 224}Ra - results of a long term follow-up study of ankylosing spondylitis patients; Leukaemierisiko nach intravenoeser {sup 224}Ra-Behandlung - Ergebnisse einer Langzeitstudie an Bechterew-Patienten

    Energy Technology Data Exchange (ETDEWEB)

    Wick, R.R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenbiologie; Chmelevsky, D. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Goessner, W. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Pathologie


    In an epidemiological study of the somatic late effects risk following incorporation of a short lived {alpha}-emitter, 1473 ankylosing spondylitis patients treated with repeated intravenous injections of {sup 224}Ra in the years 1948 - 75, have been observed in the GSF. The usual therapeutic plan consisted of a total of 10 - 12 injections of 1.036 MBq (28 {mu}Ci) of {sup 224}Ra each, given at weekly intervals; this would result in an cumulative {alpha}-dose of 0.56 - 0.67 Gy to the marrow-free skeleton of a 70-kg-man (standard man). These patients have been followed together with a control group of ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Until May 1993 (mean follow-up time 19.9 yr), 595 patients of the exposure group and 722 patients of the control group have died, causes of death have been ascertained for 578, resp. 668 patients. Among others we observed in the exposure group 10 cases of leukaemia (vs. 2.7 - 2.8 cases expected, p < 0.001) and 6 cases of leukaemia in the control group (vs. 3.3 - 3.5 exp., p = 0.14). Subclassification of the leukaemias shows a clear preference for chronic myeloid leukaemia (CML) in the exposure group (4 cases obs. vs. 0.8 cases exp., p = 0.009), whereas in the control group the observed cases of CML are within the range of expectancy. Similar observations have not been made in another group of patients, now observed by Spiess and co-workers, who have been treated at a higher dose/dose rate range. This increased incidence of leukaemias in our exposure group is in one line with results from animal experiments with bone seeking {alpha}-emitters given at low dose rates. The induction of myeloid leukaemia has been demonstrated in mice down to dose rates of only a few mGy/day also for {sup 239}Pu, an {alpha}-emitter which like {sup 224}Ra deposits preferentially on the bone surface. (orig.) [Deutsch] Im Rahmen einer epidemiologischen Studie zum somatischen Strahlenspaetschadenrisiko nach

  11. Study on the risk of late damage in humans after incorporation of the short-lived alpha emitter Ra-224

    International Nuclear Information System (INIS)

    Wick, R.R.; Nekolla, E.A.; Kellerer, A.M.; Goessner, W.


    An epidemiological study has been carried out at the GSF - National Research Center for Environment and Health - between 1948 and 1975, on 1460 ankylosing spondylitis (AS) patients. The aim of the study was to ascertain the late health effects suffered by these patients who had received repeated intravenous injections of the short lived α-emitter 224 Ra. These patients have been followed together with a control group of 1323 ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Causes of death have been ascertained for 842 exposed patients and 861 controls by the end of 2002. In the exposed group there has been a total of 219 malignant diseases and 206 cases among the controls. In particular, we observed 15 cases of leukaemia in the exposure group and 8 cases of leukaemia in the control group. Further subclassification of the leukaemias demonstrated a high increase of myeloid leukaemia in the exposure group (9 cases obs. vs. 2.5 cases exp.), and out of these especially the acute myeloid leukaemias (6 cases observed vs. 1.6 expected), whereas in the control group the observed cases are within the expected range (3 myeloid leukaemias vs. 2.6 cases). Out of these 6 cases of myeloid leukaemia, 3 cases have been observed at doses comparable to those of the currently applied 224 Ra treatment with the preparation SpondylAT registered , in one case the 224 Ra-dose was the 0.6fold, in another case 1.6fold, whereas in one case the total dose could not be verified exactly. The enhanced leukaemia incidence in our exposed group is in line with results from animal experiments in mice having been injected with bone seeking α-emitters given at low dose rates. (orig.) [de

  12. Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation

    CERN Multimedia

    Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S


    We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.

  13. High vacuum test of the dynamic components of the cyclotron dee chamber at the 224 cm variable energy cyclotron

    International Nuclear Information System (INIS)

    Chintalapudi, S.N.; Bandopadhyay, D.K.; Ghosh, D.K.; Gowariker, S.R.


    The 224 cm Variable Energy Cyclotron constructed and commissioned at Calcutta comprises a number of dynamic components in the high vacuum Dee Chamber. The static and dynamic conditions of these components have to be tested for high vacuum worthiness prior to their installation in the Dee Tank. A special set up was fabricated and used for simulating the Dee Chamber conditions and testing the components. A high vacuum of the order of 1 x 10 -5 torr was achieved under both dynamic and static conditions with and without coolant hydraulic pressures. The details of the set up, methods employed for the various tests carried out and the results obtained are described. (auth.)

  14. Risk of somatic late effects in man following incorporation of /sup 224/Ra(thorium X). Risiko somatischer Strahlenspaetschaeden des Menschen nach Inkorporation von /sup 224/Ra(Thorium X)

    Energy Technology Data Exchange (ETDEWEB)

    Wick, R.R.; Chmelevsky, D.


    1568 ankylosing spondylitis patients, injected with repeated injections of /sup 224/Ra for treatment of their disease, have been observed in the GSF (study II). By the end of 1985 3 cases of malignant tumours in the skeleton had been observed, compared to 0 cases in a control group. According to the cancer mortality statistics for the FRG the age-corrected number of spontaneous bone tumours expected would be 0.4-0.7. In contrast, a recent risk estimate from the data of the patient group of study I (SPIESS/MAYS) who were treated with considerably higher doses, suggests an expected number of 5.8 radiation induced bone tumours for the present follow-up tine. Latest observations from that group show that bone tumours may occur up to 33 yr after treatment with /sup 224/Ra. Thus, the possibility of additional cases of bone tumours occurring in study II cannot be excluded. One striking observation was that 2 of the 3 skeletal tumours observed in study II were tumours of the bone marrow; there has been only 1 bone marrow tumour in the high dose group (study I) among 56 bone tumours. In addition there have been 6 and 5 leukaemias in the exposure and control group respectively. Of the 6 leukaemias in the exposure group 3 were chronic myeloid leukaemias (CML), whereas among the 5 leukaemias in the control group there was no CML.

  15. 226Ra, 228Ra, 223Ra, and 224Ra in coastal waters with application to coastal dynamics and groundwater input

    International Nuclear Information System (INIS)

    Moore, W.S.


    Four radium isotopes offer promise in unraveling the complex dynamics of coastal ocean circulation and groundwater input. Each isotope is produced by decay of a thorium parent bound to sediment. The activities of these thorium isotopes and the sediment-water distribution coefficient for radium provide an estimate of the source function of each Ra isotope to the water. In salt marshes that receive little surface water input, Ra activities which exceed coastal ocean values must originate within the marsh. In North Inlet, South Carolina, the activities of 226 Ra exported from the marsh far exceed the activities generated within the marsh. To supply the exported activities, substantial groundwater input is required. In the coastal region itself, 226 Ra activities exceed the amount that can be supplied from rivers. Here also, substantial groundwater input is required. Within the coastal ocean, 223 Ra and 224 Ra may be used to determine mixing rates with offshore waters. Shore-perpendicular profiles of 223 Ra and 224 Ra show consistent trends which may be modeled as eddy diffusion coefficients of 350-540 m 2 s -1 . These coefficients allow an assessment of cross-shelf transport and provide further insight on the importance of groundwater to coastal regions. (author)

  16. MicroRNA-224 is Readily Detectable in Urine of Individuals with Diabetes Mellitus and is a Potential Indicator of Beta-Cell Demise

    Directory of Open Access Journals (Sweden)

    Siobhán Bacon


    Full Text Available MicroRNA (miRNA are a class of non-coding, 19–25 nucleotide RNA critical for network-level regulation of gene expression. miRNA serve as paracrine signaling molecules. Using an unbiased array approach, we previously identified elevated levels of miR-224 and miR-103 to be associated with a monogenic form of diabetes; HNF1A-MODY. miR-224 is a novel miRNA in the field of diabetes. We sought to explore the role of miR-224 as a potential biomarker in diabetes, and whether such diabetes-associated-miRNA can also be detected in the urine of patients. Absolute levels of miR-224 and miR-103 were determined in the urine of n = 144 individuals including carriers of a HNF1A mutation, participants with type 1 diabetes mellitus (T1DM, type 2 diabetes mellitus (T2DM and normal controls. Expression levels were correlated with clinical and biochemical parameters. miR-224 was significantly elevated in the urine of carriers of a HNF1A mutation and participants with T1DM. miR-103 was highly expressed in urine across all diabetes cohorts when compared to controls. For both miR-224 and-103, we found a significant correlation between serum and urine levels (p < 0.01. We demonstrate that miRNA can be readily detected in the urine independent of clinical indices of renal dysfunction. We surmise that the differential expression levels of miR-224 in both HNF1A-MODY mutation carriers and T1DM may be an attempt to compensate for beta-cell demise.

  17. EFSA Panel on Food Contact Materials , Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 224 (FGE.224): Consideration of genotoxic potential for two α,β - unsaturated thiophenes from subgroup 5.2 of FGE.19 by EFSA

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of two flavouring substances from subgroup 5.2 of FGE.19 in the Flavouring Group Evaluation 224 (FGE.224). The Flavour Industry has...... provided additional genotoxicity studies for one of the two substances in FGE.224, namely 5-methyl-2-thiophenecarbaldehyde [FL-no: 15.004]. The data requested by EFSA for the other substance, 3-acetyl-2,5-dimethylthiophene [FL-no: 15.024] of FGE.224 will be provided subsequently according to the Flavour...... are still pending and no conclusion could be drawn in the present FGE. © European Food Safety Authority, 2013...

  18. Mutagenic activity of 2-(2',4'-diaminophenoxy)ethanol in strains TA1538 and TA98 of Salmonella typhimurium. (United States)

    Mohn, G; Bouter, S; de Knijff, P


    The mutagenicity of 2-(2',4'-diaminophenoxy)ethanol (2,4-DAPE) was compared with that of 2,4-diaminoanisole (2,4-DAA), a chemically related compound previously used in hair-dye formulations. Both chemicals were tested in standard procedures with the Salmonella/microsome mutagenicity test as described by Ames and colleagues. In several experiments, which extended over a total period of 2 years, 2,4-DAA exhibited definite, but variable mutagenicity toward strain TA1538 when S9 preparations of rat liver induced with Aroclor 1254 were present in the incubation mixtures. The compound 2,4-DAPE did not exhibit detectable mutagenic activity when tested concomitantly under the same experimental conditions. We conclude that 2,4-DAPE is not mutagenic for Salmonella under conditions of the standard mammalian microsome assay with strain TA1538 and TA98 as indicators.

  19. Cataracts in patients injected with a solution of radium 224, colloidal platinum, and the red dye eosin (Peteosthor)

    International Nuclear Information System (INIS)

    Stefani, F.H.; Spiess, H.; Mays, C.W.


    Among 218 patients in the Spiess series injected with 224 Ra as juveniles from 1943 to about 1952, 91 have died. Of the 127 survivors, 47 have been examined in detail with a slitlamp and 25 were found to have some kind of lens opacity. In 14 out of the 25 the cataracts appeared morphologically similar to age-related cataracts. In 11 patients there was a bilateral posterior subcapsular cataract. In eight this was a bilateral dense round plaque with a clear subcapsular zone of about 0.5-0.6 mm, corresponding to newly deposited lens fibres during the period of about 40 years from treatment to examination. By June 1984, 12 of the 218 patients were reported to have had cataract as cause of decreased visual acuity. The present study found 32 patients (25 examined recently and seven others) with cataract confirmed with a slitlamp by August 1988. Three additionally reported cataracts could not be updated. (author)

  20. Differences between annihilation and nonannihilation characteristics of anti pp-interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Batyunya, B.V.; Boguslavsky, I.V.; Gramenitsky, I.M.; Lednicky, R.; Vrba, V.; Zlatanov, Z.; Fillipova, V.V.; Samoilov, V.V.; Temiraliev, T.; Levonian, S.V.; Villanen, P.; Walck, E.; Dementiev, R.K.; Korzhavina, I.A.; Leikin, E.M.; Puzyrnyi, A.G.; Rud, V.I.; Tikhonova, L.A.; Herynek, I.; Lokajicek, M.; Ridky, J.; Simak, V.; Leitner, R.; Suk, M.; Valkarova, A.; Kuratashvili, G.O.; Topuria, T.P.; Tsintsadze, V.D.


    All anti pp events at 22.4 GeV/c were separated into nonannihilation (N-group) and enriched annihilation (A-group) events. The mean sphericity value for the A-sample is in accordance with e + e - , K - p and π - p data. The experimental value of for events from the A-sample is larger than the value for N-events for all multiplicities. Mean charge transfer is found to be very sensitive to the dynamics of the process. The experimental value of mean charge transfer is = -0.25 if possible particle misidentification is taken into account. The experimental data are compared with the quark-parton model predictions. (orig.)

  1. Comparative study of chance coincidence correction in measuring 223Ra and 224Ra by delay coincidence method

    International Nuclear Information System (INIS)

    Yan Yongjun; Huang Derong; Zhou Jianliang; Qiu Shoukang


    The delay coincidence measurement of 220 Rn and 219 Rn has been proved to be a valid indirect method for measuring 224 Ra and 223 Ra extracted from natural water, which can provide valuable information on estuarine/ocean mixing, submarine groundwater discharge, and water/soil interactions. In practical operation chance coincidence correction must be considered, mostly Moore's correction method, but Moore's and Giffin's methods were incomplete in some ways. In this paper the modification (method 1) and a new chance coincidence correction formula (method 2) were provided. Experiments results are presented to demonstrate the conclusions. The results show that precision is improved while counting rate is less than 70 min- 1 . (authors)

  2. Electric dipole moments and polarizabilities of small Bi{sub n} (n = 2-24, 40, 80) clusters

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Song; Yuan, Hong Kuan; Chen, Hong; Wu, Bo [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Kuang, An Long [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); School of Physical Science and Technology, Suzhou University, Suzhou 215006 (China)


    The electric dipole moments (EDMs) and polarizabilities of small Bi{sub n} (n = 2-24, 40, 80) clusters are investigated by the finite field method within density functional theory (DFT). The results show that both dipole moments and polarizabilities have even-odd oscillation behaviors, and they strongly depend on geometrical structures and electronic structures. High symmetry structure prohibits the occurrence of EDMs on Bi clusters. The increasing polarizabilities of Bi clusters are attributed to the inherent novel chain-like geometrical evolution, which is significantly different from the characters observed in metal clusters or semiconductor clusters. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. On the singlet projector and the monodromy relation for psu(2,2|4) spin chains and reduction to subsectors

    International Nuclear Information System (INIS)

    Kazama, Yoichi; Komatsu, Shota; Nishimura, Takuya


    As a step toward uncovering the relation between the weak and the strong coupling regimes of the N=4 super Yang-Mills theory beyond the spectral level, we have developed in a previous paper [arXiv:1410.8533] a novel group theoretic interpretation of the Wick contraction of the fields, which allowed us to compute a much more general class of three-point functions in the SU(2) sector, as in the case of strong coupling [arXiv:1312.3727], directly in terms of the determinant representation of the partial domain wall partition function. Furthermore, we derived a non-trivial identity for the three point functions with monodromy operators inserted, being the discrete counterpart of the global monodromy condition which played such a crucial role in the computation at strong coupling. In this companion paper, we shall extend our study to the entire psu(2,2|4) sector and obtain several important generalizations. They include in particular (i) the manifestly conformally covariant construction, from the basic principle, of the singlet-projection operator for performing the Wick contraction and (ii) the derivation of the monodromy relation for the case of the so-called “harmonic R-matrix”, as well as for the usual fundamental R-matrtix. The former case, which is new and has features rather different from the latter, is expected to have important applications. We also describe how the form of the monodromy relation is modified as psu(2,2|4) is reduced to its subsectors.

  4. Local Control of Lung Derived Tumors by Diffusing Alpha-Emitting Atoms Released From Intratumoral Wires Loaded With Radium-224

    International Nuclear Information System (INIS)

    Cooks, Tomer; Schmidt, Michael; Bittan, Hadas; Lazarov, Elinor; Arazi, Lior; Kelson, Itzhak; Keisari, Yona


    Purpose: Diffusing alpha-emitters radiation therapy (DART) is a new form of brachytherapy enabling the treatment of solid tumors with alpha radiation. The present study examines the antitumoral effects resulting from the release of alpha emitting radioisotopes into solid lung carcinoma (LL2, A427, and NCI-H520). Methods and Materials: An in vitro setup tested the dose-dependent killing of tumor cells exposed to alpha particles. In in vivo studies, radioactive wires (0.3 mm diameter, 5 mm long) with 224 Ra activities in the range of 21-38 kBq were inserted into LL/2 tumors in C57BL/6 mice and into human-derived A427 or NCI-H520 tumors in athymic mice. The efficacy of the short-lived daughters of 224 Ra to produce tumor growth retardation and prolong life was assessed, and the spread of radioisotopes inside tumors was measured using autoradiography. Results: The insertion of a single DART wire into the center of 6- to 7-mm tumors had a pronounced retardation effect on tumor growth, leading to a significant inhibition of 49% (LL2) and 93% (A427) in tumor development and prolongations of 48% (LL2) in life expectancy. In the human model, more than 80% of the treated tumors disappeared or shrunk. Autoradiographic analysis of the treated sectioned tissue revealed the intratumoral distribution of the radioisotopes, and histological analysis showed corresponding areas of necrosis. In vitro experiments demonstrated a dose-dependent killing of tumors cells exposed to alpha particles. Conclusions: Short-lived diffusing alpha-emitters produced tumor growth retardation and increased survival in mice bearing lung tumor implants. These results justify further investigations with improved dose distributions.

  5. Nonlinear Equalization in 40/112/224 Gbit/s Mixed Line Rate 15-Channel DP-QPSK and DP-16QAM Contiguous Spectrum Based Networks

    DEFF Research Database (Denmark)

    Asif, Rameez


    We evaluated that in-line non-linear compensation schemes decrease the com- plexity of digital back-propagation and enhance the perfor mance of 40/112/224Gbit/s mixed line rate network. Both grouped and un-grouped spectral all ocation schemes are investigated.......We evaluated that in-line non-linear compensation schemes decrease the com- plexity of digital back-propagation and enhance the perfor mance of 40/112/224Gbit/s mixed line rate network. Both grouped and un-grouped spectral all ocation schemes are investigated....

  6. Preparation of protactinium measurement source by electroplating method

    International Nuclear Information System (INIS)

    Li Zongwei; Yang Weifan; Fang Keming; Yuan Shuanggui; Guo Junsheng; Pan Qiangyan


    An electroplating method for the preparation of Pa sources is described, and the main factors (such as pH value of solution, electroplating time and current density) influencing the electroplating of Pa are tested and discussed with 233 Pa as a tracer. A thin and uniform electroplating Pa-Layer of 1 mg/cm 2 thick on thin stainless steel disk was obtained. The Pa source was measured by a HPGe detector to determine the chemical efficiency

  7. Protactinium-231 found in natural thorium irradiated in JMTR

    International Nuclear Information System (INIS)

    Suzuki, Susumu; Mitsugashira, Toshiaki; Hara, Mitsuo; Satoh, Isamu; Shiokawa, Yoshinobu; Satoh, Michiko


    Natural thorium dioxides, which differed in the content of 230 Th, were irradiated in JMTR(Japan Material Testing Reactor). 232 U, 233 U, 231 Pa, 233 Pa, and remaining Th were measured radiometrically. High production of 231 Pa and high consumption of 230 Th were observed and it was necessary to assume large resonance capture of 230 Th in order to explain the production of 231 Pa and the consumption of 230 Th. (author)

  8. Measuring the radium quartet ({sup 228}Ra, {sup 226}Ra, {sup 224}Ra, {sup 223}Ra) in seawater samples using gamma spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Beek, P. van, E-mail: vanbeek@legos.obs-mip.f [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Souhaut, M. [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Reyss, J.-L. [LSCE, Laboratoire des Sciences du Climat et de l' Environnement (CNRS/CEA/UVSQ), Avenue de la Terrasse, 91198 Gif-sur-Yvette (France)


    Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While {sup 228}Ra and {sup 226}Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ({sup 224}Ra and {sup 223}Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report {sup 226}Ra, {sup 228}Ra, {sup 224}Ra, {sup 223}Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The {sup 223}Ra and {sup 224}Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the {sup 224}Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low {sup 223}Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

  9. Corrective Action Decision Document for Corrective Action Unit 224: Decon Pad and Septic Systems Nevada Test Site, Nevada, Rev. No.: 0

    Energy Technology Data Exchange (ETDEWEB)

    David A. Strand


    This Corrective Action Decision Document has been prepared for Corrective Action Unit (CAU) 224, Decon Pad and Septic Systems, in Areas 2, 3, 5, 6, 11, and 23 of the Nevada Test Site, Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 224 is comprised of the following corrective action sites (CASs): (1) 02-04-01, Septic Tank (Buried); (2) 03-05-01, Leachfield; (3) 05-04-01, Septic Tanks (4)/Discharge Area; (4) 06-03-01, Sewage Lagoons (3); (5) 06-05-01, Leachfield; (6) 06-17-04, Decon Pad and Wastewater Catch; (7) 06-23-01, Decon Pad Discharge Piping; (8) 11-04-01, Sewage Lagoon; and (9) 23-05-02, Leachfield. The purpose of this Corrective Action Decision Document is to identify and provide the rationale for the recommendation of a corrective action alternative for the nine CASs within CAU 224. Corrective action investigation activities were performed from August 10, 2004, through January 18, 2005, as set forth in the CAU 224 Corrective Action Investigation Plan.


    TMP (2,2,4-trimethylpentane,“isooctane”) is a colorless liquid used primarily in the alkylation of isobutene and butylene reactions to derive high-octane fuels. TMP is released in the environment through the manufacture, use, and disposal of products associated with the gasoline ...

