Energy Technology Data Exchange (ETDEWEB)
Musikas, C [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France)
1966-05-01
The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [French] La reduction du protactinium pentavalent en protactinium tetravalent, dans des solutions sulfuriques et chlorhydriques a ete realisee a l'echelle du milligramme, par electrolyse, dans une cellule a compartiments separes. Aucun indice ne permet de penser que le protactinium puisse exister dans ces solutions a l'etat trivalent. De plus les polarogrammes traces en milieu fluorhydrique ne font apparaitre qu'une seule vague de reduction. Le principe d'une methode volumetrique de dosage du protactinium est donne. (auteur)
The electroreduction of pentavalent protactinium
International Nuclear Information System (INIS)
Musikas, C.
1966-05-01
The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [fr
Moore, R.L.
1958-07-15
An lmprovement in the separation of protactinium from aqueous nitric acid solutions is described. 1t covers the use of lead dioxide and tin dioxide as carrier precipitates for the protactinium. In carrying out the process, divalent lead or divalent tin is addcd to the solution and oxidized, causing formation of a carrier precipitate of lead dioxide or stannic oxide, respectively.
Synthesis, crystallographic and magnetic properties of protactinium pnictides
International Nuclear Information System (INIS)
Hery, Yves.
1979-03-01
From a theoretical point of view, protactinium lies in a very important place in the periodic system for it seems to be the first element of the actinide series where the 5f state is occupied. We have studied protactinium pnictides, particularly arsenides and antimonides. PaAs 2 , Pa 3 As 4 , PaSb 2 and Pa 3 Sb 4 were synthetized and their crystallographic properties were determined and discussed. We have measured the magnetic susceptibilities of PaC, PaAs 2 and PaSb 2 . Protactinium exhibits a dual character. In its monocarbide, which is a weakly diamagnet, it behaves as a transition element while in the temperature independent paramagnets PaAs 2 and PaSb 2 , it behaves like a 'f' element. This 'f' element character increases with increasing metal-metal distances. Furthermore the radial expansion of the protactinium 5f orbital seems to be more important than the Uranium one, and consequently the corresponding protactinium 5f electrons are less localized. In addition, some protactinium chalcogenides (βPaS 2 , γPaSe 2 and PaOSe) have been identified [fr
Recovery of protactinium from molten fluoride nuclear fuel compositions
Baes, C.F. Jr.; Bamberger, C.; Ross, R.G.
1973-12-25
A method is provided for separating protactinium from a molten fluonlde salt composition consisting essentially of at least one alkali and alkaline earth metal fluoride and at least one soluble fluoride of uranium or thorium which comprises oxidizing the protactinium in said composition to the + 5 oxidation state and contacting said composition with an oxide selected from the group consisting of an alkali metal oxide, an alkaline earth oxide, thorium oxide, and uranium oxide, and thereafter isolating the resultant insoluble protactinium oxide product from said composition. (Official Gazette)
CATION EXCHANGE METHOD FOR THE RECOVERY OF PROTACTINIUM
Studier, M.H.; Sullivan, J.C.
1959-07-14
A cation exchange prccess is described for separating protactinium values from thorium values whereby they are initially adsorbed together from an aqueous 0.1 to 2 N hydrochloric acid on a cation exchange resin in a column. Then selectively eluting the thorium by an ammonium sulfate solution and subsequently eluting the protactinium by an oxalate solution.
International Nuclear Information System (INIS)
Gillberg-Wickman, M.
1983-03-01
To be able to judge whether protactinium 231 might represent a major contribution to the human radiation risk from high level radioactive waste a literature study of the geochemical behavior of protactinium has been made. The interest in protactinium determinations has, as far, been in the field of marine geochemistry and geochronology. These investigations show that thorium may be used as a chemical analogue. The content of protactinium 231 is determined by the 235 U content and consequently the occurrence of protactinium in nature is directly associated to the geochemistry of uranium. The pronounced hydrolytic tendency of protactinium and its great sorption and coprecipitation capacity ought to prevent or at least appreciably delay its transport from a back-filled nuclear waste vault to the uppermost surface of the earth. It also has a tendency to form colloids or particulates which may be strongly fixed on a rock surface. In adsorption and desorption processes kinetics must play an important role. Our knowledge in this field is quite limited. Under the physico-chemical conditions in the sea, protactinium is rapidly scavenged from the water column by particulates. It accumulates in the sediments. (author)
Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons
International Nuclear Information System (INIS)
Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.
1985-01-01
The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10 -1 to 10 -10 mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10 -9 mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)
Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons
Energy Technology Data Exchange (ETDEWEB)
Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.
1985-01-01
The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10/sup -1/ to 10/sup -10/ mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10/sup -9/ mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
International Nuclear Information System (INIS)
Raja, Naine; Swain, Kallola; Kayasth, S.R.; Pathassarathy, R.; Mathur, P.K.; Anil Kumar, S.
1999-01-01
A simple and efficient method has been developed to preconcentrate natural protactinium ( 231 Pa) from large size of thorium concentrate (5.0-100.0g) on Dowex 1 X 8 in acid medium. Gamma spectrometry, a powerful determination technique, has been used for quantitative determination of protactinium
International Nuclear Information System (INIS)
Hertz, M.R.; Figgins, P.E.; Deal, W.R.
1983-01-01
The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100 0 C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables
The metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons
International Nuclear Information System (INIS)
Ralston, L.G.; Cohen, N.; Bhattacharyya, H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.
1985-01-01
The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Neptunium-239, Np-237, and Pa-233 were prepared as either citrate-buffer, nitrate, or bicarbonate solutions with oxidation states of (V) and (VI). Samples of blood, urine, feces and autopsy tissues were measured by gamma spectrometry. Retention of neptunium and protactinium was determined in vivo using whole and partial body gamma-scintillation spectrometry with [NaI-CsI(T1)] detectors. Fed and fasted baboons were administered solutions of Np(VI) bicarbonate (10/sup -8/ to 10/sup -1/ mg/kg) and Pa(V) citrate-buffer (10/sup -9/ mg/kg) by gavage. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 + 2% was in liver, and 42 +- 0.1% was excreted in urine. The metabolism of neptunium followed oral and iv administrations was found to be similar. This observation was also true for baboons which had received oral and iv doses of protactinium. A method was developed to estimate GI absorption values for both nuclides in baboons, which were not sacrificed, by comparison of activities present in bioassay samples after injection and gavage. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. Further experiments are currently underway to evaluate this assay technique
A new isotope of protactinium: 239Pa
International Nuclear Information System (INIS)
Yuan, S.; Yang, W.; Mou, W.; Zhang, X.; Li, Z.; Yu, X.; Gu, J.; Guo, Y.; Gan, Z.; Liu, H.; Guo, J.
1995-01-01
A new nuclide 239 Pa was produced by 50MeV/u 18 O bombardment of uranium. A radiochemical separation method was employed for preparing sources of 239 Pa. The protactinium isotope 239 Pa has been identified for the first time by the results observed from the decay of the 239 Pa and its daughter 239 U. The half-life of 239 Pa has been determined to be 106±30min. (orig.)
Separation of Protactinium from Neutron Irradiated Thorium Oxide
International Nuclear Information System (INIS)
Dominguez, G.; Gutierrez, L.; Ropero, M.
1983-01-01
The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO 2 material into ThF 4 . For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs
Energy Technology Data Exchange (ETDEWEB)
Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires
1965-07-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)
International Nuclear Information System (INIS)
Bohet, J.
1977-01-01
Some 300 mg of Pa have been produced in a high purity metallic state. Protactinium monocarbide has been obtained by the carboreduction of Pa 2 O 5 . Protactinium iodide, produced by the direct reaction of iodine on the carbide, has been sublimated at 420 0 C and thermally dissociated at 1200 0 C on a W wire. In these conditions Pa metal has been deposited with a yield greater than 85% and presents a bct structure stable at room temperature (a=3.921+-0.001A and c=3.235+-0.001A). The fcc phase (Fm3m type) (a=5.018+-0.001A) has been obtained by quenching metallic samples (bct) heated in argon at 1500 0 C. The chemical analysis and the transformation of the fcc into bct phase by controlled heat treatments show the presence of this high temperature phase in the metal. Protactinium mononitride (5.58% N) produced by direct reaction of N on Pa at 1100 0 C presents the same fcc crystal structure but the lattice parameter is higher (a=5.047+-0.001A). The dissolution heat of metallic Pa (bct) has been determined in the aqueous solution HCl 12M - HF 0.05M at 298.15+-0.05 K. The standard formation enthalpies of the ionic species Pa(IV) and Pa(V) are respectively equal to -672+-15 kJ.mol -1 and -821+-15 kJ.mol -1
Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231
International Nuclear Information System (INIS)
Guillot, Ph.
1965-01-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through α,n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [fr
Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR
Energy Technology Data Exchange (ETDEWEB)
Trianti, N.; Su' ud, Z.; Riyana, E. S. [Nuclear Physics and Biophysics Research Division Department of Physics - Institut Teknologi Bandung (ITB) Jalan Ganeca 10 Bandung 40132 (Indonesia)
2012-06-06
A preliminary design study for the utilization of thorium added with {sup 231}Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of {sup 233}U to {sup 231}Pa in burn-up process. Optimizations of the content of {sup 231}Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 {approx} 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.
On the 221 Rn → 221 Fr decay scheme
International Nuclear Information System (INIS)
Gromov, K.Ya.; Norseev, Yu.V.; Samatov, Zh.K.; Fominykh, V.I.; Chumin, V.G.; Kudrya, S.A.; Sergienko, V.A.
2002-01-01
The results of investigating the 221 Rnβ - - decay and the 225 Ac α-decay are compared. It is shown that 221 Fr levels at 145.9 and 393.2 keV are excited at the 221 Rn decay. Intensities and reduced probabilities of the β - - decay to the 221 Fr levels are determined. A conclusion is drawn that the parity of the 221 Rn ground state is positive
Sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite
International Nuclear Information System (INIS)
Huitti, T.; Hakanen, M.
1996-12-01
The aim of the study is to determine the sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite in the brackish groundwater of Haestholmen (site of the Loviisa-1, Loviisa-2 reactors). The studies were carried out under aerobic (Cs, Ra, Pa, U, Np, Pu) and anaerobic (Np, Pa, Pu, Tc) laboratory conditions. The cation exchange capasity was determined for the rock and the diffusion of tritiated water in the rocks of different degree of alteration. The sorption and diffusion properties of the rocks are briefly compared with those of host rocks at other sites under investigation by the Finnish company Posiva Oy for the final disposal of spent fuel. (29 refs.)