  11. Coronary heart disease-associated variation in TCF21 disrupts a miR-224 binding site and miRNA-mediated regulation. (United States)

    Miller, Clint L; Haas, Ulrike; Diaz, Roxanne; Leeper, Nicholas J; Kundu, Ramendra K; Patlolla, Bhagat; Assimes, Themistocles L; Kaiser, Frank J; Perisic, Ljubica; Hedin, Ulf; Maegdefessel, Lars; Schunkert, Heribert; Erdmann, Jeanette; Quertermous, Thomas; Sczakiel, Georg


    Genome-wide association studies (GWAS) have identified chromosomal loci that affect risk of coronary heart disease (CHD) independent of classical risk factors. One such association signal has been identified at 6q23.2 in both Caucasians and East Asians. The lead CHD-associated polymorphism in this region, rs12190287, resides in the 3' untranslated region (3'-UTR) of TCF21, a basic-helix-loop-helix transcription factor, and is predicted to alter the seed binding sequence for miR-224. Allelic imbalance studies in circulating leukocytes and human coronary artery smooth muscle cells (HCASMC) showed significant imbalance of the TCF21 transcript that correlated with genotype at rs12190287, consistent with this variant contributing to allele-specific expression differences. 3' UTR reporter gene transfection studies in HCASMC showed that the disease-associated C allele has reduced expression compared to the protective G allele. Kinetic analyses in vitro revealed faster RNA-RNA complex formation and greater binding of miR-224 with the TCF21 C allelic transcript. In addition, in vitro probing with Pb2+ and RNase T1 revealed structural differences between the TCF21 variants in proximity of the rs12190287 variant, which are predicted to provide greater access to the C allele for miR-224 binding. miR-224 and TCF21 expression levels were anti-correlated in HCASMC, and miR-224 modulates the transcriptional response of TCF21 to transforming growth factor-β (TGF-β) and platelet derived growth factor (PDGF) signaling in an allele-specific manner. Lastly, miR-224 and TCF21 were localized in human coronary artery lesions and anti-correlated during atherosclerosis. Together, these data suggest that miR-224 interaction with the TCF21 transcript contributes to allelic imbalance of this gene, thus partly explaining the genetic risk for coronary heart disease associated at 6q23.2. These studies implicating rs12190287 in the miRNA-dependent regulation of TCF21, in conjunction with

  12. Cataracts in patients injected with a solution of radium 224, colloidal platinum, and the red dye eosin (Peteosthor)

    International Nuclear Information System (INIS)

    Stefani, F.H.; Spiess, H.


    Among 218 patients in the Spiess series injected with 224 Ra as juveniles from 1943 to about 1952, 91 have died leaving 127 alive. Of these, 47 have been examined in detail with a slitlamp by an ophthalmologist and 25 were found to have some kind of lens opacity. In 14 out of the 25 the cataracts appeared morphologically similar to age-related cataracts. In 11 patients there was a bilateral posterior subcapsular cataract. In eight this was a bilateral dense round plaque with a clear subcapsular zone of about 0.5-0.6 mm. This clear zone corresponds to newly deposited lens fibres during the period of about 40 years from treatment to examination. By June 1984, 12 of the 218 were reported to have had cataract as cause of decreased visual acuity. The present study found 32 patients (25 examined recently and seven others) with cataract confirmed with a slitlamp by August 1988. Three additionally reported cataracts could not be updated. (author)

  13. Study of the hydrolysis of protactinium (V), at tracer scale, by solvent extraction method with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. Characterization of the partition of TTA in the system TTA / H{sub 2}O / toluene / Na{sup +} / H{sup +} / ClO{sub 4}{sup -}; Contribution a l'etude thermodynamique de l'hydrolyse de Pa(V) a l'echelle des traces par la technique d'extraction liquide-liquide avec la thenoyltrifluoroacetone (TTA). Caracterisation du partage de la thenoyltrifluoroacetone dans le systeme TTA / H{sub 2}O / toluene / Na{sup +} / H{sup +} / ClO{sub 4}{sup -}

    Energy Technology Data Exchange (ETDEWEB)

    Jaussaud, Ch


    Hydrolysis of protactinium (V) according to the reactions: PaO(OH){sup 2+} +H{sub 2}O {r_reversible} PaO(OH){sub 2}{sup +} + H{sup +} (K{sub 2}] PaO(OH){sup 2+} +2H{sub 2}O {r_reversible} PaO(OH){sub 5} + H{sup +} (K{sub 3}) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na{sup +}/H{sup +}/ClO{sub 4}{sup -} system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients {epsilon}{sub (i,j)} as well as the Pitzer parameters {beta}{sup (0)} and {beta}{sup (1)} were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)

  14. Comment: 224 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available ty of Tokyo) licensed under CC Attribution2.1 Japan ヨコヅナクマムシ 光学顕微鏡写真 撮影:國枝武和(東京大学) bando 2010/02/15 14:55:40 2010/02/16 10:42:46 ...

  15. Evaluation of Mir-224, Mir-215 and Mir-143 as Serum Biomarkers for HCV Associated Hepatocellular Carcinoma (United States)

    Mamdouh, Samah; Khorshed, Fatma; Aboushousha, Tarek; Hamdy, Hussam; Diab, Ayman; Seleem, Mohamed; Saber, Mohamed


    HCV induced hepatitis and hepatocellular carcinoma as its sequel are major health problems world-wide and especially in Egypt. For diagnosis and during treatment of liver diseases, liver functions are monitored through determination of serum levels of liver enzymes and α-fetoprotein although the obtained information is generally not sufficient for either early detection of hepatic insult or effective follow up of therapeutic effects. More sensitive biomarkers may help to achieve these goals. MiRNAs are small non-coding RNAs that have an important role in gene expression and regulation. Many, such as miR-224, miR-215, miR-143 are correlated with tumor appearance and with the degree of fibrosis in lung, breast and colon cancer. This study was performed to estimate the level of these miRNAs in serum of patients with HCV-associated hepatitis and HCC in relation to grade of hepatitis, stage of fibrosis and differentiation of tumor tissue. In addition, correlations between serological and tissue levels were assessed. A total of 80 patients were examined, out of which 50 were included in the study. Blood samples and tissue specimens from malignant tumor and corresponding non-tumor tissue of HCV hepatitis patients were collected. Blood samples from 20 healthy volunteers were also obtained as controls. It was found that miRNAs profiles differed in HCC patients compared to controls and HCV-associated hepatitis cases. Distinction of tumor grade and fibrosis stage of patients as well as between different grades of tumor differentiation proved possible, making miRNAs promising biomarkers for diagnosis and assessment of treatment response of HCC patients. Creative Commons Attribution License

  16. Oesteosarcomagenic doses of radium (224Ra) and infectious endogenous retroviruses enhance proliferation and osteogenic differentiation of skeletal tissue dofferentiating in vitro

    International Nuclear Information System (INIS)

    Schmidt, J.; Heermeier, K.; Linzner, U.; Luz, A.; Silbermann, M.; Livne, E.; Erfle, V.


    Cartilage tissue from embryonic mice which undergoes osteogenic differentiation during in vitro cultivation was used to study the effect of osteosarcomagenic doses of α-irradiation and bone-tumor-inducing retroviruses on proliferation and phenotypic differentiation of skeletal cells in a defined tissue culture model. Irradiated mandibular condyles showed dose-dependent enhancement of cell proliferation at day 7 of the culture and increased osteogenic differentiation at day 14. Maximal effects were found with 7.4 Bq/ml of 224 Ra-labeled medium. Doses of 740 and 7400 Bq/ml of 224 Ra-labeled medium induced increasing cell death. Retrovirus infection enhanced osteogenic differentiation and extended the viability of irradiated cells. After transplantation none of the treated tissues developed tumors in syngeneic mice. (orig.)

  17. Tracing water movement in Mumbai harbor bay using naturally occurring "2"2"4Ra and "2"2"3Ra as tracer

    International Nuclear Information System (INIS)

    Yadav, V.B.; Sartandel, S.J.; Jha, S.K.; Tripathi, R.M.


    Measurement of short lived radium isotopes "2"2"4Ra and "2"2"3Ra in seawater samples collected from Mumbai Harbor Bay was carried out using MnO_2 based in-situ pre-concentration technique coupled with coincidence counting. Longitudinal variation of "2"2"4Ra and "2"2"3Ra was found in the range 17.74 - 98.66 dpm/100L and 0.56 - 2.26 dpm/100L respectively. Higher value of radium isotopes was found near shore sampling points where reused seawater and surface water from land intrudes in creek. A decreasing pattern was observed in the creek as we move to offshore locations. Lower activity ratio in offshore locations indicates the flow of water towards open sea. (author)

  18. Design and manufacture of a three-counter channel system based on delayed coincidence principle using for 22'3Ra and 224Ra measurements

    International Nuclear Information System (INIS)

    Tuong Thi Thu Huong; Pham Ngoc Tuan; Dang Hong Ngoc Quy; Truong Van Dat; Tran Anh Khoi; Chau Thi Nhu Quynh


    The research group has designed and fabricated a radiation detection system for measuring low activities of 223 Ra and 224 Ra in natural waters based on a design of Giffin et al (1963). Samples are obtained by adsorbing 223 Ra and 224 Ra onto a column of MnO 2 coated fiber (Mn fiber). The short-lived Rn daughters of 223 Ra and 224 Ra which recoil from the Mn fiber are swept into a scintillation detector where alpha decays of Rn and Po occur. Signals from the detector are sent to a delayed coincidence circuit which discriminates decay of the 224 Ra daughters, 220 Ra and 216 Po, from decays of the 223 Ra daughters, 219 Ra and 215 Po. The main product of this project is a “Low Alpha counting system” based on digital technology. This system consists of some main electronic circuit such as amplifier, single channel analyzer, counters/timers, micro-processor, RS232 interfacing. Almost of mentioned-above components have been designed and fabricated using ISE 10.1 software toolkits from Xilinx. The application program for controlling and collecting data from the device is written in LabView. In comparison with conventional analog circuits, the design of this system is smaller and easy to use owing to being connected to personal computer through RS232 interface in order to data acquisition and processing. This is also a new trend in the field of development of nuclear equipment with the aim to simple design, cost-saving (Reuse of hardware components can further reduce the system development cost), flexible (arbitrarily adjust measurement parameters by setting parameters from software), user-Friendly Environment (program directly embedded into the FPGA). (author)

  19. Invariant cross sections for the inclusive reactions antipp→π++X and antipp→p+X at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boss, E.G.; Ermilova, D.I.; Samojlov, V.V.


    The invariant inclusive cross sections for π + mesons and protons from antipp reactions at 22.4 GeV/c are presented. The average multiplicity for π + meson and proton production is 1.92+-0.02 and 0.41+-0.02, respectively. The annihilation spectra have been approximated using the difference between antipp and pp data. The resulting distributions have similar features as the total antipp data

  20. Invariant cross sections for inclusive reactions anti pp→π++X and anti pp→p+X at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Temiraliev, T.; Samojlov, V.V.


    Invariant inclusive cross sections for π + mesons and protons from antipp reactions at 22.4 GeV/c are presented. The average multiplicity for production of π + mesons is 1.92+-0.02 and for protons 0.41+-0.02. Annihilation spectra have been approximated by using the difference between antipp and pp data. The resulting distributions have similar gross features as the total antipp data. (author)

  1. (Vapour + liquid) equilibria for binary and ternary mixtures of 2-propanol, tetrahydropyran, and 2,2,4-trimethylpentane at P = 101.3 kPa

    International Nuclear Information System (INIS)

    Lin, Dun-Yi; Tu, Chein-Hsiun


    Highlights: ► We report the VLE data at P = 101.3 kPa involving a cyclic ether. ► The activity coefficients of mixtures were obtained from modified Raoult’s law. ► The VLE data were correlated by four liquid activity coefficient models. ► The ternary VLE data were predicted from binary parameters of the four models. - Abstract: (Vapour + liquid) equilibrium (VLE) at P = 101.3 kPa have been determined for a ternary system (2-propanol + tetrahydropyran + 2,2,4-trimethylpentane) and its constituent binary systems (2-propanol + tetrahydropyran, 2-propanol + 2,2,4-trimethylpentane), and (tetrahydropyran + 2,2,4-trimethylpentane). Analysis of VLE data reveals that two binary systems (2-propanol + tetrahydropyran) and (2-propanol + 2,2,4-trimethylpentane) have a minimum boiling azeotrope. No azeotrope was found for the ternary system. The activity coefficients of liquid mixtures were obtained from the modified Raoult’s law and were used to calculate the reduced excess molar Gibbs free energy (g E /RT). Thermodynamic consistency tests were performed for all VLE data using the Van Ness direct test for the binary systems and the test of McDermott–Ellis as modified by Wisniak and Tamir for the ternary system. The VLE data of the binary mixtures were correlated using the three-suffix Margules, Wilson, NRTL, and UNIQUAC activity-coefficient models. The models with their best-fitted interaction parameters of the binary systems were used to predict the ternary (vapour + liquid) equilibrium.

  2. Risk of leukaemia following intravenous treatment with 224Ra - results of a long term follow-up study of ankylosing spondylitis patients

    International Nuclear Information System (INIS)

    Wick, R.R.; Chmelevsky, D.; Goessner, W.


    In an epidemiological study of the somatic late effects risk following incorporation of a short lived α-emitter, 1473 ankylosing spondylitis patients treated with repeated intravenous injections of 224 Ra in the years 1948 - 75, have been observed in the GSF. The usual therapeutic plan consisted of a total of 10 - 12 injections of 1.036 MBq (28 μCi) of 224 Ra each, given at weekly intervals; this would result in an cumulative α-dose of 0.56 - 0.67 Gy to the marrow-free skeleton of a 70-kg-man (standard man). These patients have been followed together with a control group of ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Until May 1993 (mean follow-up time 19.9 yr), 595 patients of the exposure group and 722 patients of the control group have died, causes of death have been ascertained for 578, resp. 668 patients. Among others we observed in the exposure group 10 cases of leukaemia (vs. 2.7 - 2.8 cases expected, p 239 Pu, an α-emitter which like 224 Ra deposits preferentially on the bone surface. (orig.) [de

  3. Radium isotope (223Ra, 224Ra, 226Ra and 228Ra) distribution near Brazil's largest port, Paranaguá Bay, Brazil

    International Nuclear Information System (INIS)

    Dias, Thais H.; Oliveira, Joselene de; Sanders, Christian J.; Carvalho, Franciane; Sanders, Luciana M.; Machado, Eunice C.; Sá, Fabian


    This work investigates the 223 Ra, 224 Ra, 226 Ra and 228 Ra isotope distribution in river, estuarine waters and sediments of the Paranaguá Estuarine Complex (PEC). The stratification of the Ra isotopes along water columns indicate differing natural sources. In sediments, the radium isotope activities was inversely proportional to the particle size. The highest concentrations of 223 Ra, 224 Ra, 226 Ra and 228 Ra in the water column were found in the bottom more saline waters and towards the inner of the estuary. These relatively high concentrations towards the bottom of the estuary may be attributed to the influence of tidally driven groundwater source and desorption from particles at the maximum turbidity zone. The apparent river water ages from the radium isotope ratios, 223 Ra/ 224 Ra and 223 Ra/ 228 Ra, indicate that the principal rivers that flow into the estuary have residence times from between 6 and 11 days. - Highlights: • Radium isotope concentrations were evaluated along a large estuarine system. • The radioactivity level in river, estuary and sediments was within a normal range. • Spatial distributions of site specific radionuclides have differing activities and sources.

  4. Behavioral, neuroendocrine and neurochemical effects of the imidazoline I2 receptor selective ligand BU224 in naive rats and rats exposed to the stress of the forced swim test. (United States)

    Finn, David P; Martí, Octavi; Harbuz, Michael S; Vallès, Astrid; Belda, Xavier; Márquez, Cristina; Jessop, David S; Lalies, Margaret D; Armario, Antonio; Nutt, David J; Hudson, Alan L


    There is evidence for alterations in imidazoline(2) (I(2)) receptor density in depressed patients. Selective I(2) receptor ligands modulate central monoamine levels and activate the hypothalamo-pituitary-adrenal (HPA) axis and may have potential as antidepressants. To study the behavioral effects of the selective I(2) receptor ligand BU224 in the rat forced swim test (FST) and its effects on the HPA axis and central monoaminergic responses. Rats received saline or BU224 (10 mg/kg IP) 24, 18 and 1 h prior to 15 min exposure to the FST. Saline- and BU224-treated non-stressed groups were included. Time spent immobile, struggling and swimming calmly was measured. Plasma adrenocorticotrophic hormone (ACTH) and corticosterone levels 90 min post-BU224 were measured in addition to tissue levels of monoamines and metabolites in the frontal cortex, hippocampus and hypothalamus. Administration of BU224 significantly reduced immobility and increased mild swimming without affecting struggling. Exposure to the FST significantly increased plasma ACTH and corticosterone levels. BU224 administration also increased ACTH and potentiated the ACTH response to FST with no effect on corticosterone. BU224 administration significantly increased frontal cortex 5-hydroxytryptamine (5-HT) levels and decreased 5-HT turnover in the frontal cortex and hypothalamus of rats exposed to FST. In non-stressed rats, BU224 decreased 5-HT turnover in the hippocampus and hypothalamus and decreased norepinephrine turnover in the frontal cortex. The selective I(2) receptor ligand BU224 reduces immobility of rats in the FST, indicative of antidepressant-like activity. This effect is accompanied by alterations in HPA axis and central monoaminergic activity.

  5. The hair-dye reagent 2-(2',4'-diaminophenoxy)ethanol is mutagenic to Salmonella typhimurium. (United States)

    Venitt, S; Crofton-Sleigh, C; Osborne, M R


    A new hair-dye ingredient, 2-(2',4'-diaminophenoxy)ethanol (2,4-DAPE), was described as being devoid of any genotoxic activity on the basis of a multi-laboratory study. Since 2,4-DAPE is a close analogue of 2,4-diaminoanisole (2,4-DAA), which is mutagenic and carcinogenic, we tested this claim by assaying 2,4-DAPE for bacterial mutagenicity. Two samples of 2,4-DAPE X 2HCl were synthesized by reduction of the corresponding dinitrophenoxyethanol and identity and purity were established by elemental analysis, NMR spectrometry, mass-spectrometry, UV-spectrophotometry, TLC and HPLC. Fresh aqueous solutions of 2,4-DAPE X 2HCl were assayed in several separate plate tests using S. typhimurium TA1538, TA97, TA98 and TA100, and E. coli WP2uvrA (pKM101), 3 plates per dose and 0%, 4%, 10% and 30% Aroclor 1254-induced rat-liver S9 in S9 mixes. We obtained negative results in TA100 and E. coli. Reproducible, statistically significant dose-related increases in revertants (up to 14 times the background) were obtained in frame-shift mutants of S. typhimurium in the dose range 10-80 micrograms per plate. Mutagenicity was S9-dependent, significant increases in revertants being obtained only with 50 microliter per plate or more of S9. 2,4-DAPE induced significant mutagenic effects at doses of less than 1 micrograms per ml in TA1538 and TA98 in fluctuation tests using 2% S9 in the S9 mix. In plate tests, 2,4-DAPE was less mutagenic (by a factor of about 8) than 2,4-DAA, which gave the highest mutant yields with 20 microliter S9 per plate (4% S9 in the S9 mix). 2,4-DAPE obtained commercially was about 8 times more mutagenic than our sample of 2,4-DAPE. After purification, the commercial product, now chromatographically identical with our own sample, gave plate-test results close to those obtained for our samples of 2,4-DAPE. A review of the published reports (in which 2,4-DAPE was claimed to be inactive in a variety of short-term tests) revealed: (a) the use of protocols for bacterial

  6. Selenium nanoparticles prevents lead acetate-induced hypothyroidism and oxidative damage of thyroid tissues in male rats through modulation of selenoenzymes and suppression of miR-224. (United States)

    Atteia, Hebatallah Husseini; Arafa, Manar Hamed; Prabahar, Kousalya


    Selenium nanoparticles (Se-NPs) are customizable drug delivery vehicles that show good bioavailability, higher efficacy and lower toxicity than ordinary Se. Pre-treatment of male rats with these NPs has been recently shown to exert a protective effect against chromium-induced thyroid dysfunction. This study, therefore, aimed to investigate and characterize the potential protective mechanism of Se-NPs against lead (Pb) acetate-induced thyrotoxicity. We found that prophylactic and concurrent treatment of Pb acetate-exposed rats with Nano-Se (0.5 mg/kg, i.p) for 15 wk significantly alleviated the decrease in free triiodothyronine (fT3) and free thyroxine (fT4) levels as well as fT3/fT4 ratio% and the increase in thyroid stimulating hormone (TSH) levels to approach control values. This was accompanied by a reduction in the accumulation of Pb in serum and thyroid tissues as well as maintenance of thyroidal pro-oxidant/antioxidant balance and iodothyronine deiodinase type 1 (ID1), an essential enzyme for metabolizing of T4 into active T3, gene expression. Surprisingly, miR-224, a direct complementary target of ID1 mRNA, expression in the thyroid tissues was significantly down-regulated in Nano-Se-pre- and co-treated Pb acetate intoxicated animals. Such changes in miR-224 expression were negatively correlated with the changes in ID1 gene expression and serum fT3 level. These results suggest that Se-NPs can rescue from Pb-induced impairment of thyroid function through the maintenance of selenoproteins and down-regulation of miR-224. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  7. Orthorhombic-orthorhombic phase transitions in Nd2NiO4+δ (0.067≤δ≤0.224)

    International Nuclear Information System (INIS)

    Ishikawa, Kenji; Metoki, Kenji; Miyamoto, Hiroshi


    Variation of the phases of Nd 2 NiO 4+δ with the excess oxygen concentration δ has been examined at room temperature in the range 0.067≤δ≤0.224 using the X-ray powder diffraction technique. The phases observed at room temperature are orthorhombic-I (0.21 2 NiO 4+δ with the excess oxygen concentration. O I : orthorhombic-I; O II : orthorhombic-II; O IV : orthorhombic-IV; T I : quasi-tetragonal-I.

  8. Cross sections, average multiplicities and energy fractions of neutral π- and k-mesons in p anti p-annihilations at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Batyunya, B.V.; Boguslavsky, I.V.; Gramenitsky, I.M.


    To determine cross sections, average multiplicities and inelasticity coefficients π 0 and Ksub(n), formed in anti pp annihilation interaction at 22.4 GeV/c, data on the differences in the respective characteristics anti pp- and pp-interactions have been used. The average multiplicity of π 0 in anti pp annihilation interactions is equal to 3.2+-0.3 and exceeds analogous data for inelastic pp- and anti pp interactions. The inelasticity coefficient π + , π 0 and Ksub(n)/Ksup(0) or anti K 0 /of mesons formed in annihilation interactions: etasub(π)sup(+)=0.33+-0.22, etasub(πsup(0)=0.36+-0.05, etasub(Ksubn))=0.044+-0.008 is determined. The total multiplicity of charged and neutral particles formed in anti pp annihilation at 22.4 GeV/c equals 10.2+-0.4 and exceeds the corresponding values for inelastic anti pp and pp interactions

  9. Single-particle inclusive spectra of charged particles in anti- pp-interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.


    The inclusive spectra for inelastic anti-pp-interactions are investigated. Distributions of the transverse momentum squared for negative and positive particles as well as for identified protons have been obtained. The missing mass-squared distributions to the identified protons have been determined for different topologies of the experiment. The rapidity and target fragmentation cross-sections distributions have been obtained for the anti-pp → π - (π + )+X reactions in the center-of-mass-system. Average characteristics of the transverse momentum distribution show similar features as well as those obtained at higher than 22.4 GeV/c elsewhere. The upper limit of the antiproton diffraction dissociation cross section is 3.68+-0.45 mb. In the central region a charge asymmetry has been observed, the asymmetry parameter being equal to 0.15+-0.01

  10. Performance of 22.4-kW nonlaminated-frame dc series motor with chopper controller. [a dc to dc voltage converter (United States)

    Schwab, J. R.


    Performance data obtained through experimental testing of a 22.4 kW traction motor using two types of excitation are presented. Ripple free dc from a motor-generator set for baseline data and pulse width modulated dc as supplied by a battery pack and chopper controller were used for excitation. For the same average values of input voltage and current, the motor power output was independent of the type of excitation. However, at the same speeds, the motor efficiency at low power output (corresponding to low duty cycle of the controller) was 5 to 10 percentage points lower on chopped dc than on ripple free dc. The chopped dc locked-rotor torque was approximately 1 to 3 percent greater than the ripple free dc torque for the same average current.

  11. [The influence of N-, S-containing chinasolone derivatives (NC-224) on the biochemical and physicochemical parameters of membrane endoplasmatic reticulum and nuclear chromatine fractions of rats liver cells in conditions of its injury by tetrachloromethane]. (United States)

    Gubs'kyî, Iu I; Goriushko, G G; Belenichev, I F; Kovalenko, S I; Litvinova, N V; Marchenko, O M; Kurapova, T M; Babenko, L P; Velychko, O M


    Using biochemical and physicochemical methods of investigation in vivo, the effect of the substance NC-224, N-, S-chinasolone-derivative, on the lipoperoxidation activity in rat liver endoplasmatic reticulum membranes and nuclear chromatin fractions under tetrachloromethane intoxication have been studied. It was shown that NC-224 has pronounced antioxidant activity which is the biochemical basis of the substance membrane- and genome-protective effects and its ability to restore physicochemical properties of the surface and hydrophobic zones of hepatocyte membranes and structural parameter nuclear chromatin fractions in the conditions of chemical liver injury.

  12. New insights into the environmental photochemistry of 5-chloro-2-(2,4-dichlorophenoxy)phenol (triclosan): reconsidering the importance of indirect photoreactions. (United States)

    Bianco, Angelica; Fabbri, Debora; Minella, Marco; Brigante, Marcello; Mailhot, Gilles; Maurino, Valter; Minero, Claudio; Vione, Davide


    Triclosan (5-chloro-2-(2,4-dichlorophenoxy)phenol) is a widely used antimicrobial agent that undergoes fairly slow biodegradation. It is often found in surface waters in both the acidic (HTric) and basic (Tric(-)) forms (pKa ∼8), and it can undergo direct photodegradation to produce several intermediates including a dioxin congener (2,8-dichlorodibenzodioxin, hereafter 28DCDD). The latter is formed from Tric(-) and causes non-negligible environmental concern. Differently from current literature reports, in this paper we show that the direct photolysis would not be the only important transformation pathway of triclosan in surface waters. This is particularly true for HTric, which could undergo very significant reactions with (•)OH and, if the laser-derived quenching rate constants of this work are comparable to the actual reaction rate constants, with the triplet states of chromophoric dissolved organic matter ((3)CDOM*). Model calculations suggest that reaction with (3)CDOM* could be the main HTric phototransformation pathway in deep waters with high dissolved organic carbon (DOC), while reaction with (•)OH could prevail in low-DOC waters. In the case of Tric(-) the direct photolysis is much more important than for HTric, but triplet-sensitised transformation could produce 28DCDD + 27DCDD with higher yield compared to the direct photolysis, and it could play some role as dioxin source in deep waters with elevated DOC. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Growth and characterization of an organic single crystal: 2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide (United States)

    Senthil, K.; Kalainathan, S.; Ruban Kumar, A.

    Optically transparent crystal of the organic salt DEASI (2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide) has been synthesized by using knoevenagel condensation reaction method. The synthesized material has been purified by successfully recrystallization process. Single crystals of DEASI have been grown by slow evaporation technique at room temperature. The solubility of the title material has been determined at different temperature in acetonitrile/methanol mixture. The cell parameters and crystallinity of the title crystal were determined by single crystal XRD. The powder diffraction was carried out to study the reflection plane of the grown crystal and diffraction peaks were indexed. The presence of different functional groups in the crystal was confirmed by Fourier transform infrared (FTIR) analysis. 1H NMR spectrum was recorded to confirm the presence of hydrogen nuclei in the synthesized material. The optical property of the title crystal was studied by UV-Vis-NIR spectroscopic analysis. The melting point and thermal property of DEASI were studied using TGA/DSC technique. The Vicker’s hardness (Hv) was carried out to know the category. The dielectric constant and dielectric loss of the compound decreases with an increase in frequencies. Chemical etching studies showed that the DEASI grows in the two dimensional growth mechanisms. The Kurtz-Perry powder second harmonic generation (SHG) test has done for title crystal.

  14. Growth and characterization of an organic single crystal: 2-[2-(4-diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide. (United States)

    Senthil, K; Kalainathan, S; Ruban Kumar, A


    Optically transparent crystal of the organic salt DEASI (2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide) has been synthesized by using knoevenagel condensation reaction method. The synthesized material has been purified by successfully recrystallization process. Single crystals of DEASI have been grown by slow evaporation technique at room temperature. The solubility of the title material has been determined at different temperature in acetonitrile/methanol mixture. The cell parameters and crystallinity of the title crystal were determined by single crystal XRD. The powder diffraction was carried out to study the reflection plane of the grown crystal and diffraction peaks were indexed. The presence of different functional groups in the crystal was confirmed by Fourier transform infrared (FTIR) analysis. (1)H NMR spectrum was recorded to confirm the presence of hydrogen nuclei in the synthesized material. The optical property of the title crystal was studied by UV-Vis-NIR spectroscopic analysis. The melting point and thermal property of DEASI were studied using TGA/DSC technique. The Vicker's hardness (Hv) was carried out to know the category. The dielectric constant and dielectric loss of the compound decreases with an increase in frequencies. Chemical etching studies showed that the DEASI grows in the two dimensional growth mechanisms. The Kurtz-Perry powder second harmonic generation (SHG) test has done for title crystal. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Cessation of dangerousness status: an analysis of 224 reports from the Instituto de Perícias Heitor Carrilho, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Gustavo C. Oliveira

    Full Text Available Objectives: To evaluate factors related to dangerousness cessation at the end of involuntary commitment based on an analysis of expert reports. In light of the current legal requirement of dangerousness cessation as a pre-requisite for prison or internment release of individuals subjected to the safety measure, we sought elements to reflect on the practice of expert examiners in charge of making this decision. Methods: The authors revised 224 expert psychiatric dangerousness cessation reports released 2011 through 2014 and collected data for a statistical analysis. Results: The following variables were associated with positive risk cessation assessments: no inadequate behavior (according to the assistant professionals, no productive psychotic symptoms, no negative symptoms, presence of insight, presence of a support network, and no psychoactive substance abuse. The following variables were associated with negative dangerousness cessation decisions: early onset of malfunction, lack of insight, negative attitudes, active signs of major mental illness, presence of impulsiveness, poor response to treatment, presence of plans lacking feasibility, exposure to destabilizing factors, lack of personal support, and presence of stress. Conclusions: In this study we were able to identify factors associated with dangerousness in a sample of expert reports. The knowledge of factors linked to a higher risk of recidivism in illegal activities or violent behavior is crucial for decision-making regarding the release of offenders after their legally established period of involuntary commitment.

  16. JB_224_ESM.docx

    Indian Academy of Sciences (India)


    (A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

  17. Study of the specific concentrations of {sup 40}K, {sup 224}Ra, {sup 226}Ra and {sup 228}Ra in some seasonings marketed in Rio de Janeiro City

    Energy Technology Data Exchange (ETDEWEB)

    Garcêz, Ricardo W.D.; Lopes, José M.; Silva, Leandro B.; Silva, Ademir X. da [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Lima, Marco A.F., E-mail: [Universidade Federal Fluminense (UFF), Niterói, RJ (Brazil). Instituto de Biologia


    The seasoning are vegetables substances used in foods to enhance their flavor, aroma and color. This work presents an investigation of the activity concentration of Naturally Occurring Radioactive Materials (NORMs) in 28 samples of seasoning utilized by brazilian population. The seasoning samples were measured using gamma spectroscopy technique with a high-purity germanium (HPGe) detector, a non-destructive nuclear method and with the LabSOCS software for the calculation of the efficiency curve. The analysis shows that the activity concentration of {sup 40}K was measured in all samples and ranges from 21.0 Bq/kg to 1288 Bq/kg. The highest concentration activity of {sup 40}K was measured to 'cheiro verde', a local seasoning made of chives (Allium Schoenoprasum) and parsley (Petroselinum Crispum), while annatto, made with the fruit of Bixa Orelhana, had the lowest activity concentration. Brazil nut (Bertholletia Excelsa) presented the highest concentrations for {sup 226}Ra and {sup 228}Ra with 24 Bq/kg and 25.7 Bq/kg, respectively and black pepper (Piper Nigrum) presented the highest concentration for {sup 224}Ra with 33.9 Bq/kg. The highest effective dose for members of the public due to ingestion was 23.5 μSv/y due to Brazil nut and the lowest effective dose was found for annatto: 0.13 μSv/y. The syrian seasoning sample present specific concentration of 6.1±1.1 Bq/kg for {sup 137}Cs and 0.08 μSv/y of effective dose. The values found in this work do not represent a risk to human health. (author)

  18. Study of the specific concentrations of 40K, 224Ra, 226Ra and 228Ra in some seasonings marketed in Rio de Janeiro City

    International Nuclear Information System (INIS)

    Garcêz, Ricardo W.D.; Lopes, José M.; Silva, Leandro B.; Silva, Ademir X. da; Lima, Marco A.F.


    The seasoning are vegetables substances used in foods to enhance their flavor, aroma and color. This work presents an investigation of the activity concentration of Naturally Occurring Radioactive Materials (NORMs) in 28 samples of seasoning utilized by brazilian population. The seasoning samples were measured using gamma spectroscopy technique with a high-purity germanium (HPGe) detector, a non-destructive nuclear method and with the LabSOCS software for the calculation of the efficiency curve. The analysis shows that the activity concentration of 40 K was measured in all samples and ranges from 21.0 Bq/kg to 1288 Bq/kg. The highest concentration activity of 40 K was measured to 'cheiro verde', a local seasoning made of chives (Allium Schoenoprasum) and parsley (Petroselinum Crispum), while annatto, made with the fruit of Bixa Orelhana, had the lowest activity concentration. Brazil nut (Bertholletia Excelsa) presented the highest concentrations for 226 Ra and 228 Ra with 24 Bq/kg and 25.7 Bq/kg, respectively and black pepper (Piper Nigrum) presented the highest concentration for 224 Ra with 33.9 Bq/kg. The highest effective dose for members of the public due to ingestion was 23.5 μSv/y due to Brazil nut and the lowest effective dose was found for annatto: 0.13 μSv/y. The syrian seasoning sample present specific concentration of 6.1±1.1 Bq/kg for 137 Cs and 0.08 μSv/y of effective dose. The values found in this work do not represent a risk to human health. (author)

  19. Synthesis, docking and acetylcholinesterase inhibitory assessment of 2-(2-(4-Benzylpiperazin-1-yl)ethyl)isoindoline-1,3-dione derivatives with potential anti-Alzheimer effects (United States)


    Background Alzheimer’s disease (AD) as neurodegenerative disorder, is the most common form of dementia accounting for about 50-60% of the overall cases of dementia among persons over 65 years of age. Low acetylcholine (ACh) concentration in hippocampus and cortex areas of the brain is one of the main reasons for this disease. In recent years, acetylcholinesterase (AChE) inhibitors like donepezil with prevention of acetylcholine hydrolysis can enhance the duration of action of acetylcholine in synaptic cleft and improve the dementia associated with Alzheimer’s disease. Results Design, synthesis and assessment of anticholinesterase activity of 2-(2-(4-Benzylpiperazin-1-yl)ethyl)isoindoline-1,3-dione derivatives showed prepared compounds can function as potential acetylcholinesterase inhibitor. Among 12 synthesized derivatives, compound 4a with ortho chlorine moiety as electron withdrawing group exhibited the highest potency in these series (IC50 = 0.91 ± 0.045 μM) compared to donepezil (IC50 = 0.14 ± 0.03 μM). The results of the enzyme inhibition test (Ellman test) showed that electron withdrawing groups like Cl, F and NO2 can render the best effect at position ortho and para of the phenyl ring. But compound 4g with methoxy group at position 3(meta) afforded a favorable potency (IC50 = 5.5 ± 0.7 μM). Furthermore, docking study confirmed a same binding mode like donepezil for compound 4a. Conclusions Synthesized compounds 4a-4l could be proposed as potential anticholinesterase agents. PMID:23758724

  20. Synthesis, Docking and Acetylcholinesterase Inhibitory Assessment of 2-(2-(4-Benzylpiperazin-1-YlEthylIsoindoline-1,3-Dione Derivatives with Potential Anti-Alzheimer Effects

    Directory of Open Access Journals (Sweden)

    Ahmad Mohammadi-Farani


    Full Text Available Background:Alzheimer’s disease (AD as neurodegenerative disorder, is the most common form of dementia accounting for about 50-60% of the overall cases of dementia among persons over 65 years of age. Low acetylcholine (ACh concentration in hippocampus and cortex areas of the brain is one of the main reasons for this disease. In recent years, acetylcholinesterase (AChE inhibitors like donepezil with prevention of acetylcholine hydrolysis can enhance the duration of action of acetylcholine in synaptic cleft and improve the dementia associated with Alzheimer’s disease.Results:Design, synthesis and assessment of anticholinesterase activity of 2-(2-(4-Benzylpiperazin-1-ylethylisoindoline-1,3-dione derivatives showed prepared compounds can function as potential acetylcholinesterase inhibitor. Among 12 synthesized derivatives, compound 4a with ortho chlorine moiety as electron withdrawing group exhibited the highest potency in these series (IC50 = 0.91 ± 0.045 μM compared to donepezil (IC50 = 0.14 ± 0.03 μM. The results of the enzyme inhibition test (Ellman test showed that electron withdrawing groups like Cl, F and NO2 can render the best effect at position ortho and para of the phenyl ring. But compound 4g with methoxy group at position 3(meta afforded a favorable potency (IC50 = 5.5 ± 0.7 μM. Furthermore, docking study confirmed a same binding mode like donepezil for compound 4a.Conclusions:Synthesized compounds 4a-4l could be proposed as potential anticholinesterase agents.

  1. A Chemically Modified Curcumin (CMC 2.24) Inhibits Nuclear Factor κB Activation and Inflammatory Bone Loss in Murine Models of LPS-Induced Experimental Periodontitis and Diabetes-Associated Natural Periodontitis. (United States)

    Elburki, Muna S; Rossa, Carlos; Guimarães-Stabili, Morgana R; Lee, Hsi-Ming; Curylofo-Zotti, Fabiana A; Johnson, Francis; Golub, Lorne M


    The purpose of this study was to assess the effect of a novel chemically modified curcumin (CMC 2.24) on NF-κB and MAPK signaling and inflammatory cytokine production in two experimental models of periodontal disease in rats. Experimental model I: Periodontitis was induced by repeated injections of LPS into the gingiva (3×/week, 3 weeks); control rats received vehicle injections. CMC 2.24, or the vehicle, was administered by daily oral gavage for 4 weeks. Experimental model II: Diabetes was induced in adult male rats by streptozotocin injection; periodontal breakdown then results as a complication of uncontrolled hyperglycemia. Non-diabetic rats served as controls. CMC 2.24, or the vehicle, was administered by oral gavage daily for 3 weeks to the diabetics. Hemimaxillae and gingival tissues were harvested, and bone loss was assessed radiographically. Gingival tissues were pooled according to the experimental conditions and processed for the analysis of matrix metalloproteinases (MMPs) and bone-resorptive cytokines. Activation of p38 MAPK and NF-κB signaling pathways was assessed by western blot. Both LPS and diabetes induced an inflammatory process in the gingival tissues associated with excessive alveolar bone resorption and increased activation of p65 (NF-κB) and p38 MAPK. In both models, the administration of CMC 2.24 produced a marked reduction of inflammatory cytokines and MMPs in the gingival tissues, decreased bone loss, and decreased activation of p65 (NF-κB) and p38 MAPK. Inhibition of these cell signaling pathways by this novel tri-ketonic curcuminoid (natural curcumin is di-ketonic) may play a role in its therapeutic efficacy in locally and systemically associated periodontitis.

  2. Hallucinogen-like effects of 2-([2-(4-cyano-2,5-dimethoxyphenyl) ethylamino]methyl)phenol (25CN-NBOH), a novel N-benzylphenethylamine with 100-fold selectivity for 5-HT2A receptors, in mice

    DEFF Research Database (Denmark)

    Fantegrossi, William E; Gray, Bradley W; Bailey, Jessica M


    RATIONALE: 2-([2-(4-cyano-2,5-dimethoxyphenyl)ethylamino]methyl)phenol (25CN-NBOH) is structurally similar to N-benzyl substituted phenethylamine hallucinogens currently emerging as drugs of abuse. 25CN-NBOH exhibits dramatic selectivity for 5-HT2A receptors in vitro, but has not been behaviorally...... an intermediate degree of generalization (55 %) for the DOI training dose, and these interoceptive effects were attenuated by M100907. Finally, 25CN-NBOH did not generalize to M100907 at any dose, but ketanserin fully substituted in these animals. CONCLUSIONS: 25CN-NBOH was behaviorally active, but less effective...

  3. Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean

    International Nuclear Information System (INIS)

    Roy-Barman, M.


    The 'boundary scavenging' box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces 'almost' linear 230 Th profiles (as observed in the data) despite lateral transport. However, omitting lateral transport biases the 230 Th based particle flux estimates by as much as 50%. 231 Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231 Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232 Th is modelled using the same transport parameters as 230 Th but a different source function. The main source of the 232 Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230 Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230 Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230 Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231 Pa/ 230 Th ratio in arctic sediments. (authors)

  4. Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean

    Directory of Open Access Journals (Sweden)

    M. Roy-Barman


    Full Text Available The "boundary scavenging" box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces "almost" linear 230Th profiles (as observed in the data despite lateral transport. However, omitting lateral transport biaises the 230Th based particle flux estimates by as much as 50%. 231Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232Th is modelled using the same transport parameters as 230Th but a different source function. The main source of the 232Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231Pa/230Th ratio in arctic sediments.

  5. Occurrence of Radium-224, Radium-226 and Radium-228 in Water from the Vincentown and Wenonah-Mount Laurel Aquifers, the Englishtown Aquifer System, and the Hornerstown and Red Bank Sands, Southwestern and South-Central New Jersey (United States)

    dePaul, Vincent T.; Szabo, Zoltan


    This investigation is the first regionally focused study of the presence of natural radioactivity in water from the Vincentown and Wenonah-Mount Laurel aquifers, Englishtown aquifer system, and the Hornerstown and Red Bank Sands. Geologic materials composing the Vincentown and Wenonah-Mount Laurel aquifers and the Hornerstown and Red Bank Sands previously have been reported to contain radioactive (uranium-enriched) phosphatic strata, which is common in deposits from some moderate-depth coastal marine environments. The decay of uranium and thorium gives rise to natural radioactivity and numerous radioactive progeny, including isotopes of radium. Naturally occurring radioactive isotopes, especially those of radium, are of concern because radium is a known human carcinogen and ingestion (especially in water used for drinking) can present appreciable health risks. A regional network in southwestern and south-central New Jersey of 39 wells completed in the Vincentown and Wenonah-Mount Laurel aquifers, the Englishtown aquifer system, and the Hornerstown and Red Bank Sands was sampled for determination of gross alpha-particle activity; concentrations of radium radionuclides, major ions, and selected trace elements; and physical properties. Concentrations of radium-224, radium-226, and radium-228 were determined for water from 28 of the 39 wells, whereas gross alpha-particle activity was determined for all 39. The alpha spectroscopic technique was used to determine concentrations of radium-224, which ranged from less than 0.5 to 2.7 pCi/L with a median concentration of less than 0.5pCi/L, and of radium-226, which ranged from less than 0.5 to 3.2 pCi/L with a median concentration of less than 0.5 pCi/L. The beta-counting technique was used to determine concentrations of radium-228. The concentration of radium-228 ranged from less than 0.5 to 4.3 pCi/L with a median of less than 0.5. Radium-228, when quantifiable, had the greatest concentration of the three radium

  6. Independent verification survey report for exposure units Z2-24, Z2-31, Z2-32, AND Z2-36 in zone 2 of the East Tennessee technology park Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    King, David A. [Oak Ridge Inst. for Science and Education (ORISE), Oak Ridge, TN (United States)


    The U.S. Department of Energy (DOE) Oak Ridge Office of Environmental Management selected Oak Ridge Associated Universities (ORAU), through the Oak Ridge Institute for Science and Education (ORISE) contract, to perform independent verification (IV) at Zone 2 of the East Tennessee Technology Park (ETTP) in Oak Ridge, Tennessee. ORAU has concluded IV surveys, per the project-specific plan (PSP) (ORAU 2013a) covering exposure units (EUs) Z2-24, -31, -32, and -36. The objective of this effort was to verify the target EUs comply with requirements in the Zone 2 Record of Decision (ROD) (DOE 2005), as implemented by using the dynamic verification strategy presented in the dynamic work plan (DWP) (BJC 2007); and confirm commitments in the DWP were adequately implemented, as verified via IV surveys and soil sampling.

  7. Volumetric behaviour of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system and its binary sub-systems within the temperature range (298.15–328.15) K

    International Nuclear Information System (INIS)

    Morávková, Lenka; Troncoso, Jacobo; Machanová, Karolina; Sedláková, Zuzana


    Highlights: • Density measurements. • Excess molar volume at atmospheric pressure. • Redlich–Kister equation. • ERAS model. • Comparison of our data with literature data. -- Abstract: Densities and speeds of sound of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system as well as all its binary sub-systems were measured at four temperatures, namely 298.15 K, 308.15 K, 318.15 K, and 328.15 K at atmospheric pressure by a vibrating-tube densimeter DSA 5000. The binary (isooctane + toluene) system was studied previously. Excess quantities (molar volume, adiabatic compressibility, and isobaric thermal expansivity) of the mixtures studied were calculated from the experimental densities and speed of sounds. The excess molar volume data were correlated using the Redlich–Kister equation. Both the positive and S-shaped excess molar volume curves were found for the systems studied. The excess molar volumes versus concentration of binary systems differed in the shape and temperature dependence. The experimental binary data were compared with literature data. The experimental excess molar volumes were analyzed by means of the Extended Real Associated Solution (ERAS) model. The experimental data and the ERAS model can help to estimate real behaviour of the systems studied

  8. Discovery of (1R,2S)-2-{[(2,4-Dimethylpyrimidin-5-yl)oxy]methyl}-2-(3-fluorophenyl)-N-(5-fluoropyridin-2-yl)cyclopropanecarboxamide (E2006): A Potent and Efficacious Oral Orexin Receptor Antagonist. (United States)

    Yoshida, Yu; Naoe, Yoshimitsu; Terauchi, Taro; Ozaki, Fumihiro; Doko, Takashi; Takemura, Ayumi; Tanaka, Toshiaki; Sorimachi, Keiichi; Beuckmann, Carsten T; Suzuki, Michiyuki; Ueno, Takashi; Ozaki, Shunsuke; Yonaga, Masahiro


    The orexin/hypocretin receptors are a family of G protein-coupled receptors and consist of orexin-1 (OX1) and orexin-2 (OX2) receptor subtypes. Orexin receptors are expressed throughout the central nervous system and are involved in the regulation of the sleep/wake cycle. Because modulation of these receptors constitutes a promising target for novel treatments of disorders associated with the control of sleep and wakefulness, such as insomnia, the development of orexin receptor antagonists has emerged as an important focus in drug discovery research. Here, we report the design, synthesis, characterization, and structure-activity relationships (SARs) of novel orexin receptor antagonists. Various modifications made to the core structure of a previously developed compound (-)-5, the lead molecule, resulted in compounds with improved chemical and pharmacological profiles. The investigation afforded a potential therapeutic agent, (1R,2S)-2-{[(2,4-dimethylpyrimidin-5-yl)oxy]methyl}-2-(3-fluorophenyl)-N-(5-fluoropyridin-2-yl)cyclopropanecarboxamide (E2006), an orally active, potent orexin antagonist. The efficacy was demonstrated in mice in an in vivo study by using sleep parameter measurements.