Energies and electric dipole transitions for low-lying levels of protactinium IV and uranium V
Energy Technology Data Exchange (ETDEWEB)
Uerer, Gueldem; Oezdemir, Leyla [Sakarya Univ. (Turkey). Physics Dept.
2012-01-15
We have reported a relativistic multiconfiguration Dirac-Fock (MCDF) study on low-lying level structures of protactinium IV (Z = 91) and uranium V (Z = 92) ions. Excitation energies and electric dipole (E1) transition parameters (wavelengths, oscillator strengths, and transition rates) for these low-lying levels have been given. We have also investigated the influence of the transverse Breit and quantum electrodynamic (QED) contributions besides correlation effects on the level structure. A comparison has been made with a few available data for these ions in the literature. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Dominguez, G; Gutierrez, L; Ropero, M
1983-07-01
The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO{sub 2} material into ThF{sub 4}. For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs.
Protactinium and the intersection of actinide and transition metal chemistry
Energy Technology Data Exchange (ETDEWEB)
Wilson, Richard E.; De Sio, Stephanie; Vallet, Valérie
2018-02-12
The role of the 5f and 6d orbitals in the chemistry of the actinide elements has been of considerable interest since their discovery and synthesis. Relativistic effects cause the energetics of the 5f and 6d orbitals to change as the actinide series is traversed left to right imparting a rich and complex chemistry. The 5f and 6d atomic states cross in energy at protactinium (Pa), making it a potential intersection between transition metal and actinide chemistries. Herein, we report the synthesis of a Pa-peroxo cluster, A(6)(Pa4O(O-2)(6)F-12) [A = Rb, Cs, (CH3)(4)N], formed in pursuit of an actinide polyoxometalate. Quantum chemical calculations at the density functional theory level demonstrate equal 5f and 6d orbital participation in the chemistry of Pa and increasing 5f orbital participation for the heavier actinides. Periodic changes in orbital character to the bonding in the early actinides highlights the influence of the 5f orbitals in their reactivity and chemical structure.
49 CFR 571.221 - Standard No. 221, School bus body joint strength.
2010-10-01
... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 221, School bus body joint strength. 571.221 Section 571.221 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR VEHICLE SAFETY STANDARDS Federal Motor Vehicle Safety Standard...
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Definitions. 665.221 Section 665.221..., DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.221 Definitions...) Man grey reef shark Carcharhinus amblyrhynchos. Man galapagos shark Carcharhinus galapagensis. Man...
49 CFR 107.221 - Determination.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Determination. 107.221 Section 107.221... PROGRAM PROCEDURES Preemption Waiver of Preemption Determinations § 107.221 Determination. (a) After... Chief Counsel issues a determination. (b) The Chief Counsel may issue a waiver of preemption only on...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK221 (Link to dictyBase) - - - - VHK221P (Link to Original site) VHK221F 603 VHK2...21Z 724 VHK221P 1307 - - Show VHK221 Library VH (Link to library) Clone ID VHK221 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-A/VHK221Q.Seq.d/ Representative seq. ID VHK221P (Link to... Original site) Representative DNA sequence >VHK221 (VHK221Q) /CSM/VH/VHK2-A/VHK221Q.Seq.d/ AACTCTCGAGTGCAAA
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH221 (Link to dictyBase) - - - Contig-U16381-1 SLH221Z (Link... to Original site) - - SLH221Z 595 - - - - Show SLH221 Library SL (Link to library) Clone ID SLH221 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH221Q.Seq.d/ Representative seq. ID SLH22...1Z (Link to Original site) Representative DNA sequence >SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ XXXXX...LH722 (SLH722Q) /CSM/SL/SLH7-A/SLH722Q.Seq.d/ 559 e-158 SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ 559 e
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Purpose. 22.1 Section 22.1 Transportation Office of the Secretary of Transportation SHORT-TERM LENDING PROGRAM (STLP) General § 22.1 Purpose. The purpose of the DOT OSDBU STLP is to provide financial assistance in the form of short-term loans from...
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Smoking. 2.21 Section 2.21 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.21 Smoking. (a) The superintendent may designate a portion of a park area, or all or a portion of a building,...
Energy Technology Data Exchange (ETDEWEB)
Radchenko, Valery; Engle, Jonathan W.; Wilson, Justin J.; Maassen, Joel R.; Nortier, Meiring F.; Birnbaum, Eva R.; John, Kevin D.; Fassbender, Michael E. [Los Alamos National Laboratory, NM (United States)
2016-08-01
Targeted alpha therapy (TAT) is a treatment method of increasing interest to the clinical oncology community that utilizes α-emitting radionuclides conjugated to biomolecules for the selective killing of tumor cells. Proton irradiation of thorium generates a number of α-emitting radionuclides with therapeutic potential for application via TAT. In particular, the radionuclide {sup 230}Pa is formed via the {sup 232}Th(p, 3n) nuclear reaction and partially decays to {sup 230}U, an α emitter which has recently received attention as a possible therapy nuclide. In this study, we estimate production yields for {sup 230}Pa and other Pa isotopes from proton-irradiated thorium based on cross section measurements. We adopt existing methods for the chromatographic separation of protactinium isotopes from proton irradiated thorium matrices to combine and optimize them for effective fission product decontamination.
39 CFR 221.5 - Headquarters organization.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Headquarters organization. 221.5 Section 221.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.5 Headquarters organization. (a) Postmaster General—(1) Appointment. The postmaster general (PMG), the chief...
49 CFR 234.221 - Lamp voltage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Lamp voltage. 234.221 Section 234.221 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Maintenance Standards § 234.221 Lamp voltage. The voltage at each lamp shall be...
39 CFR 221.4 - Corporate officers.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Corporate officers. 221.4 Section 221.4 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.4 Corporate officers. The Board of Governors determines the number of corporate officers and appoints the...
14 CFR 221.4 - English language.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false English language. 221.4 Section 221.4... REGULATIONS TARIFFS General § 221.4 English language. All tariffs and other documents and material filed with the Department pursuant to this part shall be in the English language. ...
24 CFR 221.1 - Savings clause.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Savings clause. 221.1 Section 221.1... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Eligibility Requirements-Low Cost Homes-Savings Clause § 221.1...
24 CFR 221.775 - Option period.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Option period. 221.775 Section 221.775 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... § 221.775 Option period. The mortgagee may exercise its option to assign within one year following the...
22 CFR 221.43 - Governing law.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 221.43 Section 221.43 Foreign... Administration § 221.43 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States of America governing contracts and commercial transactions of the United...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Storm rails. 108.221 Section 108.221 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Rails § 108.221 Storm rails. Each unit must have a storm rail in the following...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 221.7 Section 221.7 Transportation... TRANSPORTATION REAR END MARKING DEVICE-PASSENGER, COMMUTER AND FREIGHT TRAINS General § 221.7 Civil penalty. Any... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except...
2010-10-01
... transportation; (3) Rapid transit operations in an urban area that are not connected with the general railroad... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 221.3 Section 221.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...
2010-04-01
... 270 of this chapter). The Board is responsible for making this decision. ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 221.1 Section 221.1 Employees... Security Administration or the Railroad Retirement Board will pay benefits to a railroad employee, and his...
39 CFR 221.2 - Board of Governors.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Board of Governors. 221.2 Section 221.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.2 Board of Governors. (a) Composition. The Board of Governors consists of 11 members. Nine governors are appointed by...
International Nuclear Information System (INIS)
Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.
2004-01-01
Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the
46 CFR 221.93 - Collection of civil penalties.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Collection of civil penalties. 221.93 Section 221.93... RELATED ACTIVITIES REGULATED TRANSACTIONS INVOLVING DOCUMENTED VESSELS AND OTHER MARITIME INTERESTS Civil Penalties § 221.93 Collection of civil penalties. Within 30 days after receipt of the Hearing Officer's...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false PHS support. 93.221 Section 93.221 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
29 CFR 1952.221 - Developmental schedule.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.221 Section 1952.221 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... Management data system operational July 1, 1973. Automated Management data system operational January 1, 1974...
International Nuclear Information System (INIS)
Kudrya, S.A.; Sergienko, V.A.; Gorozhankin, V.M.; Gromov, K.Ya.; Malikov, Sh.R.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Yakushev, E.A.
2002-01-01
In-depth investigation of (α-γ)-coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ-rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the (α-γ)-coincidences makes it possible to find the intensity of population of 221 Fr levels by the α decay and multipolarities of five weak γ-transitions. The conversion electron spectrum is investigated in the range of 5-24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the assumption of static octupole deformation
27 CFR 25.221 - Voluntary destruction of beer.
2010-04-01
... beer. 25.221 Section 25.221 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Voluntary Destruction § 25.221 Voluntary destruction of beer. (a) On brewery premises. (1) A brewer may destroy, at the brewery, beer on which the tax has not...
24 CFR 221.770 - Assignment option.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.770 Section... § 221.770 Assignment option. A mortgagee holding a conditional or firm commitment issued on or before... mortgagee's approved underwriter on or before November 30, 1983) has the option to assign, transfer and...
10 CFR 221.11 - Natural gas and ethane.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Natural gas and ethane. 221.11 Section 221.11 Energy DEPARTMENT OF ENERGY OIL PRIORITY SUPPLY OF CRUDE OIL AND PETROLEUM PRODUCTS TO THE DEPARTMENT OF DEFENSE UNDER THE DEFENSE PRODUCTION ACT Exclusions § 221.11 Natural gas and ethane. The supply of natural gas...
29 CFR 778.221 - “Call-back” pay.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false âCall-backâ pay. 778.221 Section 778.221 Labor Regulations...Regular Rateâ Payments Not for Hours Worked § 778.221 “Call-back” pay. (a) General. In the interest of... payments consist of a specified number of hours' pay at the applicable straight time or overtime rates...
49 CFR 1542.221 - Records of law enforcement response.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Records of law enforcement response. 1542.221 Section 1542.221 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.221 Records of law enforcement...
39 CFR 221.1 - The United States Postal Service.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false The United States Postal Service. 221.1 Section 221.1 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.1 The United States Postal Service. The United States Postal Service was established as an...