  9. Participant and spectator scaling of spectator fragments in Au + Au and Cu + Cu collisions at √{sN N}=19.6 and 22.4 GeV (United States)

    Alver, B.; Back, B. B.; Baker, M. D.; Ballintijn, M.; Barton, D. S.; Betts, R. R.; Bickley, A. A.; Bindel, R.; Budzanowski, A.; Busza, W.; Carroll, A.; Chai, Z.; Chetluru, V.; Decowski, M. P.; García, E.; Gburek, T.; George, N.; Gulbrandsen, K.; Gushue, S.; Halliwell, C.; Hamblen, J.; Harnarine, I.; Heintzelman, G. A.; Henderson, C.; Hofman, D. J.; Hollis, R. S.; Hołyński, R.; Holzman, B.; Iordanova, A.; Johnson, E.; Kane, J. L.; Katzy, J.; Khan, N.; Kucewicz, W.; Kulinich, P.; Kuo, C. M.; Li, W.; Lin, W. T.; Loizides, C.; Manly, S.; McLeod, D.; Mignerey, A. C.; Nouicer, R.; Olszewski, A.; Pak, R.; Park, I. C.; Pernegger, H.; Reed, C.; Remsberg, L. P.; Reuter, M.; Richardson, E.; Roland, C.; Roland, G.; Rosenberg, L.; Sagerer, J.; Sarin, P.; Sawicki, P.; Sedykh, I.; Skulski, W.; Smith, C. E.; Stankiewicz, M. A.; Steinberg, P.; Stephans, G. S. F.; Sukhanov, A.; Szostak, A.; Tang, J.-L.; Tonjes, M. B.; Trzupek, A.; Vale, C.; van Nieuwenhuizen, G. J.; Vaurynovich, S. S.; Verdier, R.; Veres, G. I.; Walters, P.; Wenger, E.; Willhelm, D.; Wolfs, F. L. H.; Wosiek, B.; Woźniak, K.; Wuosmaa, A. H.; Wyngaardt, S.; Wysłouch, B.; Phobos Collaboration


    Spectator fragments resulting from relativistic heavy ion collisions, consisting of single protons and neutrons along with groups of stable nuclear fragments up to nitrogen (Z =7 ), are measured in PHOBOS. These fragments are observed in Au+Au (√{sNN}=19.6 GeV ) and Cu+Cu (22.4 GeV) collisions at high pseudorapidity (η ). The dominant multiply-charged fragment is the tightly bound helium (α ), with lithium, beryllium, and boron all clearly seen as a function of collision centrality and pseudorapidity. We observe that in Cu+Cu collisions, it becomes much more favorable for the α fragments to be released than lithium. The yields of fragments approximately scale with the number of spectator nucleons, independent of the colliding ion. The shapes of the pseudorapidity distributions of fragments indicate that the average deflection of the fragments away from the beam direction increases for more central collisions. A detailed comparison of the shapes for α and lithium fragments indicates that the centrality dependence of the deflections favors a scaling with the number of participants in the collision.

  10. CopperCore 2.2.4

    NARCIS (Netherlands)

    Vogten, Hubert; Martens, Harrie; Koper, Rob


    Changed in this release: -fixed bug with the id of the Monitor object and other services, fixed bugs with regard to the visibility of items. Please go to SourceForge for the original sources and website (this is only a backup archive): Available under the GNU GPL

  11. Publications | Page 224 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... Promoting Decent Work for Women in the Banking and Domestic Sectors in ... by the Institute for Social and Environmental Transition (ISET) in collaboration with ... geographical disparities faced by different Indonesian provinces and districts.

  12. Gender | Page 224 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to humanity. Of greater concern to social scientists is the emerging trend of population aging — the topic of a recent ...

  13. Publications | Page 224 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Simulation study of inter-firm network knowledge transfer moderated by the proximity [Chinese language] (restricted access). In order to explore the influence of inter-firm network attributes on knowledge transfer performance, a multi-agent simulation model was established. Results of the computerized simulation were ...

  14. 12 CFR 22.4 - Exemptions. (United States)


    ... State-owned property covered under a policy of self-insurance satisfactory to the Director of FEMA, who publishes and periodically revises the list of States falling within this exemption; or (b) Property...

  15. Publications | Page 224 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity ... In most countries fiscal and social reforms are subject to political swings, which are reflected in the ... Policy brief : revising Thailand's financing innovation policies (restricted access) ... Malaysia, Singapore, Taiwan and Thailand were.

  16. 22 CFR 224.29 - Sanctions. (United States)


    ...), (d), and (e) of this section, shall reasonably relate to the severity and nature of the failure or... upon, testimony relating to the information sought; and (4) Strike any part of the pleadings or other...

  17. Optically active antifungal azoles. XII. Synthesis and antifungal activity of the water-soluble prodrugs of 1-[(1R,2R)-2-(2,4-difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone. (United States)

    Ichikawa, T; Kitazaki, T; Matsushita, Y; Yamada, M; Hayashi, R; Yamaguchi, M; Kiyota, Y; Okonogi, K; Itoh, K


    1-[(1R,2R)-2-(2,4-Difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone (1: TAK-456) was selected as a candidate for clinical trials, but since its water-solubility was insufficient for an injectable formulation, the quaternary triazolium salts 2 were designed as water-soluble prodrugs. Among the prodrugs prepared, 4-acetoxymethyl-1-[(2R,3R)-2-(2,4-difluorophenyl)-2-hydroxy-3-[2-oxo-3-[4-(1H-1-terazolyl)phenyl]-1-imidazolidinyl]butyl]-1H-1,2,4-triazolium chloride (2a: TAK-457) was selected as an injectable candidate for clinical trials based on the results of evaluations on solubility, stability, hemolytic effect and in vivo antifungal activities.

  18. The novel imidazopyridine 2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine (BYK191023) is a highly selective inhibitor of the inducible nitric-oxide synthase. (United States)

    Strub, Andreas; Ulrich, Wolf-Rüdiger; Hesslinger, Christian; Eltze, Manfrid; Fuchss, Thomas; Strassner, Jochen; Strand, Susanne; Lehner, Martin D; Boer, Rainer


    We have identified imidazopyridine derivatives as a novel class of NO synthase inhibitors with high selectivity for the inducible isoform. 2-[2-(4-Methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine (BYK191023) showed half-maximal inhibition of crudely purified human inducible (iNOS), neuronal (nNOS), and endothelial (eNOS) NO synthases at 86 nM, 17 microM, and 162 microM, respectively. Inhibition of inducible NO synthase was competitive with l-arginine, pointing to an interaction of BYK191023 with the catalytic center of the enzyme. In radioligand and surface plasmon resonance experiments, BYK191023 exhibited an affinity for iNOS, nNOS, and eNOS of 450 nM, 30 microM, and >500 microM, respectively. Inhibition of cellular nitrate/nitrite synthesis in RAW, rat mesangium, and human embryonic kidney 293 cells after iNOS induction showed 40- to 100-fold higher IC(50) values than at the isolated enzyme, in agreement with the much higher l-arginine concentrations in cell culture media and inside intact cells. BYK191023 did not show any toxicity in various rodent and human cell lines up to high micromolar concentrations. The inhibitory potency of BYK191023 was tested in isolated organ models of iNOS (lipopolysaccharide-treated and phenylephrine-precontracted rat aorta; IC(50) = 7 microM), eNOS (arecaidine propargyl ester-induced relaxation of phenylephrine-precontracted rat aorta; IC(50) > 100 microM), and nNOS (field-stimulated relaxation of phenylephrine-precontracted rabbit corpus cavernosum; IC(50) > 100 microM). These data confirm the high selectivity of BYK191023 for iNOS over eNOS and nNOS found at isolated enzymes. In summary, we have identified a new highly selective iNOS inhibitor structurally unrelated to known compounds and l-arginine. BYK191023 is a valuable tool for the investigation of iNOS-mediated effects in vitro and in vivo.

  19. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.


    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  20. 49 CFR 571.224 - Standard No. 224; Rear impact protection. (United States)


    ... supporting frame structure of a motor vehicle. Horizontal member means the structural member of the guard... vehicle's cargo doors, tailgate, or other permanent structures are positioned as they normally are when... equipment that, while the vehicle is in transit, resides in or moves through any portion of the space...

  1. Excess enthalpies of ternary mixtures of oxygenated additives + hydrocarbon mixtures in fuels and bio-fuels: Dibutyl ether (DBE) and 1-butanol and 1-hexene or cyclohexane or 2,2,4 trimethylpentane at 298.15 K and 313.15 K

    International Nuclear Information System (INIS)

    Aguilar, Fernando; Alaoui, Fatima E.M.; Segovia, José J.; Montero, Eduardo A.


    Highlights: ► New excess enthalpy data for ternary mixtures of dibutyl ether + hydrocarbon + 1-butanol are reported. ► Four ternary systems at 298.15 K and 313.15 K were measured by means of an isothermal flow calorimeter. ► 420 Data were fitted to a Redlich–Kister rational equation. ► Intermolecular and association effects involved in these systems have been discussed. - Abstract: New experimental excess molar enthalpy data (420 points) of the ternary systems dibutyl ether (DBE) and 1-butanol and 1-hexene at 298.15 K and 313.15 K, and DBE and 1-butanol and cyclohexane or 2,2,4-trimethylpentane (TMP) at 313.15 K at atmospheric pressure are reported. A quasi-isothermal flow calorimeter has been used to make the measurements. All the ternary systems show endothermic character. The experimental data for the ternary systems have been fitted using the Redlich–Kister rational equation. Considerations with respect the intermolecular interactions amongst ether, alcohol and hydrocarbon compounds are presented.

  2. Kelder. Gerda Taljaard. Kaapstad: Tafelberg, 2012. 224 pp. ISBN ...

    African Journals Online (AJOL)

    There are. Benjamin's girlfriends—Elzette, the evil blonde skinny lawyer, and Martine, the goth with porcelain skin who plays jazz saxophone in her soundproof bathroom whilst standing on the toilet seat. One of Esmeralda's boyfriends is a butcher with massive sideburns. Another boyfriend is a professional big game hunter,.

  3. 47 CFR 36.224 - Extraordinary items-Account 7600. (United States)


    ..., REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Operating Revenues and Certain... account of an operating nature are apportioned on a basis consistent with the nature of these items. ...

  4. Editorial [Malta Medical Journal, Vol.22(4)


    Vassallo, Josanne


    Another publication year has come to an end and I note with pleasure the diversity of papers that have been submitted over the course of the past year. The papers are of particular interest to the medical community in the Maltese islands. A survey dealing with the aetiology of infectious intestinal disease provides information of relevance to practitioners in Malta.

  5. Dicty_cDB: VSI224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yk mek*e*iy*w*ntsc*ifkkemgkrg*i*tn*rvvdissw***ncrqici*merfkw*lv *iiwk*klgiq*iwsngsktcink*sln**itkiislamr*kt*...*iy*w*ntsc*ifkkemgkrg*i*tn*rvvdissw***ncrqici*me rfkw*lv*iiwk*klgiq*iwsngsktcink*sln**itkiislamr*kt**sskfirf

  6. Dicty_cDB: AFO224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ksck*ey snr*slrftrketllqsw*t*cscp*t*lcrpir*syrkrsfithllwyskw*fcnfthc wcsswyrn*thr*w*nyn*rccwssns**ni Frame B: fkknhlgnlkifnikk*kksflttfvyaeekkrnekyiiirfwlcckast*lplkkrrlf cnnc*fi

  7. Quantitative analysis of intermolecular interactions in 2,2'-((4 ...

    Indian Academy of Sciences (India)



    Feb 7, 2018 ... in good agreement with the crystal structure of the title compound. The structures of title ... was isolated from the reaction medium by simple filtra- tion. Thus, a green protocol ... In this situation, a study to understand how other ...

  8. 7 CFR 1951.224 - Third party agreements. (United States)


    ... in changes to the borrower's legal organizational structure which would result in its loss of control... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...) PROGRAM REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Servicing of Community and Direct Business...

  9. 7 CFR 2.24 - Assistant Secretary for Administration. (United States)


    ... with policies, regulations, and procedures with respect to purchases, contracts, leases, and other...] (13) Related to ethics. The Ethics function in the U.S. Department of Agriculture is under the... Agency Ethics Official under the Office of Government Ethics regulations at 5 CFR part 2638. (14...

  10. Combating Opium in Afghanistan. Strategic Forum, Number 224, November 2006 (United States)


    strategy will be severely limited.17 Truffles, a fungi delicacy, are the only legal agricultural product whose value rivals that of opium bear fruit and are not viable sources of income over the short term. Wheat , a favorite substitute of Western aid agencies, does not provide a...viable alternative for farmers. Income from poppy production is approximately $5,400 per hectare, while wheat brings in $500. Farmers claim that

  11. All projects related to | Page 224 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    . Infectious diseases are especially problematic in sub-Saharan Africa, where livestock production accounts for up to 25% of national income. Start Date: March 1, 2012. End Date: October 31, 2014. Topic: BIOTECHNOLOGY, AGRICULTURAL ...

  12. 22 CFR 224.6 - Prerequisites for issuing a complaint. (United States)


    ... paragraph (b) of this section), the amount of money or the value of property or services demanded or... single request, demand, or submission. (c) Nothing in this section shall be construed to limit the... were not submitted simultaneously, regardless of the amount of money, or the value of property or...

  13. 29 CFR 778.224 - “Other similar payments”. (United States)


    ... exclusion from the regular rate is specifically provided under section 7(e)(2) because they are not made as compensation for hours of work. Section 7(e) (2) also authorizes exclusion from the regular rate of “other... the payments specifically described in section 7(e)(2). It is clear that the clause was not intended...

  14. 29 CFR 779.224 - Common control in other cases. (United States)


    ... discussed in §§ 779.225 through 779.235. Leased Departments, Franchise and Other Business Arrangements ... business activities with other persons or corporations. In such a case, the activities may be performed... arrangement between the parties so as to vest the control of the activities of one business in the hands of...

  15. 10 CFR 600.224 - Matching or cost sharing. (United States)


    ... fringe benefits may be included in the valuation. (2) Employees of other organizations. When an employer... of pay exclusive of the employee's fringe benefits and overhead costs. If the services are in a... paragraph (e)(2)(i) of this section, no amount may be counted for donated land, and only depreciation or use...

  16. In vivo characterization of the novel imidazopyridine BYK191023 [2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine], a potent and highly selective inhibitor of inducible nitric-oxide synthase. (United States)

    Lehner, Martin D; Marx, Degenhard; Boer, Rainer; Strub, Andreas; Hesslinger, Christian; Eltze, Manfrid; Ulrich, Wolf-Rüdiger; Schwoebel, Frank; Schermuly, Ralph Theo; Barsig, Johannes


    Excessive release of nitric oxide from inducible nitric-oxide synthase (iNOS) has been postulated to contribute to pathology in a number of inflammatory diseases. We recently identified imidazopyridine derivatives as a novel class of potent nitricoxide synthase inhibitors with high selectivity for the inducible isoform. In the present study, we tested the in vivo potency of BYK191023 [2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo-[4,5-b]pyridine], a selected member of this inhibitor class, in three different rat models of lipopolysaccharide-induced systemic inflammation. Delayed administration of BYK191023 dose-dependently suppressed the lipopolysaccharide-induced increase in plasma nitrate/nitrite (NO(x)) levels with an ED(50) of 14.9 micromol/kg/h. In a model of systemic hypotension following high-dose lipopolysaccharide challenge, curative administration of BYK191023 at a dose that inhibited 83% of the NO(x) increase completely prevented the gradual decrease in mean arterial blood pressure observed in vehicle-treated control animals. The vasopressor effect was specific for endotoxemic animals since BYK191023 did not affect blood pressure in saline-challenged controls. In addition, in a model of lipopolysaccharide-induced vascular hyporesponsiveness, BYK191023 infusion partially restored normal blood pressure responses to norepinephrine and sodium nitroprusside via an l-arginine competitive mechanism. Taken together, BYK191023 is a member of a novel class of highly isoform-selective iNOS inhibitors with promising in vivo activity suitable for mechanistic studies on the role of selective iNOS inhibition as well as clinical development.

  17. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  18. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  19. Radiochemical determination and separation or total radium, 226Ra and 224Ra; Analisis Radioquimico de Radio total, Radio-226 y Radio-224

    Energy Technology Data Exchange (ETDEWEB)

    Suarez, J A; Gonzalez, J A; Pablo, M A. de


    Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs.

  20. 18 CFR 284.224 - Certain transportation and sales by local distribution companies. (United States)


    ... business; whether an individual, partnership, corporation or otherwise; the state under the laws of which... paragraph (e)(2)(ii) of this section. (3) Volumetric test. The volumes of natural gas sold or assigned under...

  1. Sexospécificités | Page 224 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le programme Recherche pour la lutte mondiale contre le tabac (RMCT) du CRDI aide des chercheurs des pays en développement à contrer l'influence des géants de l'industrie du tabac aux ressources financières colossales. Read more about Pour que brûle le feu du changement. Langue French. IDRC 's Research for ...

  2. Topographic Map of Quadrangle 3670, Jam-Kashem (223) and Zebak (224) Quadrangles, Afghanistan (United States)

    Bohannon, Robert G.


    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site ( The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  3. Validation of MIPAS IMK/IAA V5R_O3_224 ozone profiles

    Directory of Open Access Journals (Sweden)

    A. Laeng


    Full Text Available We present the results of an extensive validation program of the most recent version of ozone vertical profiles retrieved with the IMK/IAA (Institute for Meteorology and Climate Research/Instituto de Astrofísica de Andalucía MIPAS (Michelson Interferometer for Passive Atmospheric Sounding research level 2 processor from version 5 spectral level 1 data. The time period covered corresponds to the reduced spectral resolution period of the MIPAS instrument, i.e., January 2005–April 2012. The comparison with satellite instruments includes all post-2005 satellite limb and occultation sensors that have measured the vertical profiles of tropospheric and stratospheric ozone: ACE-FTS, GOMOS, HALOE, HIRDLS, MLS, OSIRIS, POAM, SAGE II, SCIAMACHY, SMILES, and SMR. In addition, balloon-borne MkIV solar occultation measurements and ground-based Umkehr measurements have been included, as well as two nadir sensors: IASI and SBUV. For each reference data set, bias determination and precision assessment are performed. Better agreement with reference instruments than for the previous data version, V5R_O3_220 (Laeng et al., 2014, is found: the known high bias around the ozone vmr (volume mixing ratio peak is significantly reduced and the vertical resolution at 35 km has been improved. The agreement with limb and solar occultation reference instruments that have a known small bias vs. ozonesondes is within 7% in the lower and middle stratosphere and 5% in the upper troposphere. Around the ozone vmr peak, the agreement with most of the satellite reference instruments is within 5%; this bias is as low as 3% for ACE-FTS, MLS, OSIRIS, POAM and SBUV.

  4. (E-2-[2-(4-Carboxyphenylethenyl]-8-hydroxyquinolin-1-ium chloride ethanol monosolvate

    Directory of Open Access Journals (Sweden)

    Edwin Weber


    Full Text Available In the title compound, C18H14NO3+·Cl−·CH3CH2OH, the dihedral angle formed by the mean planes of the quinolinium and benzene rings is 3.4 (1°, while the carboxy substituent is tilted at an angle of 4.8 (1° with respect to the benzene ring. There is a short N—H...O contact in the cation. In the crystal, due to the planar molecular geometry, two-dimensional aggregates are formed parallel to (221 via C—H...O, C—H...Cl, O—H...Cl and N—H...Cl hydrogen bonds. Interlayer association is accomplished by O—Hethanol...Cl and O—H...Oethanol hydrogen bonds and π–π stacking interactions [centroid–centroid distances vary from 3.6477 (12 to 3.8381 (11 Å]. A supramolecular three-dimensional architecture results from a stacked arrangement of layers comprising the ionic and hydrogen-bonded components.

  5. 77 FR 55894 - Fifteenth Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    ..., DC, on September 4, 2012. Kathy Hitt, Management Analyst, Business Operations Group, Federal Aviation... include the following: September 27-28, 2012 Welcome/Introductions/Administrative Remarks Review/Approve... Progress Report Time and Place of Next Meeting Any Other Business Adjourn Attendance is open to the...

  6. 78 FR 31627 - Twenty-Second Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    ..., Management Analyst, NextGen, Business Operations Group, Federal Aviation Administration. [FR Doc. 2013-12460... Welcome, Introductions & Administrative Remarks Review and Approve Summary of the Twenty-first Meeting... Next Meeting Any Other Business Adjourn Attendance is open to the interested public but limited to...

  7. 77 FR 64838 - Sixteenth Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    ..., DC, on October 15, 2012. Kathy Hitt, Management Analyst, Business Operations Group, Federal Aviation... Welcome/Introductions/Administrative Remarks Review/Approve Summary of Fifteenth Meeting Updates from TSA (as required) Section Reports Times and Place of Next Meeting Other Business Adjourn Attendance is...

  8. 77 FR 71474 - Seventeenth Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    ..., DC, on November 15, 2012. Richard F. Gonzalez, Management Analyst, Business Operations Group, ANG-A12... Welcome/Introductions/Administrative Remarks Review/Approve Summary of Sixteenth Meeting Updates from TSA (as required) Section Reports Times and Place of Next Meeting Other Business Adjourn Attendance is...

  9. 78 FR 16757 - Twentieth Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    .... Paige Williams, Management Analyst, NextGen, Business Operations Group, Federal Aviation Administration... Welcome, Introductions & Administrative Remarks Review and Approve Summary of Nineteenth Meeting Updates... Time and Place of Next Meeting Any Other Business Adjourn Attendance is open to the interested public...

  10. 78 FR 7850 - Nineteenth Meeting: RTCA Special Committee 224, Airport Security Access Control Systems (United States)


    .... Richard F. Gonzalez, Management Analyst, Business Operations Group, ANG-A12, Federal Aviation...: February 21, 2013 Welcome, Introductions & Administrative Remarks Review and Approve Summary of Eighteenth... Section Reports Time and Place of Next Meeting Other Business Adjourn Attendance is open to the interested...

  11. SU-E-J-224: Multimodality Segmentation of Head and Neck Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Aristophanous, M; Yang, J; Beadle, B [UT MD Anderson Cancer Center, Houston, TX (United States)


    Purpose: Develop an algorithm that is able to automatically segment tumor volume in Head and Neck cancer by integrating information from CT, PET and MR imaging simultaneously. Methods: Twenty three patients that were recruited under an adaptive radiotherapy protocol had MR, CT and PET/CT scans within 2 months prior to start of radiotherapy. The patients had unresectable disease and were treated either with chemoradiotherapy or radiation therapy alone. Using the Velocity software, the PET/CT and MR (T1 weighted+contrast) scans were registered to the planning CT using deformable and rigid registration respectively. The PET and MR images were then resampled according to the registration to match the planning CT. The resampled images, together with the planning CT, were fed into a multi-channel segmentation algorithm, which is based on Gaussian mixture models and solved with the expectation-maximization algorithm and Markov random fields. A rectangular region of interest (ROI) was manually placed to identify the tumor area and facilitate the segmentation process. The auto-segmented tumor contours were compared with the gross tumor volume (GTV) manually defined by the physician. The volume difference and Dice similarity coefficient (DSC) between the manual and autosegmented GTV contours were calculated as the quantitative evaluation metrics. Results: The multimodality segmentation algorithm was applied to all 23 patients. The volumes of the auto-segmented GTV ranged from 18.4cc to 32.8cc. The average (range) volume difference between the manual and auto-segmented GTV was −42% (−32.8%–63.8%). The average DSC value was 0.62, ranging from 0.39 to 0.78. Conclusion: An algorithm for the automated definition of tumor volume using multiple imaging modalities simultaneously was successfully developed and implemented for Head and Neck cancer. This development along with more accurate registration algorithms can aid physicians in the efforts to interpret the multitude of imaging information available in radiotherapy today. This project was supported by a grant by Varian Medical Systems.

  12. SU-E-J-224: Multimodality Segmentation of Head and Neck Tumors

    International Nuclear Information System (INIS)

    Aristophanous, M; Yang, J; Beadle, B


    Purpose: Develop an algorithm that is able to automatically segment tumor volume in Head and Neck cancer by integrating information from CT, PET and MR imaging simultaneously. Methods: Twenty three patients that were recruited under an adaptive radiotherapy protocol had MR, CT and PET/CT scans within 2 months prior to start of radiotherapy. The patients had unresectable disease and were treated either with chemoradiotherapy or radiation therapy alone. Using the Velocity software, the PET/CT and MR (T1 weighted+contrast) scans were registered to the planning CT using deformable and rigid registration respectively. The PET and MR images were then resampled according to the registration to match the planning CT. The resampled images, together with the planning CT, were fed into a multi-channel segmentation algorithm, which is based on Gaussian mixture models and solved with the expectation-maximization algorithm and Markov random fields. A rectangular region of interest (ROI) was manually placed to identify the tumor area and facilitate the segmentation process. The auto-segmented tumor contours were compared with the gross tumor volume (GTV) manually defined by the physician. The volume difference and Dice similarity coefficient (DSC) between the manual and autosegmented GTV contours were calculated as the quantitative evaluation metrics. Results: The multimodality segmentation algorithm was applied to all 23 patients. The volumes of the auto-segmented GTV ranged from 18.4cc to 32.8cc. The average (range) volume difference between the manual and auto-segmented GTV was −42% (−32.8%–63.8%). The average DSC value was 0.62, ranging from 0.39 to 0.78. Conclusion: An algorithm for the automated definition of tumor volume using multiple imaging modalities simultaneously was successfully developed and implemented for Head and Neck cancer. This development along with more accurate registration algorithms can aid physicians in the efforts to interpret the multitude of imaging information available in radiotherapy today. This project was supported by a grant by Varian Medical Systems

  13. Structures, Energetics and Spectroscopic Fingerprints of Water Clusters n=2-24

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Soohaeng; Xantheas, Sotiris S.


    This chapter discusses the structures, energetics, and vibrational spectra of the first few (n$24) water clusters obtained from high-level electronic structure calculations. The results are discussed in the perspective of being used to parameterize/assess the accuracy of classical and quantum force fields for water. To this end, a general introduction with the classification of those force fields is presented. Several low-lying families of minima for the medium cluster sizes are considered. The transition from the “all surface” to the “fully coordinated” cluster structures occurring at nD17 and its spectroscopic signature is presented. The various families of minima for nD20 are discussed together with the low energy networks of the pentagonal dodecahedron (H2O)20 water cage. Finally, the low-energy networks of the tetrakaidecahedron (T-cage) (H2O)24 cluster are shown and their significance in the construction of periodic lattices of structure I (sI) of the hydrate lattices is discussed.

  14. Yeast Interacting Proteins Database: YER059W, YDL224C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ment for passage through Start and commitment to cell division Rows with this prey as prey (1) Rows with thi... passage through Start and commitment to cell division Rows with this prey as prey Rows with this prey as pr

  15. Practical Pseudo-collisions for Hash Functions ARIRANG-224/384

    DEFF Research Database (Denmark)

    Guo, Jian; Matusiewicz, Krystian; Knudsen, Lars Ramkilde


    In this paper we analyse the security of the SHA-3 candidate ARIRANG. We show that bitwise complementation of whole registers turns out to be very useful for constructing high-probability differential characteristics in the function. We use this approach to find near-collisions with Hamming weigh...

  16. 25 CFR 224.63 - What provisions must a TERA contain? (United States)


    ... RESOURCE AGREEMENTS UNDER THE INDIAN TRIBAL ENERGY DEVELOPMENT AND SELF DETERMINATION ACT Procedures for... cancelled checks; cash receipt vouchers; copies of money orders or cashiers checks; or verification of...

  17. Zoológico de Cali. (pág. 224-229

    Directory of Open Access Journals (Sweden)

    Ingrit Pineda


    Full Text Available Es un importante centro de conservación de especies en peligro de extinción, en el se encuentra gran cantidad de fauna perteneciente a nuestro continente y algunas otras traídas del África. Los animales se encuentran agrupadosy distribuidos de acuerdo al grupo taxonómico en el que se ubican; es decir encontraremos en lugares diferentes a los primates, reptiles y anfibios, aves, felinos, algunosotros mamíferos. Lavariedad de formas, colores y conductas de los animales, han hecho de este lugar un importante centro educativo, tanto de diversiónpara adultos y niños.Está catalogado como uno de los mejoreszoológicos deLatinoamérica.

  18. Feeding behaviors and other motor development in healthy children (2-24 months). (United States)

    Carruth, Betty Ruth; Skinner, Jean D


    To monitor infant's gross, fine and oral motor development patterns related to feeding. An incomplete block design was used with 57 to 60 (sample = 98) mothers interviewed when their children were 2, 3, 4, 6, 8, 10, 12, 16 and 24 months (within +/- 5 days of birth date). Each mother had 5 to 6 interviews. Selected developmental feeding behaviors were monitored using in-home interviews conducted by trained interviewers (n = 2). At each interview, mothers reported the child's age when behaviors first occurred, and anthropometric measurements were performed. Subjects were healthy white children who lived mostly in homes with educated two-parent families of upper socioeconomic status. Mean behavioral ages were within normal ranges reported in the literature, whereas individuals exhibited a wide diversity in reported ages. Examples of gross motor skills (age in months, +/- SD) included sitting without help (5.50+/-2.08) and crawling (8.00+/-1.55). Mean ages for self-feeding fine motor skills showed children reaching for a spoon when hungry (5.47+/-1.44), using fingers to rake food toward self (8.87+/-2.58) and using fingers to self-feed soft foods (13.52+/-2.83). Oral behaviors included children opening their mouth when food approached (4.46+/-1.37), eating food with tiny lumps (8.70+/-2.03) and chewing and swallowing firmer foods without choking (12.17+/-2.28). Mean ages for feeding behaviors occurred within expected age ranges associated with normal development. However, mothers reported that individual children exhibited a wide age range for achieving these behaviors. Our results should be considered in counseling mothers about infant feeding practices.

  19. People and things. CERN Courier, May 1982, v. 22(4)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 1982 Summer Workshop on Proton Decay Experiments will be held from 7-11 June at Argonne National Laboratory. Its purpose is to bring together experimenters and theorists with an active interest in the next generation of proton decay experiments. A workshop will be held at Los Alamos from 19-22 July to discuss the LAMPF II project for a rapid cycling 16 GeV synchrotron providing 10 13 protons per pulse. 'The challenge of attaining ultra high energies' - This is the title of a meeting to review limitations and possibilities in particle acceleration to ultra high energies, organized jointly by ECFA and the Rutherford Laboratory. The topics for discussion will include the use of high electric fields generated in plasmas, external fields in short wave r.f. linacs, and laser illuminated gratings

  20. Radiochemical determination and separation or total radium, 226Ra and 224Ra

    International Nuclear Information System (INIS)

    Suarez, J. A.; Gonzalez, J. A.; Pablo, M. A. de


    Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs

  1. 50 CFR 224.101 - Enumeration of endangered marine and anadromous species. (United States)


    ... Creek Captive Broodstock Program, and the Noyo River Fish Station egg-take Program coho hatchery.... Beluga whale (Delphinapterus leucas), Cook Inlet distinct population segment; Blue whale (Balaenoptera...

  2. A long-term study on the therapeutic effects of radium-224 in Bechterew's disease

    International Nuclear Information System (INIS)

    Schmitt, E.


    The article deals with the question of the real extents of the positive effects of Thorium x in Bechterew's disease and the risks which are taken by applying this treatment. 129 out of 200 patients treated in the Frankfurt clinic in the time 1952-1970 were explored with the help of a detailed list of questions. 80 of these patients could make a direct comparison with other treatment methods and stated the Thorium X-treatment to be substantially more efficient. A long-lasting improvement was seen in 52% of the patients. Out of 80 patients who underwent a post-examination, 79.5% felt an improvement directly after the treatment, 75.6% even still 2 years after the treatment. The clinical values and the laboratory examinations, however, did not reveal such a favourable picture. In a comparison group of patients who had not been treated with Thorium X, only 19.9% showed an improvement. Using the usual methods of clinic, lab., and radiology, no radiation damage could be observed. The author is of the opinion that treatment with Thorium X does not bear an increased risk, if compared with medicamentous treatment methods. However, strict indication and exact dosage should be adhered to. (MG) [de

  3. 2,2'-[(4-Methyl-2-phenylimidazolidine-1,3-diyl)bis(methylene)]diphenol

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Cardenas, L.; Ríos-Motta, J.; Eigner, Václav; Dušek, Michal


    Roč. 69, č. 8 (2013), o1198 ISSN 1600-5368 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : single-crystal X-ray study * Jana2006 * hydrogen bonds Subject RIV: CC - Organic Chemistry Impact factor: 0.347, year: 2011

  4. Domingo Irwin, Relaciones civiles-militares en el siglo XX, Caracas, El Centauro, 2000, 224 pp.


    Langue, Frédérique


    En la larga lista de los interrogantes planteados por la " revolución bolivariana " del Presidente Chávez en la Venezuela de hoy figura sin lugar a dudas la naturaleza de la misma. ¿Régimen militarista, autoritario, retoño del caudillismo, manifestación de pretorianismo, nueva simbiosis entre la sociedad civil y el sector militar ? Especialista de las relaciones civiles-militares en la larga duración, Domingo Irwin aborda en esta entrega una temática pluridisciplinaria dominada por la histori...

  5. : tous les projets | Page 224 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INTERNATIONAL FINANCE, INTERNATIONAL FINANCIAL MARKET, FINANCIAL POLICY, DEMOGRAPHY, DEMOGRAPHIC CHANGE, DEMOGRAPHIC TRANSITION. Région: Brazil, South America, China, Far East Asia, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, ...

  6. 50 CFR 224.103 - Special prohibitions for endangered marine mammals. (United States)


    ... breeding, nursing, or resting activities, attempts by a whale to shield a calf from a vessel or human...), commercial fishing means taking or harvesting fish or fishery resources to sell, barter, or trade. Commercial... sea lions, shall also apply to the western population of Steller sea lions, which consists of all...

  7. 25 CFR 224.30 - What definitions apply to this part? (United States)


    ... subject to a restriction against alienation under the laws of the United States. “Physical trust asset... restriction against alienation under the laws of the United States. For the purposes of this part, tribal land includes land taken into trust or subject to restrictions on alienation under the laws of the United States...

  8. Aleksandr Gol’ts, Armiia Rossii: 11 poteriannykh let, Moscow: Zakharov, 2004, 224 pp.

    Directory of Open Access Journals (Sweden)

    Richard F. Staar


    Full Text Available Specialist of military questions, Aleksandr Gol’ts worked for Red Star (Krasnaia Zvezda, the newspaper of the Russian Ministry of Defense, before joining various prestigious magazines such as Itogi. He is considered one of the most prominent journalist on military matters in Russia today. His book, “The Russian Army : 11 lost years”, is dedicated to military reforms in post-Soviet Russia. With his extensive knowledge of institutional realities of the military establishment, Gol’ts provides a...

  9. 40 CFR 421.224 - Standards of performance for new sources. (United States)


    ... any 1 day Maximum for monthly average mg/kg (pounds per million pounds) of technical grade molybdenum plus vanadium plus pure grade molybdenum produced Arsenic 27.120 12.097 Chromium 7.219 2.927 Lead 5.463...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary...

  10. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target (United States)

    Fassbender, Michael E.; Radchenko, Valery


    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  11. A new method for the determination of radium-228, thorium-228, and radium-224 in groundwaters via thoron (radon-220)

    International Nuclear Information System (INIS)

    Smith, M.R.; Lautensleger, A.W.; Laul, J.C.


    An improved method for determining radium and thorium from the 232 Th decay series has been developed which measures the activity of 220 Rn as an assay of its parents. Although some ingrowth corrections and minor separation procedures for Th are required, the results to date show that the dynamic counting of 220 Rn via de-emanation and alpha counting by the alpha-scintillation method is preferable. The method for lower limit detection depends on the emanation rate. (author) 3 refs.; 6 figs

  12. Post-GOE redox insights from Mo isotopes, Ce anomalies, and Mn from the 2.24 Ga Kazput Formation (United States)

    Thoby, M.; Konhauser, K.; Philippot, P.; Killingsworth, B.; Warchola, T.; Lalonde, S.


    Following the Great Oxidation event (GOE) defined from 2.45 to 2.2 Ga, an event marking the first appearance of widespread atmospheric oxygen, a combination of decreased Mn(II) supply from land and increased Mn(IV)-precipitation in the oceans should have resulted in lower concentrations of Mn in seawater. Nevertheless, it appears that some early Proterozoic marine sediments record high seawater Mn concentrations hundreds of millions of years after the GOE. Here we investigate a Mn excursion associated with marine carbonates and shales of the 2.31 Ga Kazput Formation. Samples were recovered from drill core collected during the Turee Creek Drilling Project (TCDP). Using molybdenum (Mo) isotope data coupled with cerium (Ce) anomalies, we define the redox condition of the Kazput depositional environment. Initial results show no Mo fractionation and few cerium anomalies in carbonates, pointing to an anoxic basin without Mn oxide precipitates. Additionally, XRF data on the shales indicates an association of Mn with calcium (Ca) suggesting an anoxic environment at the time of their deposition. Our results provide new insights into the nature and environment of the Turee Creek basin and the extent of oxygenation of surface waters after the GOE.

  13. Radon fixation for determination of 224Ra, 226Ra and 228Ra via gamma-ray spectrometry

    International Nuclear Information System (INIS)

    Herranz, M.; Idoeta, R.; Abelairas, A.; Legarda, F.


    The aim of this work is the improvement of the procedure for the determination of radium isotopes activities in water, which is done through radiochemical separation and subsequent gamma-ray spectrometry. In addition, radon gas retention is studied using different activated carbon materials. The results of the IAEA Proficiency test: 'Determination of radium and uranium radionuclides in water' of December 2002 [IAEA, 2003. Analytical quality control services: determination of radium and uranium radionuclides in water. Preliminary Report, Seibersdorf] are considered for this work

  14. Experience in the fabrication of 224 cm diameter electromagnet and coil for the Variable Energy Cyclotron Centre (Paper No. 005)

    International Nuclear Information System (INIS)

    Chaudhuri, J.; Das, S.K.; Bhattacharjee, B.B.


    The largest and vital component of a cyclotron is the D.C. magnet. The magnet core of cyclotron of the Variable Energy Cyclotron, Calcutta, is of H-shaped and made from low carbon steel casting and weighs nearly 262 tonnes. In length, width and height, the magnet is 6096mm x 2235mm x 2896mm respectively. The pole piece diameter is 2235mm with pole gap of 190.5±0.127. For convenient of handling and transportation, the upper and lower yoke of the magnet is in five pieces each. Apart from this, magnet has two numbers of legs and two numbers of pole pieces. The pole pieces are again splitted in two pieces for the convenience of fabrication assembly. The dimensions of the castings in the finished machined condition are 6096±1.5 x 889 x 447±0.026 for yoke slabs and 1117.6±0.8 (H) x 1092±1.5 (L) x 2235±1.5 (Max.) x 1422 (Min.) mm for the magnet legs. The weight of each casting of yoke slab is 19000 kg and that of leg casting is 17420 Kg each. The castings are required to have required magnetic saturation value and soundness of casting to the rolled steel standard. (author). 7 figs

  15. An upper limit to interstellar Pu-224 abundance as deduced from radiochemical search in deep-sea sediment

    International Nuclear Information System (INIS)

    Paul, M.; Valenta, A.; Ahman, I.


    Short-lived radionuclides with halflives of a few 10 7 years, now-extinct in the solar system, are expected to be present in the interstellar medium (ISM) as freshly synthesized matter in supermovae. Grains of ISM origin recently discovered in the inner solar system and at Earth orbit may accrete onto Earth after ablation in the atmosphere. As pointed out by one of the authors (K.S.) in 1974, a favorable matrix of detection of such extraterrestrial material is deep-sea sediments with very low sedimentation rates of ∼1 -1 . We report here a search for the 'live' Pu-244 in a 1 kg-deep-sea dry sediment collected in 1992 in the North Pacific. After a 546 day a-counting of a Pu fraction chemically separated from the alkaline-fused sediment sample at Kanazawa Univ. AMS analysis was performed at Hebrew Univ. and Weizmann Institute. Only one count of Pu-244 with no background ions was detected, indicating no excess over the expected stratospheric man-made fallout. A limit of 0.2 Pu-244 atoms cm -2 .y -1 for extra terrestrial deposition was set under reasonable assumptions and it was then concluded from this result and the available data on ISM that the abundance of Pu-244 in the ISM is less than 2 X 10 -11 g-Pu-244 (g ISM) -1 . Implications of the present result will be discussed.

  16. Vol. 4(1), S/No 13, January, 2015:224-231 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka


    Jan 13, 2015 ... Copyright © IAARR 2014: Indexed African Journals .... It is the divine entity ..... religious framework of an alternative view of the world, a rival cosmology and a different way of ... Ado-Ekiti, Nigeria: Hambaz ...

  17. 75 FR 41337 - Implementation of Section 224 of the Act; A National Broadband Plan for Our Future (United States)


    ... communications-equipment training or skills that the utility cannot duplicate to work among the power lines, such... be a reasonable time period for the actual performance of make-ready work. To implement this approach... performance. Moreover, the Commission proposes that the obligation to complete make- ready work in this...

  18. Fast Facts: Recent Statistics from the Library Research Service, Nos. 214-224. February 11-March 31, 2005 (United States)

    Steffen, Nicolle Olivia; Lance, Keith Curry; Lietzau, Zeth; Dickenson, Don


    Eleven issues of "Fast Facts" from the Library Research Service cover information from libraries across Colorado. These issues focus on topics from the public, academic, and school sectors. These topics include patron use of AskColorado (a statewide virtual reference service) and the rising use of online services. The "Fast…

  19. 75 FR 45494 - Implementation of Section 224 of the Act; a National Broadband Plan for Our Future (United States)


    ... Attachment Notice 73 FR 6879, February 6, 2008 in recognition of the importance of pole attachments to the... techniques take advantage of usable physical space on the existing pole. 15. The Eleventh Circuit... deployment of communications technologies, consistent with the broad ``pro competitive'' purposes of the 1996...

  20. Analysis of the alignment of momenta in anti pp interactions at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boos, E.G.; Ermilova, D.I.; Samoilov, V.V.


    Analyzed were about 25000 inelastic anti pp events with charge multiplicity of 2, 4, 6, 8, 10, obtained with the ''Ludmila'' chamber. The events were reconstructed by the MDTHRESH and HYDRA programs. The results on studying azimuthal correlations in anti pp-interactions are presented. The difference observed between distributions of particle pairs with equal and different charges cannot be explained completely neither by the effect of interference of identical particles, nor by the presence of leading particles or by that of resonances. Studies of the value of planarity point to the alignment of transverse momentum of secondary particles. The alignment does not depend on the multiplicity of charged particles, and it is not connected with the effect of interference of identical particles or with leading particles. An asymmetry is observed in the azimuthal angular distribution of a beam particle in the main axes system, which is not described in the framework of cylindrical phase volume

  1. 33 CFR 110.224 - San Francisco Bay, San Pablo Bay, Carquinez Strait, Suisun Bay, Sacramento River, San Joaquin... (United States)


    ... area shown on a Government chart. (5) No vessel may moor, anchor, or tie up to any pier, wharf, or... supervision may go alongside or in any manner moor to any Government-owned vessel, mooring buoy, or pontoon...); and the side boundaries of which are parallel tangents joining the semicircles. A forbidden anchorage...

  2. Radon fixation for determination of {sup 224}Ra, {sup 226}Ra and {sup 228}Ra via gamma-ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Herranz, M. [Departamento Ingenieria Nuclear y Mecanica de Fluidos, E. S. Ingenieros de Bilbao - Universidad del Pais Vasco (UPV/EHU), Alda. Urquijo s/n, 48013 Bilbao (Spain)]. E-mail:; Idoeta, R. [Departamento Ingenieria Nuclear y Mecanica de Fluidos, E. S. Ingenieros de Bilbao - Universidad del Pais Vasco (UPV/EHU), Alda. Urquijo s/n, 48013 Bilbao (Spain); Abelairas, A. [Departamento Ingenieria Nuclear y Mecanica de Fluidos, E. S. Ingenieros de Bilbao - Universidad del Pais Vasco (UPV/EHU), Alda. Urquijo s/n, 48013 Bilbao (Spain); Legarda, F. [Departamento Ingenieria Nuclear y Mecanica de Fluidos, E. S. Ingenieros de Bilbao - Universidad del Pais Vasco (UPV/EHU), Alda. Urquijo s/n, 48013 Bilbao (Spain)


    The aim of this work is the improvement of the procedure for the determination of radium isotopes activities in water, which is done through radiochemical separation and subsequent gamma-ray spectrometry. In addition, radon gas retention is studied using different activated carbon materials. The results of the IAEA Proficiency test: 'Determination of radium and uranium radionuclides in water' of December 2002 [IAEA, 2003. Analytical quality control services: determination of radium and uranium radionuclides in water. Preliminary Report, Seibersdorf] are considered for this work.