40 CFR 221.1 - Applications for permits.
2010-07-01
... of the proposed dumping on the marine environment, navigation, living and non-living marine resource... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applications for permits. 221.1 Section 221.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING...
14 CFR 221.5 - Unauthorized air transportation.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Unauthorized air transportation. 221.5... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS General § 221.5 Unauthorized air transportation. Tariff publications... Department's granting authority to perform the foreign air transportation covered by such tariff publications...
24 CFR 221.790 - Debenture interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Debenture interest rate. 221.790...-Moderate Income Projects § 221.790 Debenture interest rate. The debentures issued pursuant to the exercise of an assignment option shall bear interest at the going Federal rate at date of issuance. The going...
24 CFR 221.254 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... Cost Homes § 221.254 Mortgage insurance premiums. (a) All of the provisions of §§ 203.260 through 203.295 of this chapter relating to mortgage insurance premiums shall apply to mortgages insured under...
39 CFR 221.7 - Postal Service emblem.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Postal Service emblem. 221.7 Section 221.7 Postal... Service emblem. The Postal Service emblem, which is identical with the seal, is registered as a trademark and service mark by the U.S. Patent Office. Except for the emblem on official stationery, the emblem...
46 CFR 221.111 - Status of prior transactions-controlling dates.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Status of prior transactions-controlling dates. 221.111 Section 221.111 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING... MARITIME INTERESTS Savings Provisions § 221.111 Status of prior transactions—controlling dates. (a) The...
24 CFR 221.795 - Displacement-below market interest rate mortgages.
2010-04-01
... Rights and Obligations-Moderate Income Projects § 221.795 Displacement—below market interest rate... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Displacement-below market interest rate mortgages. 221.795 Section 221.795 Housing and Urban Development Regulations Relating to Housing...
50 CFR 221.4 - What deadlines apply to pending applications?
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false What deadlines apply to pending applications? 221.4 Section 221.4 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC... LICENSES General Provisions § 221.4 What deadlines apply to pending applications? (a) Applicability. (1...
14 CFR 221.102 - Accessibility of tariffs to the public.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221.102 Section 221.102 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in complete...
Lee, Jonghwan; Choi, Kyung-Ju; Moon, Sung Ung; Kim, Soonhag
2016-01-01
Recently, microRNA (miRNA or miR) has emerged as a new cancer biomarker because of its high expression level in various cancer types and its role in the control of tumor suppressor genes. In cancer studies, molecular imaging and treatment based on target cancer markers have been combined to facilitate simultaneous cancer diagnosis and therapy. In this study, for combined therapy with diagnosis of cancer, we developed a doxorubicin-conjugated miR-221 molecular beacon (miR-221 DOXO MB) in a single platform composed of three different nucleotides: miR-221 binding sequence, black hole quencher 1 (BHQ1), and doxorubicin binding site. Imaging of endogenous miR-221 was achieved by specific hybridization between miR-221 and the miR-221 binding site in miR-221 DOXO MB. The presence of miR-221 triggered detachment of the quencher oligo and subsequent activation of a fluorescent signal of miR-221 DOXO MB. Simultaneous cancer therapy in C6 astrocytoma cells and nude mice was achieved by inhibition of miRNA-221 function that downregulates tumor suppressor genes. The detection of miR-221 expression and inhibition of miR-221 function by miR-221 DOXO MB provide the feasibility as a cancer theragnostic probe. Furthermore, a cytotoxic effect was induced by unloading of doxorubicin intercalated into miR-221 DOXO MB inside cells. Loss of miR-221 function and cytotoxicity induced by the miR-221 DOXO MB provides combined therapeutic efficacy against cancers. This method could be used as a new theragnostic probe with enhanced therapy to detect and inhibit many cancer-related miRNAs. Copyright © 2015 Elsevier Ltd. All rights reserved.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate increase and payment... Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and § 221.65... continuation of a below market interest rate, interest on such mortgage shall be computed by the mortgagee at...
International Nuclear Information System (INIS)
Corbett, J.O.
1981-04-01
Recently published calculations have suggested that a hypothetical individual may receive an effective radiation dose equivalent of 23 mrem/y from coal-fired power station emissions through the ingestion of lead-210, polonium-210 and protactinium-231. It is shown that the model used in those calculations is over-pessimistic by one or two orders of magnitude when applied to the deposition of Pb-210 and Po-210 derived from the decay of radon naturally present in the atmosphere. A more recent assessment of metabolic data for Pa-231 suggests that estimated doses from this nuclide also can be reduced by about a factor of twenty. It is concluded that the maximum effective dose equivalent from power station emissions probably does not exceed 1-2 mrem/y. (author)
27 CFR 41.221 - Change in trade name.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in trade name. 41.221 Section 41.221 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Change in trade name. Where there is a change in, or an addition or discontinuance of, a trade name used...
Data Quality Objectives Summary Report for the 221-U Canyon Disposition Alternatives
International Nuclear Information System (INIS)
Miller, M.S.; Oaces, L.E.; Baxter, J.; Brown, T.M.; Enoke, D.E.; Carlson, D.; Rugg, J.E.
1997-08-01
The 221-U Canyon Disposition Alternatives Data Quality Objective (DQO) Process identifies the sampling and analytical requirements necessary to support future detailed evaluation of alternatives via the CERCLA process, for final disposition of the 221-U Canyon Facility. Viable alternatives for the disposition of the 221-U Facility have been identified in a CERCLA Phase I Feasibility Study (FS) (DOE-RL 1997) for the Canyon Disposition Initiative (CDI). The scope of this DQO Process is limited to the 221-U Process Canyon Building and equipment contained within the facility. Associated stacks, filters, solvent handling, vaults, and storage facilities external to the 221-U Building are not addressed in this DQO. This DQO focuses on the 221-U Building because it provides the greatest potential source of contaminant volumes and concentrations and the physical structure poses the greatest challenge for disposition decisions
20 CFR 404.221 - Computing your average monthly wage.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Computing your average monthly wage. 404.221... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Average-Monthly-Wage Method of Computing Primary Insurance Amounts § 404.221 Computing your average monthly wage. (a) General. Under the average...
International Nuclear Information System (INIS)
Jaussaud, Ch.
2003-01-01
Hydrolysis of protactinium (V) according to the reactions: PaO(OH) 2+ +H 2 O ↔ PaO(OH) 2 + + H + (K 2 ] PaO(OH) 2+ +2H 2 O ↔ PaO(OH) 5 + H + (K 3 ) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na + /H + /ClO 4 - system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients ε (i,j) as well as the Pitzer parameters β (0) and β (1) were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)
Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity
DEFF Research Database (Denmark)
Argetsinger, Lawrence S; Kouadio, Jean-Louis K; Steen, Hanno
2004-01-01
or which of the 49 tyrosines in JAK2 are autophosphorylated. In this study, mass spectrometry and two-dimensional peptide mapping were used to determine that tyrosines 221, 570, and 1007 in JAK2 are autophosphorylated. Phosphorylation of tyrosine 570 is particularly robust. In response to growth hormone......, JAK2 was rapidly and transiently phosphorylated at tyrosines 221 and 570, returning to basal levels by 60 min. Analysis of the sequences surrounding tyrosines 221 and 570 in JAK2 and tyrosines in other proteins that are phosphorylated in response to ligands that activate JAK2 suggests that the YXX......[L/I/V] motif is one of the motifs recognized by JAK2. Experiments using JAK2 with tyrosines 221 and 570 mutated to phenylalanine suggest that tyrosines 221 and 570 in JAK2 may serve as regulatory sites in JAK2, with phosphorylation of tyrosine 221 increasing kinase activity and phosphorylation of tyrosine 570...
12 CFR 221.125 - Credit to brokers and dealers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Credit to brokers and dealers. 221.125 Section... SYSTEM CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.125 Credit to brokers and dealers. (a) The...
12 CFR 221.103 - Loans to brokers or dealers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Loans to brokers or dealers. 221.103 Section... SYSTEM CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.103 Loans to brokers or dealers. Questions have...
50 CFR 221.3 - How are time periods computed?
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false How are time periods computed? 221.3... Provisions § 221.3 How are time periods computed? (a) General. Time periods are computed as follows: (1) The day of the act or event from which the period begins to run is not included. (2) The last day of the...
46 CFR 221.85 - Hearing procedures.
2010-10-01
... § 221.85 Hearing procedures. (a) The Hearing Officer shall conduct a fair and impartial proceeding in... the authentication of any written exhibit or statement. (c) At the close of the Party's presentation...
MicroRNA-221 and -222 Regulate Radiation Sensitivity by Targeting the PTEN Pathway
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Wang Ping; Cao Yongzhen; Lv Zhonghong; Yu Shizhu; Wang Guangxiu; Zhang Anling; Jia Zhifan; Han Lei; Yang Chunying; Ishiyama, Hiromichi; Teh, Bin S.; Xu Bo; Pu Peiyu
2011-01-01
Purpose: MicroRNAs (miRNAs) are noncoding RNAs inhibiting expression of numerous target genes by posttranscriptional regulation. miRNA-221 and miRNA-222 (miRNA-221/-222) expression is elevated in radioresistant tumor cell lines; however, it is not known whether and how miRNAs control cellular responses to ionizing irradiation. Methods and Materials: We used bioinformatic analyses, luciferase reporter assay, and genetic knockdown and biochemical assays to characterize the regulation pathways of miRNA-221/-222 in response to radiation treatment. Results: We identified the PTEN gene as a target of miRNA-221/-222. Furthermore, we found that knocking down miRNA-221/-222 by antisense oligonucleotides upregulated PTEN expression. Upregulated PTEN expression suppressed AKT activity and increased radiation-induced apoptosis, resulting in enhancement of radiosensitivity in tumor cells. Conclusions: miRNA-221/-222 control radiation sensitivity by regulating the PTEN/AKT pathway and can be explored as novel targets for radiosensitization.
14 CFR 221.200 - Content and explanation of abbreviations, reference marks and symbols.
2010-01-01
..., reference marks and symbols. 221.200 Section 221.200 Aeronautics and Space OFFICE OF THE SECRETARY... § 221.200 Content and explanation of abbreviations, reference marks and symbols. (a) Content. The format..., reference marks and symbols. Abbreviations, reference marks and symbols which are used in the tariff shall...