  3. Prospection for natural 231Pa in India

    International Nuclear Information System (INIS)

    Anupama, P.; Gantayet, L.M.; Verma, R.; Parthasarathy, R.; Anil Kumar, S.; Dingankar, M.V.; Ghosh, S.K.; Patra, R.N.


    Protactinium-231 ( 231 Pa) occurs in nature as a member of the decay chain of naturally occuring 235 U of the 4n+ 3 radioactive series. The expected protactinium concentration in the Jaduguda ore body (with uranium concentration of 0.03-0.06 %) is around 0.2 parts per billion (ppb) and that in monazite ore (uranium concentration 0.3%) is 0.9 ppb. The process at uranium ore processing plant at Jaduguda was studied. 231 Pa content in samples from the process streams of the plant was determined. The gamma ray spectrometry method was chosen and standardised in our laboratory to detect and measure 231 Pa in parts per billion levels in these samples. A concentrated source of protactinium could not be found among the assessed streams of Jaduguda uranium plant. The Monazite processing plant at IRE, Aluva was then studied. From the known chemistry of protactinium, the possible distribution of the 231 Pa was guessed at. Accordingly, the process streams of IRE process plant were selected to prospect for 231 Pa and determine the fractionation of protactinium. For analysis of 231 Pa, the thorium bearing samples were chemically treated to remove the thorium daughter products, which interfere in gamma spectrometry. This report describes the planning for prospecting, sample selection, the standardisation of the analysis procedure for determination of 231 Pa content, and the analysis results. The 231 Pa content in various streams of Indian Rare Earths plant was found in the range 0.2 -6.5 ppb. Some of the streams did not carry any protactinium. The fractionation of 231 Pa in the various streams of the plant and the selection of source for recovery of protactinium are discussed in detail. (author)

  4. Study on the adsorption of 233Pa in glass

    International Nuclear Information System (INIS)

    Natsumi, R.R.; Saiki, M.; Lima, F.W. de.


    It is intended to examine the adsorption of protactinium on glass in relation to pH, presence of complexing agents concentration and type of electrolytes. The study was made by using carrier-free 233 Pa solution and Pyrex glass tube was selected as adsorbent glass material surface. The adsorption curve of protactinium on glass surface as a function of the pH of the tracer solution showed the existence of two pronounced adsorption regions. It was found that this adsorption can be reduced by using electrolytes or complexing agents. Desorption of protactinium previously adsorbed on the Pyrex glass tube was also studied. Hidrochloric, oxalic and hydrofluoric acid solutions were used for the desorption experiments. (Author) [pt

  5. SU-F-J-224: Impact of 4D PET/CT On PERCIST Classification of Lung and Liver Metastases in NSLC and Colorectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Meier, J; Lopez, B; Mawlawi, O [UT MD Anderson Cancer Center, Houston, TX (United States)


    Purpose: To quantify the impact of 4D PET/CT on PERCIST metrics in lung and liver tumors in NSCLC and colorectal cancer patients. Methods: 32 patients presenting lung or liver tumors of 1–3 cm size affected by respiratory motion were scanned on a GE Discovery 690 PET/CT. The bed position with lesion(s) affected by motion was acquired in a 12 minute PET LIST mode and unlisted into 8 bins with respiratory gating. Three different CT maps were used for attenuation correction: a clinical helical CT (CT-clin), an average CT (CT-ave), and an 8-phase 4D CINE CT (CT-cine). All reconstructions were 3D OSEM, 2 iterations, 24 subsets, 6.4 Gaussian filtration, 192×192 matrix, non-TOF, and non-PSF. Reconstructions using CT-clin and CT-ave used only 3 out of the 12 minutes of the data (clinical protocol); all 12 minutes were used for the CT-cine reconstruction. The percent change of SUVbw-peak and SUVbw-max was calculated between PET-CTclin and PET-CTave. The same percent change was also calculated between PET-CTclin and PET-CTcine in each of the 8 bins and in the average of all bins. A 30% difference from PET-CTclin classified lesions as progressive metabolic disease (PMD) using maximum bin value and the average of eight bin values. Results: 30 lesions in 25 patients were evaluated. Using the bin with maximum SUVbw-peak and SUVbw-max difference, 4 and 13 lesions were classified as PMD, respectively. Using the average bin values for SUVbw-peak and SUVbw-max, 3 and 6 lesions were classified as PMD, respectively. Using PET-CTave values for SUVbw-peak and SUVbw-max, 4 and 3 lesions were classified as PMD, respectively. Conclusion: These results suggest that response evaluation in 4D PET/CT is dependent on SUV measurement (SUVpeak vs. SUVmax), number of bins (single or average), and the CT map used for attenuation correction.

  6. Isothermal Vapour-Liquid Equilibria in the Ternary System tert-Butyl Methyl Ether + tert-Butanol + 2,2,4-Trimethylpentane and the Three Binary Subsystems

    Czech Academy of Sciences Publication Activity Database

    Bernatová, Svatoslava; Wichterle, Ivan


    Roč. 180, 1-2 (2001), s. 235-245 ISSN 0378-3812 R&D Projects: GA ČR GA104/99/0136 Institutional research plan: CEZ:AV0Z4072921 Keywords : vapourůliquid equilibrium * experimental data * molar excess volume Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001

  7. 2-(2-(4-Benzoylpiperazin-1-ylethylisoindoline-1,3-dione derivatives: Synthesis, docking and acetylcholinesterase inhibitory evaluation as anti-alzheimer agents

    Directory of Open Access Journals (Sweden)

    Ahmad Mohammadi-Farani


    Full Text Available Objective(s: Alzheimer’s disease (AD as progressive cognitive decline and the most common form of dementia is due to degeneration of the cholinergic neurons in the brain. Therefore, administration of the acetylcholinesterase (AChE inhibitors such as donepezil is the first choice for treatment of the AD. In the present study, we focused on the synthesis and anti-cholinesterase evaluation of new donepezil like analogs. Materials and Methods: A new series of phthalimide derivatives (compounds 4a-4j were synthesized via Gabriel protocol and subsequently amidation reaction was performed using various benzoic acid derivatives. Then, the corresponding anti-acetylcholinesterase activity of the prepared derivatives (4a-4j was assessed by utilization of the Ellman's test and obtained results were compared to donepezil. Besides, docking study was also carried out to explore the likely in silico binding interactions.  Results: According to the obtained results, electron withdrawing groups (Cl, F at position 3 and an electron donating group (methoxy at position 4 of the phenyl ring enhanced the acetylcholinesterase inhibitory activity. Compound 4e (m-Fluoro, IC50 = 7.1 nM and 4i (p-Methoxy, IC50 = 20.3 nM were the most active compounds in this series and exerted superior potency than donepezil (410 nM. Moreover, a similar binding mode was observed in silico for all ligands in superimposition state with donepezil into the active site of acetylcholinesterase. Conclusion: Studied compounds could be potential leads for discovery of novel anti-Alzheimer agents in the future.

  8. SU-E-J-224: Using UTE and T1 Weighted Spin Echo Pulse Sequences for MR-Only Treatment Planning; Phantom Study

    Energy Technology Data Exchange (ETDEWEB)

    Yu, H; Fatemi, A [Sunnybrook Health Sciences Centre, Toronto, Ontario (Canada); Sahgal, A [University of Toronto, Toronto, ON (Canada)


    Purpose: Investigating a new approach in MRI based treatment planning using the combination of (Ultrashort Echo Time) UTE and T1 weighted spin echo pulse sequences to delineate air, bone and water (soft tissues) in generating pseudo CT images comparable with CT. Methods: A gel phantom containing chicken bones, ping pang balls filled with distilled water and air bubbles, was made. It scanned with MRI using UTE and 2D T1W SE pulse sequences with (in plane resolution= 0.53mm, slice thickness= 2 mm) and CT with (in plane resolution= 0.5 mm and slice thickness= 0.75mm) as a ground truth for geometrical accuracy. The UTE and T1W SE images were registered with CT using mutual information registration algorithm provided by Philips Pinnacle treatment planning system. The phantom boundaries were detected using Canny edge detection algorithm for CT, and MR images. The bone, air bubbles and water in ping pong balls were segmented from CT images using threshold 300HU, - 950HU and 0HU, respectively. These tissue inserts were automatically segmented from combined UTE and T1W SE images using edge detection and relative intensity histograms of the phantom. The obtained segmentations of air, bone and water inserts were evaluated with those obtained from CT. Results: Bone and air can be clearly differentiated in UTE images comparable to CT. Combining UTE and T1W SE images successfully segmented the air, bone and water. The maximum segmentation differences from combine MRI images (UTE and T1W SE) and CT are within 1.3 mm, 1.1mm for bone, air, respectively. The geometric distortion of UTE sequence is small less than 1 pixel (0.53 mm) of MR image resolution. Conclusion: Our approach indicates that MRI can be used solely for treatment planning and its quality is comparable with CT.

  9. Hyperspectral surface materials map of quadrangle 3670, Jurm-Kishim (223) and Zebak (224) quadrangles, Afghanistan, showing iron-bearing minerals and other materials (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.


    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  10. Detailed investigation of Na2.24FePO4CO3 as a cathode material for Na-ion batteries (United States)

    Huang, Weifeng; Zhou, Jing; Li, Biao; Ma, Jin; Tao, Shi; Xia, Dingguo; Chu, Wangsheng; Wu, Ziyu


    Na-ion batteries are gaining an increased recognition as the next generation low cost energy storage devices. Here, we present a characterization of Na3FePO4CO3 nanoplates as a novel cathode material for sodium ion batteries. First-principles calculations reveal that there are two paths for Na ion migration along b and c axis. In-situ and ex-situ Fe K-edge X-ray absorption near edge structure (XANES) point out that in Na3FePO4CO3 both Fe2+/Fe3+ and Fe3+/Fe4+ redox couples are electrochemically active, suggesting also the existence of a two-electron intercalation reaction. Ex-situ X-ray powder diffraction data demonstrates that the crystalline structure of Na3FePO4CO3 remains stable during the charging/discharging process within the range 2.0–4.55 V. PMID:24595232

  11. SU-F-T-224: Importance of Timely Review of Daily Cone-Beam CTs: Dosimetric Evaluation of Rejected CBCTs for Head and Neck Patients

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, M; Yu, N; Joshi, N; Koyfman, S; Xia, P [Cleveland Clinic, Cleveland, OH (United States); Lin, S [Cleveland State University, Cleveland, OH (United States)


    Purpose: To dosimetrically evaluate the importance of timely reviewing daily CBCTs for patients with head and neck cancer. Methods: After each fraction daily cone-beam CT (CBCT) for head and neck patients are reviewed by physicians prior to next treatment. Physician rejected image registrations of CBCT were identified and analyzed for 17 patients. These CBCT images were rigidly fused with planning CT images and the contours from the planning CT were transferred to CBCTs. Because of limited extension in the superior-inferior dimension contours with partial volumes in CBCTs were discarded. The treatment isocenter was placed by applying the clinically recorded shifts to the volume isocenter of the CBCT. Dose was recalculated at the shifted isocenter using a homogeneous dose calculation algorithm. Dosimetrically relevant changes defined as greater than 5% deviation from the clinically accepted plans but with homogeneous dose calculation were evaluated for the high dose (HD), intermediate dose (ID), and low dose (LD) CTVs, spinal cord, larynx, oropharynx, parotids, and submandibular glands. Results: Among seventeen rejected CBCTS, HD-CTVs, ID-CTVs, and LD-CTVs were completely included in the CBCTs for 17, 1, and 15 patients, respectively. The prescription doses to the HD-CTV, ID-CTV, and LD-CTV were received by < 95% of the CTV volumes in 5/17, 1/1, and 5/15 patients respectively. For the spinal cord, the maximum doses (D0.03cc) were increased > 5% in 13 of 17 patients. For the oropharynx, larynx, parotid, and submandibular glands, the mean dose of these organs at risk was increased > 5% in 7/17, 8/12, 11/16 and 6/16 patients, respectively. Conclusion: Timely review daily CBCTs for head and neck patients under daily CBCT guidance is important, and uncorrected setup errors can translate to dosimetrically relevant dose increases in organsat- risk and dose decreases in the clinical target volumes.

  12. 2-(2,4-Dichlorophenyl-N-(1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-ylacetamide

    Directory of Open Access Journals (Sweden)

    B. Narayana


    Full Text Available In the crystal structure of the title compound, C19H17Cl2N3O2, the molecules form dimers of the R22(10 type through N—H...O hydrogen bonding. As a result of steric repulsion, the amide group is rotated with respect to both the dichlorophenyl and 2,3-dihydro-1H-pyrazol-4-yl rings, making dihedral angles of 80.70 (13 and 64.82 (12°, respectively. The dihedral angle between the dichlorophenyl and 2,3-dihydro-1H-pyrazol-4-yl rings is 48.45 (5° while that between the 2,3-dihydro-1H-pyrazol-4-yl and phenyl rings is 56.33 (6°.

  13. SU-F-J-224: Impact of 4D PET/CT On PERCIST Classification of Lung and Liver Metastases in NSLC and Colorectal Cancer

    International Nuclear Information System (INIS)

    Meier, J; Lopez, B; Mawlawi, O


    Purpose: To quantify the impact of 4D PET/CT on PERCIST metrics in lung and liver tumors in NSCLC and colorectal cancer patients. Methods: 32 patients presenting lung or liver tumors of 1–3 cm size affected by respiratory motion were scanned on a GE Discovery 690 PET/CT. The bed position with lesion(s) affected by motion was acquired in a 12 minute PET LIST mode and unlisted into 8 bins with respiratory gating. Three different CT maps were used for attenuation correction: a clinical helical CT (CT_clin), an average CT (CT_ave), and an 8-phase 4D CINE CT (CT_cine). All reconstructions were 3D OSEM, 2 iterations, 24 subsets, 6.4 Gaussian filtration, 192×192 matrix, non-TOF, and non-PSF. Reconstructions using CT_clin and CT_ave used only 3 out of the 12 minutes of the data (clinical protocol); all 12 minutes were used for the CT_cine reconstruction. The percent change of SUVbw_peak and SUVbw_max was calculated between PET_CTclin and PET_CTave. The same percent change was also calculated between PET_CTclin and PET_CTcine in each of the 8 bins and in the average of all bins. A 30% difference from PET_CTclin classified lesions as progressive metabolic disease (PMD) using maximum bin value and the average of eight bin values. Results: 30 lesions in 25 patients were evaluated. Using the bin with maximum SUVbw_peak and SUVbw_max difference, 4 and 13 lesions were classified as PMD, respectively. Using the average bin values for SUVbw_peak and SUVbw_max, 3 and 6 lesions were classified as PMD, respectively. Using PET_CTave values for SUVbw_peak and SUVbw_max, 4 and 3 lesions were classified as PMD, respectively. Conclusion: These results suggest that response evaluation in 4D PET/CT is dependent on SUV measurement (SUVpeak vs. SUVmax), number of bins (single or average), and the CT map used for attenuation correction.

  14. Isothermal Vapour-Liquid Equilibria in the Binary and Ternary Systems Composed of 2,2,4-Trimethylpentane, 2-Methyl-1-Propanol, and 4-Methyl-2-Pentanone

    Czech Academy of Sciences Publication Activity Database

    Bernatová, Svatoslava; Pavlíček, Jan; Wichterle, Ivan


    Roč. 307, č. 1 (2011), s. 66-71 ISSN 0378-3812 R&D Projects: GA ČR GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapor-liquid equilibrium * experimental data * prediction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.139, year: 2011

  15. Isothermal Vapour-Liquid Equilibria in the Binary and Ternary Systems Composed of 2-Propanol, 3-Methyl-2-Butanone and 2,2,4-Trimethylpentane.

    Czech Academy of Sciences Publication Activity Database

    Psutka, Štěpán; Wichterle, Ivan


    Roč. 264, 1-2 (2008) , s. 55-61 ISSN 0378-3812 R&D Projects: GA ČR(CZ) GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapour–liquid equilibrium * experimental data * prediction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.699, year: 2008

  16. Isothermal (Vapour + Liquid) Equilibria in the Binary and Ternary Systems Composed of 2-Propanol, 2,2,4-Trimethylpentane and 2,4-Dimethyl-3-Pentanone

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, Jan; Wichterle, Ivan


    Roč. 45, č. 1 (2012), s. 83-89 ISSN 0021-9614 R&D Projects: GA ČR GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol * ketone * hydrocarbon Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.297, year: 2012

  17. Governmental Decree No. 224/1997 of 13 August 1997 on fees levied on nuclear waste producers and on the transfer of such fees to the Nuclear Account

    International Nuclear Information System (INIS)


    Nuclear power plants are obliged to pay a fee of CZK 50 per MWe produced. This amount is transferred to the Nuclear Account. The fee return is filed with the Czech Radioactive Repositories Administration. Minor radioactive waste producers only pay the radioactive waste storage cost; this sum is also transferred to the Nuclear Account. Each entity applying with the State Office for Nuclear Safety for a licence regarding activities which are associated with the production of radioactive wastes shall register with the Radioactive Repositories Administration as a prospective radioactive waste producer. (P.A.)

  18. Florence Nightingale at First Hand Lynn McDonald Florence Nightingale at First Hand Continuum UK £14.99 224pp 9781441132550 9781441132550 [Formula: see text]. (United States)


    WRITINGS ON Florence nightingale offer two contrasting views of her life. the first is that she was a formidable and highly influential woman, with enlightened views about disease prevention, the care of sick people and the role of professionally trained nurses. the alternative view is that she was a flawed Victorian hero, who enjoyed celebrity status in her lifetime but whose achievements were overestimated.

  19. Authorization for change in operating standards, 221 and 224 Building, pertaining to process changes during the period March 1, 1951--December 1, 1952

    Energy Technology Data Exchange (ETDEWEB)

    Bailor, W.C.


    Since the issuance of HW-17398, Separations Section Operating Standards - Part I relating to the Bismuth Phosphate Process on March 1, 1951, several changes in the process have been found desirable and have been reduced to practice. This document presents these changes.

  20. (2RS-2-(2,4-Difluorophenyl-1-[(4-iodobenzyl(methylamino]-3-(1H-1,2,4-triazol-1-ylpropan-2-ol

    Directory of Open Access Journals (Sweden)

    Hui-Ping Xiong


    Full Text Available In the title compound (common name: iodiconazole, C19H19F2IN4O, there is an intramolecular O—H...N hydrogen bond and molecules are linked by weak interactions only, namely C—H...N, C—H...O and C—H...F hydrogen bonds, and π-electron ring–π-electron ring interactions between the triazole rings with centroid–centroid distances of 3.725 (3 Å.

  1. Phenotype-gene: 30 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 30 decreased density of decreased density of chlorophyll AT3G19040

  2. Phenotype-gene: 32 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 32 decreased density of chloroph...b/SciNetS_ria224i/cria224u4ria224u16262716i decreased density of chlorophyll AT5G56860

  3. Phenotype-gene: 29 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 29 decreased density of decreased density of chlorophyll AT1G78600

  4. Phenotype-gene: 553 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 553 non-functional obsolete non-functional obsolete microgametophyte AT4G17730

  5. Phenotype-gene: 580 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 580 non-functional stomatal movement...db/SciNetS_ria224i/cria224u4ria224u16990135i non-functional stomatal movement AT1G52400

  6. Phenotype-gene: 31 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 31 decreased density of chloroph...iNetS_ria224i/cria224u4ria224u15659096i decreased density of chlorophyll AT5G35220

  7. Isothermal Vapour-Liquid Equilibrium in the Binary tert-Butanol or 2,2,4-Trimethylpentane + 1-tert-Butoxy-2-Propanol, and in the Ternary tert-Butanol + 2,2,4-Trimethylpentane + 1-tert-Butoxy-2-Propanol Systems

    Czech Academy of Sciences Publication Activity Database

    Bernatová, Svatoslava; Wichterle, Ivan


    Roč. 189, 1-2 (2001), s. 111-118 ISSN 0378-3812 R&D Projects: GA ČR GA104/99/0136 Institutional research plan: CEZ:AV0Z4072921 Keywords : vapour-liquid equilibrium * experimental data * molar excess volume Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001

  8. An extraction method of uranium 233 from the thorium irradiates in a reactor core

    International Nuclear Information System (INIS)

    Chesne, A.; Regnaut, P.


    Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [fr

  9. Molten salt reactors: chemistry

    International Nuclear Information System (INIS)


    This work is a critical analysis of the 1000 MW MSBR project. Behavior of rare gases in the primary coolant circuit, their extraction from helium. Coating of graphite by molybdenum, chemistry of protactinium and niobium produced in the molten salt, continuous reprocessing of the fuel salt and use of stainless steel instead of hastelloy are reviewed [fr

  10. Feasibility studies of thermonuclear neutron capture synthesis of SHE

    International Nuclear Information System (INIS)

    Meldner, H.W.


    A variety of thermonuclear neutron sources and neutron capture targets were investigated for their potential of allowing signigicant production of heavy, perhaps superheavy, isotopes. The neutron sources considered range from inertial confinement microexplosives to (underground) macroexplosives. Optimal capture targets appear to be composites containing uranium and protactinium. 1 figure


    Chiotti, P.


    A process of regenerating a magnesium-thorium alloy contaminated with fission products, protactinium, and uranium is presented. A molten mixture of KCl--LiCl-MgCl/sub 2/ is added to the molten alloy whereby the alkali, alkaline parth, and rare earth fission products (including yttrium) and some of the thorium and uranium are chlorinated and

  12. Phenotype-gene: 509 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 509 lethal (sensu gen...ant J. 42(5):720-30. lethal (sensu genet

  13. Phenotype-gene: 743 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 743 abnormal for trait of behavior...a224i/cria224u4ria224u17376810i abnormal for trait of behavioral quality in organ

  14. Phenotype-gene: 754 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 754 abnormal for trait of behavior..._ria224i/cria224u4ria224u17139246i abnormal for trait of behavioral quality in or

  15. Phenotype-gene: 753 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 753 abnormal for trait of abnormal for trait of behavior

  16. Phenotype-gene: 789 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 789 abnormal for trait of morph...-24. abnormal for trait of morphology in

  17. Phenotype-gene: 776 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 776 abnormal for trait of morph...-22. abnormal for trait of morphology in

  18. Phenotype-gene: 767 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 767 abnormal for trait of morph...):627-37. abnormal for trait of morpholo

  19. Phenotype-gene: 797 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 797 abnormal for trait of morph...):591-603. abnormal for trait of morphol

  20. Phenotype-gene: 33 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 33 decreased density of chloroph...041-52. decreased density of chlorophyll

  1. Phenotype-gene: 779 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 779 abnormal for trait of morph...2-93. abnormal for trait of morphology i

  2. Phenotype-gene: 791 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 791 abnormal for trait of morph...):272-84. abnormal for trait of morpholo

  3. Phenotype-gene: 798 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 798 abnormal for trait of morph...-66. abnormal for trait of morphology in

  4. Phenotype-gene: 505 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 505 kinked for trait of morph...66. kinked for trait of morphology in or

  5. Phenotype-gene: 558 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 558 non-functional ph...73-85. non-functional phloem or xylem hi

  6. Phenotype-gene: 768 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 768 abnormal for trait of morph...p:// abnormal for trait of morphology in organ n

  7. Phenotype-gene: 499 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 499 insufficient for quantity of chloroph... 16(12):3400-12. insufficient for quantity of chloroph

  8. Phenotype-gene: 790 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 790 abnormal for trait of morph...93. abnormal for trait of morphology in

  9. Phenotype-gene: 795 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 795 abnormal for trait of morph...:353-66. abnormal for trait of morpholog

  10. Phenotype-gene: 792 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 792 abnormal for trait of morph...2):3548-63. abnormal for trait of morpho

  11. Phenotype-gene: 778 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 778 abnormal for trait of morph...:282-4. abnormal for trait of morphology

  12. Phenotype-gene: 762 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 762 abnormal for trait of morph...:1467-81. abnormal for trait of morpholo

  13. Phenotype-gene: 773 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 773 abnormal for trait of morph...-80. abnormal for trait of morphology in

  14. Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 270 elongated hypocotyl in environment... of light regimen in environment of light regimen hypocotyl ... elongated ...