12 CFR 221.109 - Loan to open-end investment company.
2010-01-01
... CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.109 Loan to open-end investment company. In... customarily purchases stocks registered on a national securities exchange, the Board stated that in view of... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Loan to open-end investment company. 221.109...
5 CFR 532.221 - Industries included in regular nonappropriated fund surveys.
2010-01-01
... nonappropriated fund surveys. 532.221 Section 532.221 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... wholesalers. 44132 Tire dealers. 44311 Appliance, television, and other electronic stores. 44411 Home centers. 44611 Pharmacies and drug stores. 4471 Gasoline stations. 44814 Family clothing stores. 4521 Department...
5 CFR 9901.221 - Classification requirements.
2010-01-01
... Section 9901.221 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE NATIONAL..., qualifications, and other requirements of categories of jobs, and will make such descriptions and documentation...
Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.
Argetsinger, Lawrence S; Kouadio, Jean-Louis K; Steen, Hanno; Stensballe, Allan; Jensen, Ole N; Carter-Su, Christin
2004-06-01
The tyrosine kinase JAK2 is a key signaling protein for at least 20 receptors in the cytokine/hematopoietin receptor superfamily and is a component of signaling by insulin receptor and several G-protein-coupled receptors. However, there is only limited knowledge of the physical structure of JAK2 or which of the 49 tyrosines in JAK2 are autophosphorylated. In this study, mass spectrometry and two-dimensional peptide mapping were used to determine that tyrosines 221, 570, and 1007 in JAK2 are autophosphorylated. Phosphorylation of tyrosine 570 is particularly robust. In response to growth hormone, JAK2 was rapidly and transiently phosphorylated at tyrosines 221 and 570, returning to basal levels by 60 min. Analysis of the sequences surrounding tyrosines 221 and 570 in JAK2 and tyrosines in other proteins that are phosphorylated in response to ligands that activate JAK2 suggests that the YXX[L/I/V] motif is one of the motifs recognized by JAK2. Experiments using JAK2 with tyrosines 221 and 570 mutated to phenylalanine suggest that tyrosines 221 and 570 in JAK2 may serve as regulatory sites in JAK2, with phosphorylation of tyrosine 221 increasing kinase activity and phosphorylation of tyrosine 570 decreasing kinase activity and thereby contributing to rapid termination of ligand activation of JAK2.
14 CFR 221.61 - Rules and regulations governing foreign air transportation.
2010-01-01
... governing foreign air transportation. Instead of being included in the fares tariffs, the rules and regulations governing foreign air transportation required to be filed by §§ 221.20 and 221.30 and/or... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Rules and regulations governing foreign air...
12 CFR 221.112 - Loans by bank in capacity as trustee.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Loans by bank in capacity as trustee. 221.112... CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.112 Loans by bank in capacity as trustee. (a... been pledged as collateral for loans. Loans are not made, under the plan, from bank funds, and...
Sampling and Analysis Plan for the 221-U Facility
International Nuclear Information System (INIS)
Rugg, J.E.
1998-02-01
This sampling and analysis plan (SAP) presents the rationale and strategy for the sampling and analysis activities proposed to be conducted to support the evaluation of alternatives for the final disposition of the 221-U Facility. This SAP will describe general sample locations and the minimum number of samples required. It will also identify the specific contaminants of potential concern (COPCs) and the required analysis. This SAP does not define the exact sample locations and equipment to be used in the field due to the nature of unknowns associated with the 221-U Facility
Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Cao Yongzhen; Pu Peiyu; Lu Zhonghong; Du Yue
2009-01-01
Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)
50 CFR 221.34 - What is the law governing ex parte communications?
2010-10-01
... communications? 221.34 Section 221.34 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS PRESCRIPTIONS IN FERC HYDROPOWER... communications? (a) Ex parte communications with the ALJ or his or her staff are prohibited in accordance with 5...
24 CFR 221.255 - Assignment option.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.255 Section... Assignment option. (a) A mortgagee holding a mortgage insured pursuant to a conditional or firm commitment issued on or before November 30, 1983 has the option to assign, transfer and deliver to the Commissioner...
30 CFR 250.221 - What environmental monitoring information must accompany the EP?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What environmental monitoring information must accompany the EP? 250.221 Section 250.221 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... necessary under the MMPA. (c) Flower Garden Banks National Marine Sanctuary (FGBNMS). If you propose to...
33 CFR 135.221 - Reapplication for certification.
2010-07-01
... (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.221 Reapplication for certification. (a) If... certificate must be immediately submitted to the Fund Administrator in accordance with § 135.204. ...
12 CFR 221.124 - Purchase of debt securities to finance corporate takeovers.
2010-01-01
... securities to finance corporate takeovers. (a) Petitions have been filed with the Board raising questions as... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Purchase of debt securities to finance corporate takeovers. 221.124 Section 221.124 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...
Phase I feasibility study for the Canyon disposition initiative (221-U facility)
International Nuclear Information System (INIS)
1997-08-01
The objective of the Phase I Feasibility Study (FS) presented in this document is to provide decision makers sufficient information on the remedial alternatives specific to the disposition of the 221-U Canyon Building (221-U Facility) located at the Hanford Site, and to determine which alternatives are viable for further detailed analysis
2010-01-01
... in connection with Insurance Premium Funding Programs. 221.122 Section 221.122 Banks and Banking...) Interpretations § 221.122 Applicability of margin requirements to credit in connection with Insurance Premium... with insurance premium funding programs. The inquiries are included in a set of guidelines in the...
Radiation environmental monitoring and assessment of plant-221 site ten years after decommissioning
International Nuclear Information System (INIS)
Li Yang; Gu Zhijie; Pan Wei; Ren Xiaona; Hu Xiaolin; She Haiqiang
2011-01-01
More than 10 years have passed since nuclear facility decommissioning practice for Plant-221 finished. Environmental radiation monitoring and post assessment of the decommissioning site of Plant-221 was carried out during 2003-2006, which was organized by Department of Environmental Protection and executed by China Institute for Radiation Protection, Environmental Radiation Monitoring station of Qinghai Province, etc. It shows that the decommissioning practice for Plant-221 complied with relevant limits for decommissioning, and its environmental radiation situation has not had significant change in general after 10 years, and the potential impact to the public and the environmental is acceptable. (authors)
Directory of Open Access Journals (Sweden)
Zhang W
2015-07-01
Full Text Available Wendian Zhang,1 Fangqi Peng,1 Taotao Zhou,1 Yifei Huang,2 Li Zhang,3 Peng Ye,4 Miao Lu,1 Guang Yang,5 Yongkang Gai,1 Tan Yang,1 Xiang Ma,1 Guangya Xiang1 1School of Pharmacy, Tongji Medical College, 2Department of Pharmacy, 3Department of Ultrasound, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, 4Department of Pharmacy, Wuhan University, Renmin Hospital, 5School of Medicine, Jianghan University, Wuhan, People’s Republic of China Abstract: Hepatocellular carcinoma (HCC is one of the leading causes of cancer-related death. Gene therapy was established as a new strategy for treating HCC. To explore the potential delivery system to support the gene therapy of HCC, negatively charged liposomal delivery system was used to deliver miR-221 antisense oligonucleotide (anti-miR-221 to the transferrin (Tf receptor over expressed HepG2 cells. The liposome exhibited a mean particle size of 122.5 nm, zeta potential of -15.74 mV, anti-miR-221 encapsulation efficiency of 70%, and excellent colloidal stability at 4°C. Anti-miR-221-encapsulated Tf-targeted liposome demonstrated a 15-fold higher delivery efficiency compared to nontargeted liposome in HepG2 cells in vitro. Anti-miR-221 Tf-targeted liposome effectively delivered anti-miR-221 to HepG2 cells, upregulated miR-221 target genes PTEN, P27kip1, and TIMP3, and exhibited greater silencing efficiency over nontargeted anti-miR-221 liposome. After intravenous injection into HepG2 tumor-bearing xenografted mice with Cy3-labeled anti-miR-221 Tf-targeted liposome, Cy3-anti-miR-221 was successfully delivered to the tumor site and increased the expressions of PTEN, P27kip1, and TIMP3. Our results demonstrate that the Tf-targeted negatively charged liposome could be a potential therapeutic modality in the gene therapy of human HCC. Keywords: transferrin, gene, HCC, target delivery system, anionic liposome
50 CFR 221.47 - What are the requirements for subpoenas and witness fees?
2010-10-01
... and witness fees? 221.47 Section 221.47 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE... requirements for subpoenas and witness fees? (a) Request for subpoena. (1) Except as provided in paragraph (a... return it to the party on whose behalf the subpoena was served. (c) Witness fees. (1) A party who...
International Nuclear Information System (INIS)
Rong, Minhua; Chen, Gang; Dang, Yiwu
2013-01-01
MiR-221 is over-expressed in human hepatocellular carcinoma (HCC), but its clinical significance and function in HCC remains uncertain. The aim of the study was to investigate the relationship between miR-221 overexpression and clinicopathological parameters in HCC formalin-fixed paraffin-embedded (FFPE) tissues, and the effect of miR-221 inhibitor and mimic on different HCC cell lines in vitro. MiR-221 expression was detected using real time RT-qPCR in FFPE HCC and the adjacent noncancerous liver tissues. The relationship between miR-221 level and clinicopathological features was also analyzed. Furthermore, miR-221 inhibitor and mimic were transfected into HCC cell lines HepB3, HepG2 and SNU449. The effects of miR-221 on cell growth, cell cycle, caspase activity and apoptosis were also investigated by spectrophotometry, fluorimetry, fluorescence microscopy and flow cytometry, respectively. The relative expression of miR-221 in clinical TNM stages III and IV was significantly higher than that in the stages I and II. The miR-221 level was also upregulated in the metastatic group compared to the nonmetastatic group. Furthermore, miR-221 over-expression was related to the status of tumor capsular infiltration in HCC clinical samples. Functionally, cell growth was inhibited, cell cycle was arrested in G1/S-phase and apoptosis was increased by miR-221 inhibitor in vitro. Likewise, miR-221 mimic accelerated the cell growth. Expression of miR-221 in FFPE tissues could provide predictive significance for prognosis of HCC patients. Moreover, miR-221 inhibitor could be useful to suppress proliferation and induce apoptosis in HCC cells. Thus miR-221 might be a critical targeted therapy strategy for HCC
Directory of Open Access Journals (Sweden)
Matteo Brioschi
2010-11-01
Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.
18 CFR 284.221 - General rule; transportation by interstate pipelines on behalf of others.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false General rule; transportation by interstate pipelines on behalf of others. 284.221 Section 284.221 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY OTHER REGULATIONS UNDER THE...
Growth inhibitory effects of miR-221 and miR-222 in non-small cell lung cancer cells
International Nuclear Information System (INIS)
Yamashita, Ryo; Sato, Mitsuo; Kakumu, Tomohiko; Hase, Tetsunari; Yogo, Naoyuki; Maruyama, Eiichi; Sekido, Yoshitaka; Kondo, Masashi; Hasegawa, Yoshinori
2015-01-01
Both pro- and anti-oncogenic roles of miR-221 and miR-222 microRNAs are reported in several types of human cancers. A previous study suggested their oncogenic role in invasiveness in lung cancer, albeit only one cell line (H460) was used. To further evaluate involvement of miR-221 and miR-222 in lung cancer, we investigated the effects of miR-221 and miR-222 overexpression on six lung cancer cell lines, including H460, as well as one immortalized normal human bronchial epithelial cell line, HBEC4. miR-221 and miR-222 induced epithelial-to-mesenchymal transition (EMT)-like changes in a minority of HBEC4 cells but, unexpectedly, both the microRNAs rather suppressed their invasiveness. Consistent with the prior report, miR-221 and miR-222 promoted growth in H460; however, miR-221 suppressed growth in four other cell lines with no effects in one, and miR-222 suppressed growth in three cell lines but promoted growth in two. These are the first results to show tumor-suppressive effects of miR-221 and miR-222 in lung cancer cells, and we focused on clarifying the mechanisms. Cell cycle and apoptosis analyses revealed that growth suppression by miR-221 and miR-222 occurred through intra-S-phase arrest and/or apoptosis. Finally, lung cancer cell lines transfected with miR-221 or miR-222 became more sensitive to the S-phase targeting drugs, possibly due to an increased S-phase population. In conclusion, our data are the first to show tumor-suppressive effects of miR-221 and miR-222 on lung cancer, warranting testing their potential as therapeutics for the disease
Directory of Open Access Journals (Sweden)
Maria Eugenia Gallo Cantafio
2016-01-01
Full Text Available Locked nucleic acid (LNA oligonucleotides have been successfully used to efficiently inhibit endogenous small noncoding RNAs in vitro and in vivo. We previously demonstrated that the direct miR-221 inhibition by the novel 13-mer LNA-i-miR-221 induces significant antimyeloma activity and upregulates canonical miR-221 targets in vitro and in vivo. To evaluate the LNA-i-miR-221 pharmacokinetics and pharmacodynamics, novel assays for oligonucleotides quantification in NOD.SCID mice and Cynomolgus monkeys (Macaca fascicularis plasma, urine and tissues were developed. To this aim, a liquid chromatography/mass spectrometry method, after solid-phase extraction, was used for the detection of LNA-i-miR-221 in plasma and urine, while a specific in situ hybridization assay for tissue uptake analysis was designed. Our analysis revealed short half-life, optimal tissue biovailability and minimal urine excretion of LNA-i-miR-221 in mice and monkeys. Up to 3 weeks, LNA-i-miR-221 was still detectable in mice vital organs and in xenografted tumors, together with p27 target upregulation. Importantly, no toxicity in the pilot monkey study was observed. Overall, our findings indicate the suitability of LNA-i-miR-221 for clinical use and we provide here pilot data for safety analysis and further development of LNA-miRNA-based therapeutics for human cancer.
Dependence of the half-life of 221Fr on the implantation environment
DEFF Research Database (Denmark)
Olaizola, B.; Fraile, L.M.; Riisager, Karsten
2010-01-01
The possible dependence of the half-life of 221Fr on the solid-state environment has been investigated by the simultaneous measurement of implanted 221Fr ions in an insulator (Si) and a metallic substrate (Au) at the ISOLDE facility at CERN. Our results indicate that, if existing, the difference ...
A=225 implantation for $^{221}$Fr source for TRIUMF atom trap
The FrPNC Collaboration is mounting an atom trap for parity violation experiments and precision spectroscopy on francium atoms at TRIUMF's ISAC facility. We would like to use ISOLDE's capability of simultaneously implanting A=225 (while another experiment runs online) to make a long-lived source feeding $^{221}$Fr for tests of the trap. $^{225}$Ra $\\beta$-decays to $^{225}$Ac, which then $\\alpha$-decays, producing 100 keV $^{221}$Fr t$_{1/2}$= 4.8 minute recoils. The implanted A=225 source would be shipped to TRIUMF, where it would be held for several minutes at a time a few mm from the same yttrium foil that normally receives the ISAC beam. SRIM calculations imply that 20% of the $^{221}$Fr will be implanted in a 1 cm diameter spot on the yttrium. Then the yttrium foil is moved to the trap and heated to release the Fr atoms, just as in normal ISAC online operation. A test implantation will be done at 10$^{7}$/sec production for 1 day, testing whether carbon cracking on the implantation foil in the mass separ...
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Combined credit for exercising employee stock options and paying income taxes incurred as a result of such exercise. 221.123 Section 221.123 Banks and... (REGULATION U) Interpretations § 221.123 Combined credit for exercising employee stock options and paying...
2010-01-01
... wishes to obtain the required purpose statement by mail rather than by a face-to-face interview. Personal... without benefit of face-to-face interview. 221.115 Section 221.115 Banks and Banking FEDERAL RESERVE...) Interpretations § 221.115 Accepting a purpose statement through the mail without benefit of face-to-face interview...
29 CFR 779.221 - “Common control” defined.
2010-07-01
... organizational units.” The meaning of “common control” is discussed comprehensively in part 776 of this chapter. ... Or Common Control § 779.221 “Common control” defined. Under the definition the “enterprise” includes all related activities performed through “common control” for a common business purpose. The word...
5 CFR 531.221 - Maximum payable rate rule.
2010-01-01
... before the reassignment. (ii) If the rate resulting from the geographic conversion under paragraph (c)(2... previous rate (i.e., the former special rate after the geographic conversion) with the rates on the current... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Maximum payable rate rule. 531.221...
Chen, Tsai-Yu; Lee, Sung-Hun; Dhar, Shilpa S; Lee, Min Gyu
2018-03-16
The stemness maintenance of embryonic stem cells (ESCs) requires pluripotency transcription factors, including Oct4, Nanog, and Sox2. We have previously reported that protein arginine methyltransferase 7 (PRMT7), an epigenetic modifier, is an essential pluripotency factor that maintains the stemness of mouse ESCs, at least in part, by down-regulating the expression of the anti-stemness microRNA (miRNA) miR-24-2. To gain greater insight into the molecular basis underlying PRMT7-mediated maintenance of mouse ESC stemness, we searched for new PRMT7-down-regulated anti-stemness miRNAs. Here, we show that miR-221 gene-encoded miR-221-3p and miR-221-5p are anti-stemness miRNAs whose expression levels in mouse ESCs are directly repressed by PRMT7. Notably, both miR-221-3p and miR-221-5p targeted the 3' untranslated regions of mRNA transcripts of the major pluripotency factors Oct4, Nanog, and Sox2 to antagonize mouse ESC stemness. Moreover, miR-221-5p silenced also the expression of its own transcriptional repressor PRMT7. Transfection of miR-221-3p and miR-221-5p mimics induced spontaneous differentiation of mouse ESCs. CRISPR-mediated deletion of the miR-221 gene, as well as specific antisense inhibitors of miR-221-3p and miR-221-5p, inhibited the spontaneous differentiation of PRMT7-depleted mouse ESCs. Taken together, these findings reveal that the PRMT7-mediated repression of miR-221-3p and miR-221-5p expression plays a critical role in maintaining mouse ESC stemness. Our results also establish miR-221-3p and miR-221-5p as anti-stemness miRNAs that target Oct4 , Nanog , and Sox2 mRNAs in mouse ESCs. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.
20 CFR 725.221 - Determination of dependency; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; child. 725.221... Determination of dependency; child. For the purposes of determining whether a child was dependent upon a... the eligibility of a child who is under a disability as defined in section 223(d) of the Social...
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
2012-10-22
...-Basis Hurricane and Hurricane Missiles AGENCY: Nuclear Regulatory Commission. ACTION: Proposed interim...-ISG-024, ``Implementation of Regulatory Guide 1.221 on Design-Basis Hurricane and Hurricane Missiles....221, ``Design-Basis Hurricane and Hurricane Missiles for Nuclear Power Plants.'' DATES: Submit...
Li, Feng; Wang, Feiran; Zhu, Changlai; Wei, Qun; Zhang, Tianyi; Zhou, You Lang
2018-01-01
MicroRNA-221(miR-221) is frequently dysregulated in cancer. The purpose of this study was to explore whether miR-221 can be used as a potential diagnostic marker or therapeutic target for hepatocellular carcinoma (HCC). In this study, we investigated whether miR-221 expression was associated with clini-copathological characteristics and prognosis in HCC patients, and we developed a nanoparticle-based miRNA delivery system and detected its therapeutic efficacy in vitro and in vivo. We found that miR-221 was upregulated in HCC tissues, cell lines and blood of HCC patients. Upregulated miR-221 was associated with clinical TNM stage and tumor capsular infiltration, and showed poor prognosis, suggesting that its suppression could serve as an effective approach for hepatocellular carcinoma therapy. Treatment of HCC cells with nanoparticle/miR-221 inhibitor complexes suppressed their growth, colony formation ability, migration and invasion. In vivo, the growth of the tumors treated by the nanoparticle/miR-221 inhibitor complexes were significantly less than those treated by the nanoparticle/miRNA scramble complexes. In addition, circulating miR-221 may act as a potential tumor biomarker for early diagnosis of HCC, and combined serum miR-221 and AFP detection gave a better performance than individual detection in early diagnosis of HCC. These findings suggest that a nanoparticle-based miRNA delivery system could potentially serve as a safe and effective treatment and miR-221 could also be a potential diagnostic marker for HCC.