  15. Phenotype abnormality: 404 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 404 involute hypocotyl in environment... of red light regimen in environment of red light regimen hypocotyl ... involute ...

  16. Phenotype-gene: 494 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 494 inpaired stomatal movement... inpaired stomatal movement in presence

  17. Phenotype-gene: 475 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 475 increased sensitivity under influence...// increased sensitivity under influence of lead

  18. Phenotype-gene: 461 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 461 increased responsivity under influence...-66. increased responsivity under influence

  19. Phenotype-gene: 190 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 190 decreased responsivity under influence...:471-81. decreased responsivity under influence

  20. Phenotype-gene: 196 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 196 decreased sensitivity under influence... decreased sensitivity under influence o

  1. Phenotype-gene: 455 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 455 increased resistance under influence...1853-60. increased resistance under influence

  2. Phenotype-gene: 456 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 456 increased resistance under influence...80. increased resistance under influence

  3. Phenotype-gene: 457 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 457 increased resistance under influence... increased resistance under influence of

  4. Phenotype-gene: 788 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 788 abnormal for trait of morph...9. abnormal for trait of morphology in o

  5. Phenotype-gene: 775 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 775 abnormal for trait of morph...-22. abnormal for trait of morphology in

  6. CCDC 886753: Experimental Crystal Structure Determination : 2-(2-(4-Chlorophenyl)-5-oxo-2,5-dihydrofuran-2-yl)-1-(2-oxo-1,3-oxazolidin-3-yl)-4-phenylbutane-1,4-dione

    KAUST Repository

    Zhang, Wen; Tan, Davin; Lee, R.; Tong, Guanghu; Chen, Wenchao; Qi, Baojian; Huang, Kuo-Wei; Tan, Choon-Hong; Jiang, Zhiyong


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  7. Antitumor activity of JS-K [O2-(2,4-dinitrophenyl) 1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate] and related O2-aryl diazeniumdiolates in vitro and in vivo. (United States)

    Shami, Paul J; Saavedra, Joseph E; Bonifant, Challice L; Chu, Jingxi; Udupi, Vidya; Malaviya, Swati; Carr, Brian I; Kar, Siddhartha; Wang, Meifeng; Jia, Lee; Ji, Xinhua; Keefer, Larry K


    The literature provides evidence that metabolic nitric oxide (NO) release mediates the cytotoxic activities (against human leukemia and prostate cancer xenografts in mice) of JS-K, a compound of structure R(2)N-N(O)=NO-Ar for which R(2)N is 4-(ethoxycarbonyl)piperazin-1-yl and Ar is 2,4-dinitrophenyl. Here we present comparative data on the potencies of JS-K and 41 other O(2)-arylated diazeniumdiolates as inhibitors of HL-60 human leukemia cell proliferation, as well as in the NCI 51-cell-line screen for six of them. The data show JS-K to be the most potent of the 42 in both screens and suggest that other features of its structure and metabolism besides NO release may contribute importantly to its activity. Results with control compounds implicate JS-K's arylating ability, and the surprisingly low IC(50) value of the N-(ethoxycarbonyl)piperazine byproduct of NO release suggests a role for the R(2)N moiety. In addition to the above-mentioned in vivo activities, JS-K is shown here to be carcinostatic in a rat liver cancer model.

  8. Synthesis, coordination and biological aspects of organotin(IV derivatives of 4-[(2,4-dinitrophenylamino]-4-oxo-2-butenoic acid and 2-{[(2,4-dinitrophenylamino]carbonyl}benzoic acid

    Directory of Open Access Journals (Sweden)



    Full Text Available New series of organotin(IV complexes of aniline derivatives, R2SnL2 and R3SnL [where R = Me, n-Bu, Ph, n-Oct] have been synthesized by the reaction of HL1 and HL2 with respective organotin halides or oxides. Experimental details for the preparation and characterization (including elemental analysis, IR and multinuclear NMR (1H-, 13C- and 119Sn- spectra in CDCl3 and EI mass spectra of both series are provided. The binding sites of the ligands were identified by means of FTIR spectroscopic measurements. It was found that in all cases the organotin(IV moiety reacts with the oxygen of COO– group to form new complexes. In the diorganotin complexes, the COO– group is coordinated to the organotin(IV centres in a bidentate manner in the solid state. The 119Sn NMR data and the nJ(13C‑119/117Sn coupling constant support the tetrahedral coordination geometry of the organotin complexes in non-coordinating solvents. Biological activities (antibacterial, antifungal, cytotoxicity, antileishmanial and insecticidal of these compounds are also reported.

  9. Book Review: The future of spacetime. Stephen William Hawking (ed.); Kip S. Thorne, Igor Novikov, Timothy Ferris, Alan Lightman, and Richard Price, W.W. Norton & Company, 2002, 224 pp., US 25.95, ISBN 0393020223 (United States)

    Smeenk, Chris


    The study of Einstein's theory of general relativity experienced a renaissance beginning in the early 1960s. Prior to this resurgence of interest, general relativity was isolated from mainstream physics-admired for its elegance, perhaps, but only from a distance. The generation of students who risked their careers by entering this neglected field has now reached the age of festschrifts. In June of 2000, Caltech hosted ;Kipfest,; a conference in honor of Kip Thorne's 60th birthday. Thorne started graduate school at Princeton in 1962 and began research in general relativity under John Wheeler's guidance in the heady early days of the renaissance. Since then, he has played a prominent role in general relativity: as co-author of the influential textbook Gravitation, as a leader in research regarding astrophysical applications of Einstein's theory, and as a co-founder and chief advocate for the Laser Interferometer Gravitational Wave Observatory (LIGO), to mention a few aspects of his far-reaching work. ;Kipfest; included 14 speakers discussing fields to which Thorne has contributed. But the conference also reflected Thorne's long-standing commitment to communicating science to a general audience: Igor Novikov, Stephen Hawking, Timothy Ferris, and Alan Lightman gave popular talks at ;Kipfest,; with Thorne himself tricked into delivering a fifth. The Future of Spacetime gathers adaptations of these five lectures, along with a lengthy introductory essay by Richard Price.

  10. Keystone Symposia "ncRNAs in Development and Cancer", Vancouver, Canada: Increased release of exosomes and export of invasion-modulating miRNAs miR921, -23b, -and -224 from metastatic urothelial carcinoma cells

    DEFF Research Database (Denmark)

    Ostenfeld, Marie Stampe; Jeppesen, Dennis Kjølhede; Laurberg, Jens Reumert


    Cancer cells secrete soluble factors and various extracellular vesicles, including exosomes, into their tissue microenvironment. The secretion of exosomes is speculated to facilitate local invasion and increase the propensity of tumors to form distant metastases. Here we present a characterization...... of exosome vesicles from isogenic urothelial carcinoma cell lines, with different metastatic propensity by western blotting, electron microscopy, nanoparticle tracking analysis, dynamic light scattering, and profiling of 671 miRNAs by qRT-PCR. An increase in the number of multivesicular bodies and exosomes...... was observed for metastatic FL3 cells compared to isogenic non-metastatic T24 cells. The release was significantly inhibited by knockdown of Rab27b and pharmacological inhibition of nsmase2 by GW4869. miRNA profiling was conducted on parental cells and their secreted exosomes. Here, selective export of miR921...

  11. The Marine Light-Mixed Layer Experiment Cruise and Data Report: R/V Endeavor Cruise EN-224, Mooring Deployment, 27 April-1 May 1991: Cruise EN-227, Mooring Recovery, 5-23 September 1991 (United States)


    C 1/2 time average Thermometrics Measured during first 4K@ 250 C half of avg. period. Air Temperature Thermistor -10 to +350 C 1/2 time average...lack of a neoprene pad oil the bottom mounting bracket base plate, allowing tLe aluminum case to directly touch the bracket. The mooring 3 hardware

  12. Volumetric Behavior of the Ternary System Benzene – 2-Methoxy-2-Methylbutane – 2,2,4-Trimethylpentane and All Binary Sub-Systems at Temperature Range (298.15 – 318.15) K

    Czech Academy of Sciences Publication Activity Database

    Houšková, Hana; Morávková, Lenka; Sedláková, Zuzana; Boublík, T.; Kolská, Z.


    Roč. 337, JAN 15 (2013), s. 156-164 ISSN 0378-3812 Grant - others:GA ČR(CZ) GAP108/10/1106 Program:GA Institutional support: RVO:67985858 Keywords : vibrating-tube densimeter * excess molar volume * Peng–Robinson equation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  13. Volumetric Behaviour of the (2,2,4-Trimethylpentane + Methylbenzene + Butan-1-ol) Ternary System and Its Binary Sub-Systems within the Temperature Range (298.15–328.15) K

    Czech Academy of Sciences Publication Activity Database

    Morávková, Lenka; Troncoso, J.; Machanová, Karolina; Sedláková, Zuzana


    Roč. 64, SEP 2013 (2013), s. 137-150 ISSN 0021-9614 R&D Projects: GA ČR GAP106/10/1194 Grant - others:MŠMT(CZ) CZ.1.05/2.1.00/03.0071; UV(IT) CN2012/227; UV(IT) 11VIA16 Institutional support: RVO:67985858 Keywords : excess molar volume * density * ERAS model Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.423, year: 2013

  14. Design and synthesis of new hybrids from 2-cyano-3,12-dioxooleana- 9-dien-28-oic acid and O2-(2,4-dinitrophenyl) diazeniumdiolate for intervention of drug-resistant lung cancer. (United States)

    Kang, Fenghua; Ai, Yong; Zhang, Yihua; Huang, Zhangjian


    To search for new drugs for intervention of drug-resistant lung cancer, a series of hybrids 4-15 from 2-cyano-3,12-dioxooleana-9-dien-28-oic acid (CDDO) and O 2 -(2,4-dinitrophenyl) diazeniumdiolate were designed, synthesized and biologically evaluated. The most active compound 7 produced relatively high levels of nitric oxide (NO) and reactive oxygen species (ROS) in drug-resistant lung cancer A549/Taxol cells which over-express glutathione S-transferase π (GSTπ), and significantly inhibited the cells' proliferation (IC 50  = 0.349 ± 0.051 μM), superior to the positive controls CDDO-Me, JS-K and Taxol. The inhibitory activity of 7 could be attenuated by an NO scavenger, ROS scavenger or GSTπ inhibitor. In addition, 7 suppressed the Lon protease expression as well as induced cell apoptosis and cycle arrest in A549/Taxol cells more strongly than CDDO-Me or JS-K. Together, our findings suggest that 7 may be worth studying further for intervention of drug-resistant lung cancer. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  15. (2RS)-2-(2,4-Difluoro-phen-yl)-1-[(4-iodo-benz-yl)(meth-yl)amino]-3-(1H-1,2,4-tri-azol-1-yl)propan-2-ol. (United States)

    Xiong, Hui-Ping; Gao, Shou-Hong; Li, Chun-Tong; Wu, Zhi-Jun


    IN THE TITLE COMPOUND (COMMON NAME: iodiconazole), C(19)H(19)F(2)IN(4)O, there is an intra-molecular O-H⋯N hydrogen bond and mol-ecules are linked by weak inter-actions only, namely C-H⋯N, C-H⋯O and C-H⋯F hydrogen bonds, and π-electron ring-π-electron ring inter-actions between the triazole rings with centroid-centroid distances of 3.725 (3) Å.

  16. Phenotype-gene: 562 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 562 non-functional response to non-functional response to gravity AT1G54990

  17. Phenotype-gene: 533 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 533 low sensitivity toward under influence...nsitivity toward under influence of 1-chloro-2,4-dinitrobenzene AT2G34660 ...Plant Cell Physiol. 49(4):557-69. low se

  18. An extraction method of uranium 233 from the thorium irradiates in a reactor core; Une methode d'extraction de l'uranium-233 a partir du thorium irradie dans une pile

    Energy Technology Data Exchange (ETDEWEB)

    Chesne, A; Regnaut, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [French] Description des conditions de separation du thorium, de l'uranium 233 et du protactinium 233 en solution chlorhydrique par absorption puis elution selective sur resine echangeuse d'anions. Une precipitation du thoriun par l'acide oxalique permet la recuperation de l'acide chlorhydrique qui est recycle, la principale matiere premiere consommee etant l'acide oxalique. (auteurs)

  19. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira


    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  20. Phenotype abnormality: 46 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 46 abnormal for trait of behavior.../cria224u2ria224u38i stomatal complex ... abnormal ... response to light stimulus ... behavioral quality

  1. Phenotype-gene: 741 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 741 abnormal for trait of behavior...ria224u4ria224u15986216i abnormal for trait of behavioral quality in organ named

  2. Phenotype-gene: 747 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 747 abnormal for trait of behavior...4i/cria224u4ria224u12837954i abnormal for trait of behavioral quality in organ na

  3. Phenotype-gene: 755 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 755 abnormal for trait of behavior...ria224u4ria224u17148695i abnormal for trait of behavioral quality in organ named

  4. Determination of thorium in native gold by radiochemical neutron activation analysis

    International Nuclear Information System (INIS)

    Liu, Y.; Kraehenbuehl, U.


    Thorium concentrations in 11 native gold samples from different sources, e.g. placer gold, vein and lode gold were determined. Thorium was determined by radiochemical separation and measurement of protactinium from irradiated native gold samples. The chemical yield of the separation procedures is 90%. Other elements were measured by gamma-ray spectroscopy. The radiochemical separation procedures described in this work make accurate determination of Th concentrations in native gold at picogram concentrations possible. (orig.)

  5. The actinides

    International Nuclear Information System (INIS)

    Bagnall, K.W.


    This chapter of coordination compound chemistry is devoted to the actinides and starts with a general survey. Most of the chapter relates to thorium and uranium but protactinium, neptunium and plutonium are included. There are sections on nitrogen, phosphorus, sulfur, selenium, tellurium and halogen ligands of the metals in their +3, +4, +5 and +6 oxidation states and of the transplutonium elements in their +2, +3, +4, and +5 oxidation states. (UK)

  6. Gas-Phase Energetics of Actinide Oxides: An Assessment of Neutral and Cationic Monoxides and Dioxides from Thorium to Curium (United States)

    Marçalo, Joaquim; Gibson, John K.


    An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.

  7. The f electron collapse revisited

    International Nuclear Information System (INIS)

    Bennett, B.I.


    A reexamination of the collapse of 4f and 5f electrons in the lanthanide and actinide series is presented. The calculations show the well-known collapse of the f electron density at the thresholds of these series along with an f 2 collapse between thorium and protactinium. The collapse is sensitive to the choice of model for the exchange-correlation potential and the behavior of the potential at large radius

  8. Phenotype abnormality: 311 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 311 increased efficiency during process... named seed dormancy process ... increased efficiency ... seed dormancy process ...

  9. Phenotype abnormality: 135 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 135 decreased efficiency during process... named seed dormancy process ... decreased efficiency ... seed dormancy process ...

  10. Phenotype abnormality: 213 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 213 decreased sensitivity toward under influ...ence of brassinosteroid ... decreased sensitivity toward ... brassinosteroid ...

  11. Phenotype abnormality: 236 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 236 decreased susceptibility... in response to organism Agrobacterium ... Agrobacterium ... decreased susceptibility toward ...

  12. Phenotype-gene: 525 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 525 lethal (sensu gen...Sci. U.S.A. 101(20):7821-6. lethal (sensu gen

  13. Phenotype-gene: 746 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 746 abnormal for trait of behavior...t al. 2005 Feb. Plant J. 41(3):364-75. abnormal for trait of beha...vioral quality in organ named hypocotyl during process n

  14. Phenotype-gene: 736 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 736 abnormal for trait of behavior...eb. Science 307(5712):1111-3. abnormal for trait of behavior

  15. Phenotype-gene: 737 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 737 abnormal for trait of behavior...c. EMBO J. 25(24):5907-18. abnormal for trait of behavior

  16. Phenotype-gene: 735 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 735 abnormal for trait of behavior...t Physiol. 142(2):564-73. abnormal for trait of behavior

  17. Phenotype-gene: 777 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 777 abnormal for trait of morph...ology in organ named root for AT5G60920 ... abnormal for trait of morphology in organ named root AT5G60920

  18. Phenotype-gene: 794 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 794 abnormal for trait of morph...ology in organ named vascular leaf for AT2G44950 Fleury Delphine et al. 2007 Feb. Plant Cell 19(...2):417-32. abnormal for trait of morphol

  19. Phenotype-gene: 769 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 769 abnormal for trait of morph...ology in organ named inflorescence for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. abnormal for trait of morphol

  20. Phenotype-gene: 785 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 785 abnormal for trait of morph...U.S.A. 103(17):6759-64. abnormal for trait of morph

  1. Phenotype-gene: 766 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 766 abnormal for trait of morph...i. U.S.A. 104(47):18836-41. abnormal for trait of morph

  2. Phenotype-gene: 787 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 787 abnormal for trait of morph...03 Jul. Plant Cell 15(7):1632-45. abnormal for trait of morph

  3. Phenotype-gene: 763 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 763 abnormal for trait of morph.... U.S.A. 103(17):6759-64. abnormal for trait of morph

  4. Phenotype-gene: 770 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 770 abnormal for trait of morph...ology in organ named inflorescence for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. abnormal for trait of morphol

  5. Phenotype-gene: 771 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 771 abnormal for trait of morph...ology in organ named leaf lamina for AT1G55250 Fleury Delphine et al. 2007 Feb. Plant Cell 19(2)...:417-32. abnormal for trait of morpholog

  6. Phenotype-gene: 772 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 772 abnormal for trait of morph...ology in organ named leaf lamina for AT1G55255 Fleury Delphine et al. 2007 Feb. Plant Cell 19(2)...:417-32. abnormal for trait of morpholog

  7. Phenotype abnormality: 403 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 403 involute hypocotyl in environment... of far red light regimen in environment of far red light regimen hypocotyl ... involute ...

  8. Phenotype-gene: 57 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available iency during process named polyploidization for AT5G08550 Yoshizumi Takeshi et al. 2006 Oct. Plant Cell 18(1...0):2452-68. decreased efficiency during process named polyploidiz...ation AT5G08550

  9. Phenotype-gene: 796 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 796 abnormal for trait of morph...ology in organ named vascular leaf for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. abnormal for trait of morphol

  10. Phenotype-gene: 786 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 786 abnormal for trait of morph...03 Jul. Plant Cell 15(7):1632-45. abnormal for trait of morph

  11. Phenotype-gene: 793 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 793 abnormal for trait of morph...ology in organ named vascular leaf for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. abnormal for trait of morphol

  12. Phenotype-gene: 752 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 752 abnormal for trait of behavior...a224u16055636i abnormal for trait of behavioral quality in organ named stamen dur

  13. Phenotype-gene: 742 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 742 abnormal for trait of behavior...ia224u16299182i abnormal for trait of behavioral quality in organ named cotyledon

  14. Phenotype-gene: 744 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 744 abnormal for trait of behavior...a224u16055636i abnormal for trait of behavioral quality in organ named flower dur


    International Nuclear Information System (INIS)

    HOLDEN, N.E.


    Atomic Mass Evaluations have had a major impact on the values of the atomic weights for the twenty mononuclidic elements plus two elements, Thorium and Protactinium, which have no stable nuclides but a characteristic terrestrial isotopic composition. This paper reviews the history of the atomic weight values of these elements in the years, since the reference mass standard changed from 16 O to 12 C. There is a problem for Thorium, which is considered to have an abundance value of 100%, but is not treated as such in the Standard Atomic Weights' Table. Recommendations for handling the Standard Atomic Weight values for 2001 are presented

  16. The speciation of dissolved elements in aquatic solution. Radium and actinides

    International Nuclear Information System (INIS)

    Haesaenen, E.


    In the publication, the chemistry and speciation of radium, thorium, protactinium, uranium, neptunium, lutonium, americium and curium in ground-water environment is reviewed. Special attention is given to the transuranium elements, which have a central role in the repository of nuclear wastes. The most important methods used in the speciation of these elements is presented. The laser-induced methods, developed in the 1980's, are especially discussed. These have made it possible, e.g., to speciate the transuranium elements in their very low, actual repository ground-water concentrations (10-100 ng/l). (54 refs., 10 figs., 3 tabs.)

  17. Adjustment of a direct method for the determination of man body burden in Pu-239 on by X-ray detection of U-235

    International Nuclear Information System (INIS)

    Boulay, P.


    The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [fr

  18. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.


    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  19. Preparation of uranium-230 as a new uranium tracer

    International Nuclear Information System (INIS)

    Hashimoto, T.; Kido, K.; Sotobayashi, T.