Santolla, Maria Francesca; Lappano, Rosamaria; Cirillo, Francesca; Rigiracciolo, Damiano Cosimo; Sebastiani, Anna; Abonante, Sergio; Tassone, Pierfrancesco; Tagliaferri, Pierosandro; Di Martino, Maria Teresa; Maggiolini, Marcello; Vivacqua, Adele
2018-05-02
MicroRNA (miRNAs) are non-coding small RNA molecules that regulate gene expression by inhibiting the translation of target mRNAs. Among several dysregulated miRNAs in human cancer, the up-regulation of miR-221 has been associated with development of a variety of hematologic and solid malignancies. In this study, we investigated the involvement of miR-221 in breast cancer. TaqMan microRNA assay was used to detect the miR-221 levels in normal cells and in MDA-MB 231 and SkBr3 breast cancer cells as well as in main players of the tumor microenvironment, namely cancer-associated fibroblasts (CAFs). miR-221 mimic sequence and locked nucleic acid (LNA)-i-miR-221 construct were used to induce or inhibit, respectively, the miR-221 expression in cells used. Quantitative PCR and western blotting analysis were performed to evaluate the levels of the miR-221 target gene A20 (TNFAIP3), as well as the member of the NF-kB complex namely c-Rel and the connective tissue growth factor (CTGF). Chromatin immunoprecipitation (ChIP) assay was performed to ascertain the recruitment of c-Rel to the CTFG promoter. Finally, the cell growth and migration in the presence of LNA-i-miR-221 or silencing c-Rel and CTGF by specific short hairpin were assessed by cell count, colony formation and boyden chambers assays. Statistical analysis was performed by ANOVA. We first demonstrated that LNA-i-miR-221 inhibits both endogenous and ectopic expression of miR-221 in our experimental models. Next, we found that the A20 down-regulation, as well as the up-regulation of c-Rel induced by miR-221 were no longer evident using LNA-i-miR-221. Moreover, we established that the miR-221 dependent recruitment of c-Rel to the NF-kB binding site located within the CTGF promoter region is prevented by using LNA-i-miR-221. Furthermore, we determined that the up-regulation of CTGF mRNA and protein levels by miR-221 is no longer evident using LNA-i-miR221 and silencing c-Rel. Finally, we assessed that cell growth and
12 CFR 221.110 - Questions arising under this part.
2010-01-01
... technical circumstances under which a loan is made. Instead, the fundamental purpose of the loan is... solely toward purchases of stock for speculative or investment purposes. The Board answered that a margin... Section 221.110 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL...
Garg, Shikha; Moore, Zack; Lee, Nicole; McKenna, John; Bishop, Amber; Fleischauer, Aaron; Springs, Chasisity B; Nguyen, Ha T; Sheu, Tiffany G; Sleeman, Katrina; Finelli, Lyn; Gubareva, Larisa; Fry, Alicia M
2013-03-15
During 2010-2011, influenza B viruses with a novel neuraminidase substitution, denoted I221V (B/I221V), associated with reduced in vitro oseltamivir susceptibility were detected in North Carolina. We determined the prevalence of I221V among B viruses submitted to the Centers for Disease Control and Prevention for antiviral resistance surveillance, including all B viruses submitted to North Carolina and South Carolina state laboratories, during October 2010-September 2011.We conducted chart reviews and telephone interviews to characterize North Carolina and South Carolina patients with B/I221V vs wild-type B virus infection (B/WT). We detected I221V in 45 (22%) of 209 B viruses from North Carolina and 8 (10%) of 82 B viruses from South Carolina. We detected I221V in 3 (0.3%) of 881 B viruses tested from 45 other states. B/I221V infection was not associated with differences in underlying conditions or illness severity, compared with B/WT infection. No patients with B/I221V infection received oseltamivir prior to specimen collection. Among patients who completed oseltamivir, those with B/I221V infection reported a longer duration until illness resolution (5 vs 3 days; P = .02). B/I221V cocirculated with B/WT in North Carolina and South Carolina during 2010-2011. I221V did not alter illness severity but may have reduced oseltamivir effectiveness. Thus, global surveillance for I221V is important.
20 CFR 645.221 - For what activities and services must local boards use contracts or vouchers?
2010-04-01
... vouchers are subject to the payment requirements at § 645.230(a)(3) of this subpart. If an operating entity... boards use contracts or vouchers? 645.221 Section 645.221 Employees' Benefits EMPLOYMENT AND TRAINING... vouchers? (a) Local boards and PIC's must provide the following activities and services through vouchers or...
International Nuclear Information System (INIS)
Zhang, Xiaoping; Mao, Haian; Chen, Jin-yuan; Wen, Shengjun; Li, Dan; Ye, Meng; Lv, Zhongwei
2013-01-01
Highlights: ► MicroRNA-221 is upregulated in the endothelial progenitor cells of atherosclerosis patients. ► PAK1 is a direct target of microRNA-221. ► MicroRNA-221 inhibits EPCs proliferation through c-Raf/MEK/ERK pathway. -- Abstract: Coronary artery disease (CAD) is associated with high mortality and occurs via endothelial injury. Endothelial progenitor cells (EPCs) restore the integrity of the endothelium and protect it from atherosclerosis. In this study, we compared the expression of microRNAs (miRNAs) in EPCs in atherosclerosis patients and normal controls. We found that miR-221 expression was significantly up-regulated in patients compared with controls. We predicted and identified p21/Cdc42/Rac1-activated kinase 1 (PAK1) as a novel target of miR-221 in EPCs. We also demonstrated that miR-221 targeted a putative binding site in the 3′UTR of PAK1, and absence of this site was inversely associated with miR-221 expression in EPCs. We confirmed this relationship using a luciferase reporter assay. Furthermore, overexpression of miR-221 in EPCs significantly decreased EPC proliferation, in accordance with the inhibitory effects induced by decreased PAK1. Overall, these findings demonstrate that miR-221 affects the MEK/ERK pathway by targeting PAK1 to inhibit the proliferation of EPCs
49 CFR 384.221 - Out-of-service regulations (intoxicating beverage).
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Out-of-service regulations (intoxicating beverage...) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY... Compliance by States § 384.221 Out-of-service regulations (intoxicating beverage). The State shall adopt, and...
Prospection for natural 231Pa in India
International Nuclear Information System (INIS)
Anupama, P.; Gantayet, L.M.; Verma, R.; Parthasarathy, R.; Anil Kumar, S.; Dingankar, M.V.; Ghosh, S.K.; Patra, R.N.
2001-08-01
Protactinium-231 ( 231 Pa) occurs in nature as a member of the decay chain of naturally occuring 235 U of the 4n+ 3 radioactive series. The expected protactinium concentration in the Jaduguda ore body (with uranium concentration of 0.03-0.06 %) is around 0.2 parts per billion (ppb) and that in monazite ore (uranium concentration 0.3%) is 0.9 ppb. The process at uranium ore processing plant at Jaduguda was studied. 231 Pa content in samples from the process streams of the plant was determined. The gamma ray spectrometry method was chosen and standardised in our laboratory to detect and measure 231 Pa in parts per billion levels in these samples. A concentrated source of protactinium could not be found among the assessed streams of Jaduguda uranium plant. The Monazite processing plant at IRE, Aluva was then studied. From the known chemistry of protactinium, the possible distribution of the 231 Pa was guessed at. Accordingly, the process streams of IRE process plant were selected to prospect for 231 Pa and determine the fractionation of protactinium. For analysis of 231 Pa, the thorium bearing samples were chemically treated to remove the thorium daughter products, which interfere in gamma spectrometry. This report describes the planning for prospecting, sample selection, the standardisation of the analysis procedure for determination of 231 Pa content, and the analysis results. The 231 Pa content in various streams of Indian Rare Earths plant was found in the range 0.2 -6.5 ppb. Some of the streams did not carry any protactinium. The fractionation of 231 Pa in the various streams of the plant and the selection of source for recovery of protactinium are discussed in detail. (author)
International Nuclear Information System (INIS)
Gilbert, R.O.; Simpson, J.C.; Engel, D.W.; Kinnison, R.R.
1984-03-01
For NS201 the estimated average 239 240 Pu to 241 Am ratios for vegetation and soil are 7.3 and 11.5, respectively, where the 241 Am data were obtained using wet chemistry. The geometric mean 90 Sr to 137 Cs ratios for vegetation and soil at NS201 are estimated to be 1.1 and 1.9. These results suggest that the true (population) median 239 240 Pu to 241 Am and 90 Sr to 137 Cs ratios are smaller for vegetation than for soil at NS201. For NS219 and NS221 the estimated average 239 240 Pu to 241 Am ratios for surface soil at NS219 and NS221 are 2.8 and 0.78, respectively. There is an obvious statistical difference in the average 239 240 Pu to 241 Am ratios at these sites. The geometric mean 239 240 Pu to 241 Am ratios for vegetation samples at NS219 and NS221 are estimated to be 3.2 and 0.82, respectively. The data suggest there may be a difference in the 239 240 Pu to 241 Am ratios for soil and vegetation at NS219, but not at NS221. The geometric mean 90 Sr to 137 Cs ratio for surface soil at NS219 and NS221 combined is 0.93. The geometric mean 90 Sr to 137 Cs ratio for vegetation for the two sites (pooled data) is estimated to be 1.8. 43 references, 42 figures, 7 tables
The 7-azanorbornane nucleus of epibatidine: 7-azabicyclo[2.2.1]heptan-7-ium chloride
Directory of Open Access Journals (Sweden)
Sergey N. Britvin
2017-09-01
Full Text Available 7-Azabicyclo[2.2.1]heptane (7-azanorbornane is a bridged heterocyclic nucleus found in epibatidine, the alkaloid isolated from the skin of the tropical poison frog Epipedobates tricolor. Since epibatidine is known as one of the most potent acetylcholine nicotinic receptor agonists, a plethora of literature has been devoted to this alkaloid. However, there are no structural data on the unsubstituted 7-azanorbornane, the parent bicyclic ring of epibatidine and its derivatives. We herein present the structural characterization of the 7-azabicyclo[2.2.1]heptane parent ring as its hydrochloride salt, namely 7-azabicyclo[2.2.1]heptan-7-ium chloride, C6H12N+·Cl−. The compete cation is generated by a crystallographic mirror plane with the N atom lying on the mirror, as does the chloride anion. In the crystal, the cations are linked to the anions by N—H...Cl hydrogen bonds, which generate [001] chains.
Yen, Katharine; Travins, Jeremy; Wang, Fang; David, Muriel D; Artin, Erin; Straley, Kimberly; Padyana, Anil; Gross, Stefan; DeLaBarre, Byron; Tobin, Erica; Chen, Yue; Nagaraja, Raj; Choe, Sung; Jin, Lei; Konteatis, Zenon; Cianchetta, Giovanni; Saunders, Jeffrey O; Salituro, Francesco G; Quivoron, Cyril; Opolon, Paule; Bawa, Olivia; Saada, Véronique; Paci, Angelo; Broutin, Sophie; Bernard, Olivier A; de Botton, Stéphane; Marteyn, Benoît S; Pilichowska, Monika; Xu, YingXia; Fang, Cheng; Jiang, Fan; Wei, Wentao; Jin, Shengfang; Silverman, Lee; Liu, Wei; Yang, Hua; Dang, Lenny; Dorsch, Marion; Penard-Lacronique, Virginie; Biller, Scott A; Su, Shin-San Michael
2017-05-01
Somatic gain-of-function mutations in isocitrate dehydrogenases ( IDH ) 1 and 2 are found in multiple hematologic and solid tumors, leading to accumulation of the oncometabolite ( R )-2-hydroxyglutarate (2HG). 2HG competitively inhibits α-ketoglutarate-dependent dioxygenases, including histone demethylases and methylcytosine dioxygenases of the TET family, causing epigenetic dysregulation and a block in cellular differentiation. In vitro studies have provided proof of concept for mutant IDH inhibition as a therapeutic approach. We report the discovery and characterization of AG-221, an orally available, selective, potent inhibitor of the mutant IDH2 enzyme. AG-221 suppressed 2HG production and induced cellular differentiation in primary human IDH2 mutation-positive acute myeloid leukemia (AML) cells ex vivo and in xenograft mouse models. AG-221 also provided a statistically significant survival benefit in an aggressive IDH2 R140Q -mutant AML xenograft mouse model. These findings supported initiation of the ongoing clinical trials of AG-221 in patients with IDH2 mutation-positive advanced hematologic malignancies. Significance: Mutations in IDH1/2 are identified in approximately 20% of patients with AML and contribute to leukemia via a block in hematopoietic cell differentiation. We have shown that the targeted inhibitor AG-221 suppresses the mutant IDH2 enzyme in multiple preclinical models and induces differentiation of malignant blasts, supporting its clinical development. Cancer Discov; 7(5); 478-93. ©2017 AACR. See related commentary by Thomas and Majeti, p. 459 See related article by Shih et al., p. 494 This article is highlighted in the In This Issue feature, p. 443 . ©2017 American Association for Cancer Research.
Lithium isotope effects in chemical exchange with (2,2,1) cryptand
International Nuclear Information System (INIS)
Jepson, B.E.; Cairns, G.A.
1979-01-01
Equilibrium single-stage separation factors were determined for three lithium - (2,2,1) cryptand two-phase chemical exchange systems. The equilibrated phases consisted of an aqueous solution of a lithium salt and a chloroform solution of lithium cryptate salt complex. Lithium-6 concentrated in the organic phase in all cases, and the lithium isotope exchange rate with (2,2,1) cryptand was rapid. The separation factors were α = 1.026 +- 0.006 (LiBr exchange), α = 1.035 +- 0.003 (LiTFA), and α = 1.041 +- 0.006 (LiTFA + HTFA), where TFA represents trifluoroacetate. These values were compared with separation factors of other lithium chemical exchange systems. This work has shown that separation factors are influenced by the choice of chemical species and parameters. It has also demonstrated that significant lithium isotope effects can be obtained without a valence change of the metal exchanging between the aquo and cryptate complexes
2010-10-01
... the 5925-6425 MHz (Earth-to-space) frequency band, operating with Geostationary Satellite Orbit (GSO) Satellites in the Fixed-Satellite Service. 25.221 Section 25.221 Telecommunication FEDERAL COMMUNICATIONS... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions for Earth Stations...
Goitia, Veronica; Oquendo, Marcial; Stratton, Robert
2015-01-01
Introduction. More than 60 cases of 7p22 duplications and deletions have been reported with over 16 of them occurring without concomitant chromosomal abnormalities. Patient and Methods. We report a 29-month-old male diagnosed with autism. Whole genome chromosome SNP microarray (REVEAL) demonstrated a 1.3?Mb interstitial duplication of 7p22.1 ->p22.1 arr 7p22.1 (5,436,367?6,762,394), the second smallest interstitial 7p duplication reported to date. This interval included 14 OMIM annotated gene...
International Nuclear Information System (INIS)
Baxter, J.T.
1998-01-01
This describes a test program to establish the in-situ material properties of the reinforced concrete in Building 221-U for comparison to the original design specifications. Field sampling and laboratory testing of concrete and reinforcing steel structural materials in Building 221-U for design verification will be undertaken. Forty seven samples are to be taken from radiologically clean exterior walls of the canyon. Laboratory testing program includes unconfined compressive strength of concrete cores, tensile strength of reinforcing steel, and petrographic examinations of concrete cores taken from walls below existing grade
49 CFR 173.221 - Polymeric beads, expandable and Plastic molding compound.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Polymeric beads, expandable and Plastic molding... Than Class 1 and Class 7 § 173.221 Polymeric beads, expandable and Plastic molding compound. (a) Non-bulk shipments of Polymeric beads (or granules), expandable, evolving flammable vapor and Plastic...
Directory of Open Access Journals (Sweden)
Neri Mercatelli
Full Text Available BACKGROUND: MiR-221 and miR-222 are two highly homologous microRNAs whose upregulation has been recently described in several types of human tumors, for some of which their oncogenic role was explained by the discovery of their target p27, a key cell cycle regulator. We previously showed this regulatory relationship in prostate carcinoma cell lines in vitro, underlying the role of miR-221/222 as inducers of proliferation and tumorigenicity. METHODOLOGY/PRINCIPAL FINDINGS: Here we describe a number of in vivo approaches confirming our previous data. The ectopic overexpression of miR-221 is able, per se, to confer a high growth advantage to LNCaP-derived tumors in SCID mice. Consistently, the anti-miR-221/222 antagomir treatment of established subcutaneous tumors derived from the highly aggressive PC3 cell line, naturally expressing high levels of miR-221/222, reduces tumor growth by increasing intratumoral p27 amount; this effect is long lasting, as it is detectable as long as 25 days after the treatment. Furthermore, we provide evidence in favour of a clinical relevance of the role of miR-221/222 in prostate carcinoma, by showing their general upregulation in patient-derived primary cell lines, where we find a significant inverse correlation with p27 expression. CONCLUSIONS/SIGNIFICANCE: These findings suggest that modulating miR-221/222 levels may have a therapeutic potential in prostate carcinoma.
Zheng, Xin; Zhao, Feng-Chao; Pang, Yong; Li, Dong-Ya; Yao, Sheng-Cheng; Sun, Shao-Song; Guo, Kai-Jin
2017-06-01
Osteoarthritis (OA) is characterized by degradation of chondrocyte extracellular matrix (ECM). Accumulating evidence suggests that microRNAs (miRNAs) are associated with OA, but little is known of their function in chondrocyte ECM degradation. The objective of this study was to investigate the expression and function of miRNAs in OA. miRNA expression profile was determined in OA cartilage tissues and controls, employing Solexa sequencing and reverse transcription quantitative PCR (RT-qPCR). According to a modified Mankin scale, cartilage degradation was evaluated. Functional analysis of the miRNAs on chondrocyte ECM degradation was performed after miRNA transfection and IL-1β treatment. Luciferase reporter assays and western blotting were employed to determine miRNA targets. Expression of miR-221-3p was downregulated in OA cartilage tissues, which was significantly correlated with a modified Mankin scale. Through gain-of-function and loss-of-function studies, miR-221-3p was shown to significantly affect matrix synthesis gene expression and chondrocyte proliferation and apoptosis. Using SW1353 and C28I2 cells, SDF1 was identified as a target of miR-221-3p. SDF1 overexpression resulted in increased expression of catabolic genes such as MMP-13 and ADAMTS-5 in response to IL-1β, but these effects were moderated by miR-221-3p. SDF1 treatment antagonized this effect, while knockdown of SDF1 by shSDF1 induced inhibitory effects on the expression of CXCR4 and its main target genes, similar to miR-221-3p. The results indicate that upregulation of miR-221-3p could prevent IL-1β-induced ECM degradation in chondrocytes. Targeting the SDF1/CXCR4 signaling pathway may be used as a therapeutic approach for OA. miR-221-3p is downregulated in human cartilage tissues. miR-221-3p levels are associated with cartilage degeneration grade. miR-221-3p upregulation prevents IL-1β-induced ECM degradation in chondrocytes. Protection of ECM degradation by miR-223-3p occurs via SDF1/CXCR4
12 CFR 221.5 - Special purpose loans to brokers and dealers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Special purpose loans to brokers and dealers... FEDERAL RESERVE SYSTEM CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) § 221.5 Special purpose loans to brokers and dealers. (a...
Fire modeling for Building 221-T - T Plant Canyon Deck and Railroad Tunnel
International Nuclear Information System (INIS)
Oar, D.L.
1994-01-01
This report was prepared by Hughes Associates, Inc. to document the results of fire models for building 221-T Canyon Deck and Railroad Tunnel. Backup data is contained in document No. WHC-SD-CP-ANAL-010, Rev. 0
Study on the adsorption of 233Pa in glass
International Nuclear Information System (INIS)
Natsumi, R.R.; Saiki, M.; Lima, F.W. de.