    A uranium isotope, 230 U(T=20.8 d), was produced from the 231 Pa(γ,n) 230 Pa→viaβ - decay 230 U process with a bremsstrahlung irradiation on a protactinium target. After standing for about one month to obtain a maximal growth of 230 U, the uranium was chemically purified, applying an ion-exchange method. The purity of the 230 U obtained was examined with alpha spectrometry and an intrinsic alpha peak due to 230 U as a new uranium tracer in an alpha spectrometric analysis of uranium isotopes is described. (author)


    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas


    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  1. MOX-fuel inherent proliferation-protection due to {sup 231}Pa admixture

    Energy Technology Data Exchange (ETDEWEB)

    Kryuchkov, E.F.; Glebov, V.B.; Apse, V.A.; Shmelev, A.N. [Moscow Engineering Physics Institute (State University), Moscow (Russian Federation)


    The proliferation protection levels of MOX-fuel containing small additions of protactinium are evaluated for equilibrium closed and open cycles of a light-water reactor (LWR).Analysis of the ways to the proliferation protection of MOX-fuel by small {sup 231}Pa addition and comparison of this way with another options for giving MOX-fuel the proliferation self-protection property enable us to make the 3 following conclusions: -1) Unique nature of protactinium as a small addition to MOX-fuel is determined by the following properties: - Protactinium is available in the nature (uranium ore) as a long-lived mono-isotope {sup 231}Pa, - under neutron irradiation, {sup 231}Pa is converted into {sup 232}U, which is a long-term source of high energy gamma-radiation and practically non-separable from main fuel mass, - essentially, {sup 231}Pa is a high-quality burnable neutron absorber. -2) From the proliferation self-protection point of view, nuclear fuel cycle closure with fuel recycle is a preferable option because, under this condition, introduction of protactinium into MOX-fuel allows to create the inherent radiation barrier which is in action during full cycle of fuel management at the level corresponding to the accepted today criterion of the Spent Fuel Standard (SFS). In particular, the considered example of multiple MOX-fuel recycle with small addition of {sup 231}Pa (0.2% HM) at each cycle demonstrates a possibility to reach the proliferation protection level of fresh MOX-fuel corresponding to once irradiated fuel with the same cooling time. In this case, the lethal dose (at 30 cm distance from fuel assembly) is received within the minute range. -3) Introduction of {sup 231}Pa into MOX-fuel composition in amount of 0.5% HM allows to prolong action of the SFS from 100 to 200 years. If {sup 231}Pa content is increased up to 5% HM, then MOX-fuel conserves the proliferation self-protection property in respect to short-term unauthorized actions for 200-year period of its

  2. Phenotype-gene: 774 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ology in organ named obsolete microgametophyte for AT5G11110 Suzuki Toshiya et al. 2008 Oct. Plant Cell Ph... 774 abnormal for trait of morph...ysiol. 49(10):1465-77. abnormal for trait of morph...ology in organ named obsolete microgametophyte AT5G11110

  3. Phenotype-gene: 529 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available onment of soil environment for AT3G62910 Motohashi Reiko et al. 2007 Jul. Plant Mol...nt of soil environment AT3G62910 .... Biol. 64(5):481-97. lethal in organ named seedling in environme... 529 lethal in organ named seedling in envir

  4. Phenotype-gene: 424 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 424 increased number of axillary inflore...scence bud in organ named inflorescence for AT5G15230 Roxrud Ingrid et al. 2007 Mar. P...ed number of axillary inflorescence bud in organ named inflorescence AT5G15230 ...lant Cell Physiol. 48(3):471-83. increas

  5. Phenotype-gene: 781 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 781 abnormal for trait of morph...ology in organ named seed for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3):3616-27.... abnormal for trait of morphology in or

  6. Phenotype-gene: 765 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 765 abnormal for trait of morph...ology in organ named chloroplast for AT5G55280 Yoder David W et al. 2007 Jun. Plant Cell Physiol.... 48(6):775-91. abnormal for trait of morph

  7. Phenotype-gene: 764 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 764 abnormal for trait of morph...ology in organ named chloroplast for AT1G22700 St旦ckel Jana et al. 2006 Jul. Plant Physiol. 141(...3):870-8. abnormal for trait of morpholo

  8. Phenotype-gene: 496 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ward in organ named root under influence of ethene for AT1G25220 Stepanova Anna N et al. 2005 Aug. Plant Cel...luence of ethene AT1G25220 ...l 17(8):2230-42. insensitive toward in organ named root under inf

  9. Phenotype-gene: 498 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ward in organ named root under influence of ethene for AT5G05730 Stepanova Anna N et al. 2005 Aug. Plant Cel...luence of ethene AT5G05730 ...l 17(8):2230-42. insensitive toward in organ named root under inf

  10. Phenotype-gene: 780 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 780 abnormal for trait of morph...ology in organ named seed for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3):3616-27.... abnormal for trait of morphology in or

  11. Erratum: The article „Morphometric analysis of collagen and inflammatory cells in periodontal disease” [Morfometrijska analiza kolagena i inflamatornih ćelija u periodontalnoj bolesti]. Vojnosanit pregl 2015; 72(3: 219-224. (DOI:10.2298/VSP130627076G

    Directory of Open Access Journals (Sweden)



    Full Text Available The authors and their affiliations were listed as follows: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Listed the authors and their affiliations should read as: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; ║Department of Histology, Faculty of Medicine, University of Priština, Kosovska Mitrovica, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Link to the corrected article 10.2298/VSP130627076G

  12. Comment on the paper "Thermoluminescence glow-curve deconvolution functions for mixed order of kinetics and continuous trap distribution by G. Kitis, J.M. Gomez-Ros, Nuclear Instruments and Methods in Physics Research A 440, 2000, pp 224-231" (United States)

    Kazakis, Nikolaos A.


    The present comment concerns the correct presentation of an algorithm proposed in the above paper for the glow-curve deconvolution in the case of continuous distribution of trapping states. Since most researchers would use directly the proposed algorithm as published, they should be notified of its correct formulation during the fitting of TL glow curves of materials with continuous trap distribution using this Equation.

  13. Bis[μ-2-(2,4-difluorophenyl-1,3-bis(1,2,4-triazol-1-ylpropan-2-olato-κ4N2,O:O,N2′]bis[(acetato-κ2O,O′nickel(II] methanol hemisolvate

    Directory of Open Access Journals (Sweden)

    Feng Zhang


    Full Text Available In the title complex, [Ni2(C13H11F2N6O2(C2H3O22]·0.5CH3OH, there are two half-molecules in the asymmetric unit. The two centrosymmetrically related NiII atoms, each attached to an acetate ligand, are linked by two fluconazole ligands. Each NiII atom is six-coordinated in a distorted octahedral geometry by two N atoms of the triazole groups and two bridging O atoms from two different fluconazole ligands and two O atoms from a chelating acetate ligand. In the crystal structure, the half-occupied methanol solvent molecule is linked to a triazole group via an O—H...N hydrogen bond.


    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  15. Adjustment of a direct method for the determination of man body burden in Pu-239 on by X-ray detection of U-235; Mise au point d'une methode directe de determination de la charge corporelle en plutonium 239 chez l'homme par detection X de l'uranium 235

    Energy Technology Data Exchange (ETDEWEB)

    Boulay, P [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes


    The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [French] L'utilisation a une echelle de plus en plus large du plutonium-239 pose un probleme de la mesure de la contamination par aerosol au niveau du poumon. Une methode de mesure directe de la charge pulmonaire en plutonium-239 est possible grace a l'utilisation d'un compteur proportionnel a fenetre de grande surface. Un compteur de ce type a specialement ete realise dans ce but. La mise au point de l'appareillage permet une sensibilite suffisante pour deceler une contamination au niveau de la Q.M.A (quantite maximale admissible). D'autre part, une methode 'd'etalonnage interne' de l'individu a l'aide d'un simulateur de plutonium, le protactinium-233, est decrite. (auteur)

  16. Radioactivity studies. Progress report, January 1-December 31, 1982

    International Nuclear Information System (INIS)

    Cohen, N.


    During the last year, the research program in actinide biokinetics in nonhuman primates has been expanded to include preliminary studies of the element neptunium. Recently, Np-237, which is known to be present in high-level nuclear reactor waste, has received increased attention as a potential long-range hazard to man. In addition to the neptunium studies, the metabolism of protactinium-233, the daughter of Np-237, has been investigated. Although characterization of Pa-233 metabolism was originally conducted in order to correct for Pa-233 interference during in vivo and in vitro gamma spectrometry of Np-237, several other considerations indicated that Pa might be of radiological concern itself and should thereby warrant further investigation. Due to the limited amount of data in the literature defining the biokinetics of both neptunium and protactinium, metabolis studies of these nuclides are now being conducted in adult female baboons in a manner similar to that which has been successfully performed at this laboratory for Am-241 and Cm-243,244. Procedures routinely performed include external whole-body counting, excreta collection (separation and measurement), blood sampling, biopsies of liver and bone, and complete tissue and organ analysis after sacrifice

  17. Phenotype-gene: 757 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ait of behavioral quality in organ named whole plant during process named photomorphogenesis for AT2G36910 Rongcheng et al. 2005 Jun. Plant Physiol. 138(2):949-64. plant during process named photomorphogenesis AT2G36910

  18. Phenotype-gene: 758 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ait of behavioral quality in organ named whole plant during process named photomorphogenesis for AT3G28860 Rongcheng et al. 2005 Jun. Plant Physiol. 138(2):949-64. plant during process named photomorphogenesis AT3G28860

  19. ORF Alignment: NC_002163 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. Phenotype-gene: 203 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available in organ named epidermal pavement cell in organ named vascular leaf for AT5G24630 Kirik Viktor et al. 2007 ...d size in organ named epidermal pavement cell in organ named vascular leaf AT5G24630

  2. Reference: 693 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 693 Garcia Mar...nzyme MurE has an essential role in chloroplast development. 6 924-34 18036201 2008 Mar The Plant journal Garcia

  3. Phenotype-gene: 751 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 751 abnormal for trait of behavior...4u15908594i abnormal for trait of behavioral quality in organ named root during p

  4. Phenotype-gene: 748 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 748 abnormal for trait of behavior...7472i abnormal for trait of behavioral quality in organ named root during process

  5. Phenotype abnormality: 31 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 31 abnormal for trait of quality during process named localization of cell ... abnormal ... behavioral quality

  6. Phenotype abnormality: 44 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 44 abnormal for trait of quality in organ named root during process named organ development ... root ... abnormal ... organ development ... behavioral quality

  7. Phenotype abnormality: 45 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 45 abnormal for trait of quality in organ named stamen during process named organ development ... stamen ... abnormal ... organ development ... behavioral quality

  8. Phenotype abnormality: 37 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 37 abnormal for trait of quality in organ named cotyledon during process named organ development ... cotyledon ... abnormal ... organ development ... behavioral quality

  9. Phenotype-gene: 745 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 745 abnormal for trait of behavior...u18047472i abnormal for trait of behavioral quality in organ named hypocotyl duri

  10. Phenotype-gene: 739 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 739 abnormal for trait of quality during process named response to cytokinin stimulus for AT4G16420 ... abnormal for trait of behavior

  11. Phenotype abnormality: 47 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 47 abnormal for trait of quality in organ named thylakoid membrane during process named thylakoid membrane organization ... abnormal ... behavioral quality

  12. Phenotype abnormality: 39 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 39 abnormal for trait of quality in organ named flower during process named organ development ... flower ... abnormal ... organ development ... behavioral quality

  13. Phenotype-gene: 756 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 756 abnormal for trait of behavior...73454i abnormal for trait of behavioral quality in organ named whole plant during

  14. Phenotype-gene: 738 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 738 abnormal for trait of quality during process named response to auxin stimulus for AT4G16420 ... abnormal for trait of behavior

  15. Phenotype abnormality: 49 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 49 abnormal for trait of quality in organ named whole plant during process named cell growth ... whole plant ... abnormal ... cell growth ... behavioral quality

  16. Phenotype-gene: 749 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 749 abnormal for trait of quality in organ named root during process named growth for AT5G60920 ... abnormal for trait of behavior

  17. Phenotype-gene: 750 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 750 abnormal for trait of behavior...4u15908594i abnormal for trait of behavioral quality in organ named root during p

  18. Phenotype abnormality: 48 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 48 abnormal for trait of quality in organ named vascular leaf during process named organ development ... vascular leaf ... abnormal ... organ development ... behavioral quality

  19. Phenotype abnormality: 33 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 33 abnormal for trait of quality during process named response to auxin stimulus ... abnormal ... behavioral quality

  20. Phenotype abnormality: 42 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 42 abnormal for trait of quality in organ named root during process named gravitropism ... root ... abnormal ... behavioral quality

  1. Phenotype abnormality: 283 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 283 impaired in named whole plant during process named vernalization response ... whole plant ... impaired ...

  2. Reference: 359 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 359 Cnops Gerda...leaf development in Arabidopsis thaliana. 4 852-66 16531491 2006 Apr The Plant cell Azmi Abdelkrim|Cnops Gerda

  3. Phenotype-gene: 782 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 782 abnormal for trait of morph...ology in organ named seedling for AT2G19760 ... abnormal for trait of morphology in organ named se

  4. Phenotype-gene: 783 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 783 abnormal for trait of morph...ology in organ named seedling for AT5G49720 ... abnormal for trait of morphology in organ named se

  5. Phenotype-gene: 188 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available stance in response to organism Plectosphaerella cucumerina for AT1G59870 Stein M坦nica et al. 2006 Mar. Plant... in response to organism Plectosphaerella cucumerina AT1G59870

  6. Phenotype-gene: 345 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available an named peduncle during process named trichome morphogenesis for AT2G30432 Wang Shucai et al. 2007 Nov. named peduncle during process named trichome morphogenesis AT2G30432

  7. Phenotype-gene: 344 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available an named pedicel during process named trichome morphogenesis for AT2G30432 Wang Shucai et al. 2007 Nov. Deve...n named pedicel during process named trichome morphogenesis AT2G30432

  8. Phenotype-gene: 454 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available stance in response to organism biotroph for AT5G60600 Gil M Jos辿 et al. 2005 Oct. Plant J. 44(1):155-66. htt...p:// increased resistance in response to organism biotroph

  9. Phenotype-gene: 373 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 373 increased dens...ity for quantity of tocopherol in organ named vascular leaf for AT1G64970 ... increased density for quantity of tocoph

  10. Phenotype-gene: 399 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available rescence for quantity of chlorophyll for AT5G51545 Ma Jinfang et al. 2007 Jun. Plant Cell 19(6):1980-93. htt...p:// increased fluorescence for quantity of chloroph

  11. Reference: 414 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 414 Jayasekaran Kandakumar... 11 1255-62 16832621 2006 Nov Plant cell reports Jayasekaran Kandakumar|Kim Kyung-Nam|Ok Sung Han|Shin Jeong Sheop|Vivekanandan Munusamy

  12. Phenotype abnormality: 372 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ent of high light intensity regimen in situation of photoinhibition in environment ... 372 increased sensitivity toward in environm

  13. Phenotype abnormality: 460 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 460 pale green whole plant in environment... of low light intensity regimen in environment of low light intensity regimen http://m

  14. Phenotype abnormality: 251 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lant flowering stage in environment of long day length regimen in environment of long day length regimen htt... 251 delayed whole p

  15. Phenotype abnormality: 384 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available of stomatal complex in environment of light regimen in environment of light regimen 384 increased size

  16. Phenotype abnormality: 383 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available of stomatal complex in environment of continuous dark (no light) regimen in environment of continuous dark (... 383 increased size

  17. Phenotype abnormality: 415 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available nment of soil environment in environment of soil environment 415 lethal in organ named seedling in enviro

  18. Phenotype abnormality: 252 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lant flowering stage in environment of short day length regimen in environment of short day length regimen h... 252 delayed whole p

  19. Phenotype abnormality: 90 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 90 arrhythmic in environment... of continuous dark (no light) regimen in environment of continuous dark (no light) regimen http://

  20. Reference: 177 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 177 Al-Daoude ...lator of the plant disease resistance protein RPM1. 3 1016-28 15722472 2005 Mar The Plant cell Al-Daoude Antonious|Grant Murray|Ko Jong-Hyun|de Torres Zabala Marta

  1. Reference: 32 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 32 Friesner Jo...0- and DNA ligase IV-deficient plants are sensitive to ionizing radiation and defective in T-DNA integration. 4 427-40 12753583 2003 May The Plant journal Britt Anne B|Friesner Joanna

  2. Reference: 751 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 751 Sitaraman ...unctions during Arabidopsis embryo and floral development. 2 672-81 18390806 2008 Jun Plant physiology Bui Minh|Liu Zhongchi|Sitaraman Jayashree

  3. Phenotype abnormality: 265 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 265 disrupted in or...gan named seedling during process named growth after radicle emergence stage ... seedling ... disrupted radicle emergence stage ... growth ...

  4. Phenotype-gene: 486 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available d in organ named stomatal complex during process named stomatal movement for AT1G20090 Jeon Byeong Wook et a...reased speed in organ named stomatal complex during process named stomatal movement AT1G20090

  5. Phenotype-gene: 547 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available growth in environment of fertilized soil for AT5G40780 Hirner Axel et al. 2006 Aug. Plant Cell 18(8):1931-4...6. non-functional growth in environment of fertilized soil

  6. Reference: 610 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 610 Anand Ajit...7 May The Plant cell Anand Ajith|Citovsky Vitaly|Krichevsky Alexander|Lahaye Thomas|Mysore Kirankumar S|Schornack Sebastian|Tang Yuhong|Tzfira Tzvi

  7. Phenotype-gene: 740 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ait of behavioral quality during process named response to gravity for AT5G06140 Jaillais Yvon et al. 2006 S... trait of behavioral quality during process named response to gravity AT5G06140

  8. Reference: 612 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 612 Feng Haizh...1531-45 17513484 2007 Jul Plant physiology Chen Qingguo|Feng Haizhong|Feng Jian|Yang Xiaohui|Zhang Jian|Zuo Jianru

  9. Reference: 759 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 759 Guan Yue-Feng...s. 2 852-63 18434608 2008 Jun Plant physiology Gao Ju-Fang|Guan Yue-Feng|Huang Xue-Yong|Yang Zhong-Nan|Zhang Hong-Xia|Zhu Jun

  10. Reference: 378 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 378 Guo Yongfeng... family transcription factor, has an important role in leaf senescence. 4 601-12 16640597 2006 May The Plant journal Gan Susheng|Guo Yongfeng

  11. Reference: 183 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 183 Booker Jon...noid-derived branch-inhibiting hormone. 3 443-9 15737939 2005 Mar Developmental cell Booker Jonathan|Goddard

  12. Phenotype abnormality: 334 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 334 increased number of axillary inflore...scence bud in organ named inflorescence ... inflorescence ... present in greater numbers in organism ... axillary inflorescence bud ...

  13. Phenotype abnormality: 339 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 339 increased number of inflore...scence in organ named whole plant ... whole plant ... present in greater numbers in organism ... inflorescence ...

  14. Phenotype abnormality: 86 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 86 alternation in organ named inflore...scence during process named organ development ... inflorescence ... alternation ... organ development ...

  15. Phenotype-gene: 473 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available itivity toward in organ named whole plant under influence of ethene for AT5G40770 Christians Matthew J et al...eased sensitivity toward in organ named whole plant under influence of ethene AT5G40770

  16. Phenotype-gene: 194 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available uence of brassinosteroid for AT1G12840 ... decreased sensitivity toward under influence... 194 decreased sensitivity toward under infl

  17. Phenotype-gene: 460 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available onsivity in organ named whole plant under influence of ethene for AT5G40770 Christians Matthew J et al. 2007...responsivity in organ named whole plant under influence of ethene AT5G40770

  18. Phenotype-gene: 195 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available uence of brassinosteroid for AT4G33430 ... decreased sensitivity toward under influence... 195 decreased sensitivity toward under infl

  19. Phenotype-gene: 495 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ward in organ named hypocotyl under influence of ethene for AT1G54490 Olmedo Gabriela et al. 2006 Sep. Proc....7i insensitive toward in organ named hypocotyl under influence of ethene AT1G54490

  20. Phenotype-gene: 497 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ward in organ named root under influence of ethene for AT1G54490 Olmedo Gabriela et al. 2006 Sep. Proc. Natl...sensitive toward in organ named root under influence of ethene AT1G54490

  1. Phenotype-gene: 472 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available itivity toward in organ named seedling during process named growth under influence of abscisic acid for AT5G...g during process named growth under influence of abscisic acid AT5G13680

  2. Phenotype-gene: 400 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available rescence for quantity of chlorophyll for AT5G52110 Lyska Dagmar et al. 2007 Dec. Plant Cell Physiol. 48(12):...1737-46. increased fluorescence for quantity of chloroph

  3. Reference: 163 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 163 Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn

  4. Phenotype-gene: 376 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ciency during process named UV protection for AT2G31660 Zhao Jinfeng et al. 2007 Nov. Plant Cell 19(11):3805...-18. increased efficiency during process named UV protection

  5. Reference: 322 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 322 Konishi Mi...gene, ROOT PRIMORDIUM DEFECTIVE 1, is required for the maintenance of active cell proliferation. 2 591-602 16407439 2006 Feb Plant physiology Konishi Mineko|Sugiyama Munetaka

  6. Reference: 248 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 248 Singh Sunil Kumar... the animal exostosins. 3 384-97 16045474 2005 Aug The Plant journal Eland Cathlene|Harholt Jesper|Marchant Alan|Scheller Henrik Vibe|Singh Sunil Kumar

  7. Reference: 236 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 236 Dharmasiri...5 Jul Developmental cell Dharmasiri Nihal|Dharmasiri Sunethra|Ehrismann Jasmin S|Estelle Mark|Hobbie Lawrence|J端rgens Gerd|Lechner Esther|Weijers Dolf|Yamada Masashi

  8. Reference: 691 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 691 Watanabe Mutsu...ogy Fukushima Atsushi|Kusano Miyako|Noji Masaaki|Oikawa Akira|Saito Kazuki|Watanabe Mutsumi

  9. Phenotype abnormality: 407 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 407 lethal (sensu genetics...) during process named seedling development stage ... lethal (sensu genetics) ... seedling development stage ...

  10. Phenotype abnormality: 411 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 411 lethal (sensu genetics...) in period of stem elongation stage ... stem elongation stage ... lethal (sensu genetics) ...

  11. Phenotype abnormality: 351 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 351 increased number of trichome... branch in organ named trichome ... trichome ... present in greater numbers in organism ... trichome branch ...

  12. Reference: 696 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 696 Harrison B...gravity signal transduction pathway in root statocytes. 2 380-92 18047472 2008 Jan The Plant journal Harrison Benjamin R|Masson Patrick H

  13. Reference: 239 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 239 Bundock Paul et al. 2005 Jul. Natur...functions. An Arabidopsis hAT-like transposase is essential for plant development. 7048 282-4 16015335 2005 Jul Nature Bundock Paul|Hooykaas Paul

  14. Reference: 736 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 736 Negi Juntaro et al. 2008 Mar. Natur...l. CO2 regulator SLAC1 and its homologues are essential for anion homeostasis in plant cells. 7186 483-6 18305482 2008 Mar Nature

  15. Reference: 590 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 590 Caro Elena et al. 2007 May. Nature... to root epidermis patterning in Arabidopsis. 7141 213-7 17450124 2007 May Nature Caro Elena|Castellano M Mar|Gutierrez Crisanto

  16. Reference: 223 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 223 Dohmann Es... cause the cop/det/fus mutant phenotype in Arabidopsis. 7 1967-78 15923347 2005 Jul The Plant cell Dohmann Esther M N|Kuhnle Carola|Schwechheimer Claus

  17. Phenotype abnormality: 40 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 40 abnormal for trait of behavioral quality... in organ named hypocotyl during process named gravitropism ... hypocotyl ... abnormal ... behavioral quality

  18. Phenotype abnormality: 35 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 35 abnormal for trait of behavioral quality... during process named response to gravity ... abnormal ... behavioral quality

  19. Phenotype abnormality: 32 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 32 abnormal for trait of behavioral quality... during process named organ development ... abnormal ... organ development ... behavioral quality

  20. Phenotype abnormality: 34 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 34 abnormal for trait of behavioral quality... during process named response to cytokinin stimulus ... abnormal ... behavioral quality