1982-08-01
It is intended to examine the adsorption of protactinium on glass in relation to pH, presence of complexing agents concentration and type of electrolytes. The study was made by using carrier-free 233 Pa solution and Pyrex glass tube was selected as adsorbent glass material surface. The adsorption curve of protactinium on glass surface as a function of the pH of the tracer solution showed the existence of two pronounced adsorption regions. It was found that this adsorption can be reduced by using electrolytes or complexing agents. Desorption of protactinium previously adsorbed on the Pyrex glass tube was also studied. Hidrochloric, oxalic and hydrofluoric acid solutions were used for the desorption experiments. (Author) [pt
Ren, Chaoqi; Yu, Mengmeng; Zhang, Yao; Fan, Minghui; Chang, Fangfang; Xing, Lixiao; Liu, Yongzhen; Wang, Yongqiang; Qi, Xiaole; Liu, Changjun; Zhang, Yanping; Cui, Hongyu; Li, Kai; Gao, Li; Pan, Qing; Wang, Xiaomei; Gao, Yulong
2018-04-23
Avian leukosis virus subgroup J (ALV-J), a highly oncogenic retrovirus, causes leukemia-like proliferative diseases in chickens. microRNAs post-transcriptionally suppress targets and are involved in the development of various tumors. We previously showed that miR-221 is upregulated in ALV-J-induced tumors. In this study, we analyzed the possible function of miR-221 in ALV-J tumorigenesis. The target validation system showed that CDKN1B is a target of miR-221 and is downregulated in ALV-J infection. As CDKN1B arrests the cell cycle and regulates its progression, we analyzed the proliferation of ALV-J-infected DF-1 cells. ALV-J-infection-induced DF1 cell derepression of G1/S transition and overproliferation required high miR-221 expression followed by CDKN1B downregulation. Cell cycle pathway analysis showed that ALV-J infection induced DF-1 cell overproliferation via the CDKN1B-CDK2/CDK6 pathway. Thus, miR-221 may play an important role in ALV-J-induced aggressive growth of DF-1 cells; these findings have expanded our insights into the mechanism underlying ALV-J infection and tumorigenesis. Copyright © 2018 Elsevier Inc. All rights reserved.
2010-10-01
... care of Hansen's disease patients and who continues to be assigned to such duty, shall receive special... 42 Public Health 1 2010-10-01 2010-10-01 false Duty at a station of the Service devoted to the care of Hansen's disease patients; additional pay. 22.1 Section 22.1 Public Health PUBLIC HEALTH...
Energy Technology Data Exchange (ETDEWEB)
Care, A; Bonci, D [Department of Haematology, Oncology and Molecular Medicine, Istituto Superiore di Sanita, Rome (Italy); Peschle, C [IRCCS MultiMedica, Milan (Italy)
2009-07-01
Micro RNAs (miRs) are small ({approx}22 nucleotides) non coding RNAs involved in gene expression, as negative regulators of specific mRNA targets. Growing evidences indicated miR functional roles in all the main biological processes, including cancer where they can act as oncogenes as well as tumor suppressor genes. Several studies reported the involvement of miR- 221 and -222 in the induction and/or progression of different neoplasias. We have analyzed miR-221/-222 functional role in a panel of differently staged melanoma cell lines and primary bioptic samples, showing their capabilities to regulate two distinct, but functionally convergent pathways of melanocyte transformation through the cell cycle inhibitor p27Kip and c-kit receptor. We also demonstrated the lack of the tumor suppressor gene PLZF as a direct cause of miR-221/-222 up regulation in melanoma cells. In vitro and, more important, in vivo studies confirmed that suppression of miR-221/-222 strongly reduced melanoma growth and dissemination.
International Nuclear Information System (INIS)
Care, A.; Bonci, D.; Peschle, C.
2009-01-01
Micro RNAs (miRs) are small (∼22 nucleotides) non coding RNAs involved in gene expression, as negative regulators of specific mRNA targets. Growing evidences indicated miR functional roles in all the main biological processes, including cancer where they can act as oncogenes as well as tumor suppressor genes. Several studies reported the involvement of miR- 221 and -222 in the induction and/or progression of different neoplasias. We have analyzed miR-221/-222 functional role in a panel of differently staged melanoma cell lines and primary bioptic samples, showing their capabilities to regulate two distinct, but functionally convergent pathways of melanocyte transformation through the cell cycle inhibitor p27Kip and c-kit receptor. We also demonstrated the lack of the tumor suppressor gene PLZF as a direct cause of miR-221/-222 up regulation in melanoma cells. In vitro and, more important, in vivo studies confirmed that suppression of miR-221/-222 strongly reduced melanoma growth and dissemination
International Nuclear Information System (INIS)
Dittmer, L.M.
2006-01-01
The 100-B-22:1 pipelines and associated soils were part of the 100-B Area water treatment facilities. The 100-B-22:1 waste site is limited to those pipelines that interconnected the 185-B Filter House, the 126-B-2 Clearwells, the 185-B Deaeration Plant, and the 190-B Process Pumphouse. None of the 100-B-22:1 pipelines carried environmentally significant contamination. In accordance with the historical information and field observations of this evaluation, the results support a reclassification of this site to No Action required to meet future rural-residential uses and be protective of groundwater and the Columbia River
Directory of Open Access Journals (Sweden)
Kai Fang
2015-09-01
Full Text Available Background & Aims: Substance P (SP, a neuropeptide member of the tachykinin family, plays a critical role in colitis. MicroRNAs (miRNAs are small noncoding RNAs that negatively regulate gene expression. We examined whether SP modulates expression of microRNAs in human colonic epithelial cells. Methods: We performed microRNA profiling analysis of SP-stimulated human colonic epithelial NCM460 cells overexpressing neurokinin-1 receptor (NCM460-NK-1R. Targets of SP-regulated microRNAs were validated by real-time polymerase chain reaction (RT-PCR. Functions of miRNAs were tested in NCM460-NK-1R cells and the trinitrobenzene sulfonic acid (TNBS and dextran sulfate sodium (DSS models of colitis. Results: SP stimulated differential expression of 29 microRNAs, including miR-221-5p, the highest up-regulated miR (by 12.6-fold upon SP stimulation. Bioinformatic and luciferase reporter analyses identified interleukin-6 receptor (IL-6R mRNA as a direct target of miR-221-5p in NCM460 cells. Accordingly, SP exposure of NCM460-NK-1R cells increased IL-6R mRNA expression, and overexpression of miR-221-5p reduced IL-6R expression. Nuclear factor κB and c-Jun N-terminal kinase inhibition decreased SP-induced miR-221-5p expression. MiR-221-5p expression was increased in both TNBS- and DSS-induced colitis and in colonic biopsy samples from ulcerative colitis but not Crohnâs disease patients compared with controls. In mice, intracolonic administration of a miR-221-5p chemical inhibitor exacerbated TNBS- and DSS-induced colitis and increased colonic tumor necrosis factor-α, C-X-C motif chemokine 10 (Cxcl10, and collagen, type II, α 1 (Col2α1 mRNA expression. In situ hybridization in TNBS- and DSS-exposed colons revealed increased miR-221-5p expression primarily in colonocytes. Conclusions: Our results reveal a novel NK-1R-miR-221-5p-IL-6R network that protects from colitis. The use of miR-221-5p mimics may be a promising approach for colitis
A genotype-phenotype analysis of the 8q22.1 variant in migraine with aura
DEFF Research Database (Denmark)
Esserlind, A-L; Kirchmann, M; Hauge, A W
2012-01-01
-2002 and 2005-2006, and diagnosed according to the International Classification of Headache Disorders (ICHD-II) using a validated physician-conducted semi-structured interview. A large number of clinical characteristics were systematically determined. Caucasians of Danish ancestry diagnosed with MA...... and migraine. The aim of this study is to evaluate the association of clinical characteristics in migraine with aura (MA) with the newly discovered minor allele A of rs1835740 at 8q22.1. Methods: Participants were recruited from the Danish Headache Center and from specialist practices during the periods 1999......-significant tendency towards milder migraine headache characteristics and fewer accompanying symptoms. These tendencies were not increased in homozygote carriers. Conclusion: None of the clinical characteristics of MA were significantly influenced by the common susceptibility variant on 8q22.1....
Energy Technology Data Exchange (ETDEWEB)
Di Giandomenico, M.V
2007-10-15
Protactinium is experiencing a renewal of interest in the frame of long-term energy production. Modelling the behaviour of this element in the geosphere requires thermodynamic and structural data relevant to environmental conditions. Now deep clayey formation are considered for the disposal of radioactive waste and high values of natural sulphate contents have been determined in pore water in equilibrium with clay surface. Because of its tendency to polymerisation, hydrolysis and sorption on all solid supports, the equilibria constants relative to monomer species were determined at tracer scale (ca. 10 - 12 M) with {sup 233}Pa. The complexation constants of Pa(V) and sulphate ions were calculated starting from a systematic study of the apparent distribution coefficient D in the system TTA/Toluene/H{sub 2}O/Na{sub 2}SO{sub 4}/HClO{sub 4}/NaClO{sub 4} and as a function of ionic strength, temperature, free sulphate, protons and chelatant concentration. First of all, the interaction between free species H{sup +}, SO{sub 4}{sup -}, Na{sup +} leads to the formation of HSO{sub 4}{sup -} and NaSO{sub 4}{sup -}, for which concentrations depend upon the related thermodynamic constants. For this purpose a computer code was developed in order to determine all free species concentration. This iterative code takes into account the influence of temperature and ionic strength (SIT modelling) on thermodynamic constants. The direct measure of Pa(V) in the organic and aqueous phase by g-spectrometry had conducted to estimate the apparent distribution coefficient D as function of free sulphate ions. Complexation constants have been determined after a mathematical treatment of D. The extrapolation of these constants at zero ionic strength have been realized by SIT modelling at different temperatures. Besides, enthalpy and entropy values were calculated. Parallelly, the structural study of Pa(V) was performed using 231 Pa. XANES and EXAFS spectra show unambiguously the absence of the
2010-07-01
...-methylethylidene)bisphenol and 2,2-[(1-methylethylidene)bis(4,1-phe-ny-lene-oxy-methyl-ene)]-bi-sox-i- rane, graft... Substances § 721.7160 2-Oxepanone, polymer with 4,4′-(1-methylethylidene)bisphenol and 2,2-[(1... new uses subject to reporting. (1) The chemical substance 2-oxepanone, polymer with 4,4′(1-meth-yl-eth...
The puzzling interpretation of NIR indices: The case of NaI2.21
Röck, B.; Vazdekis, A.; La Barbera, F.; Peletier, R. F.; Knapen, J. H.; Allende-Prieto, C.; Aguado, D. S.
2017-01-01
We present a detailed study of the Na I line strength index centred in the K band at 22 100 Å (NaI2.21 hereafter) relying on different samples of early-type galaxies. Consistent with previous studies, we find that the observed line strength indices cannot be fit by state-of-the-art scaled-solar
Energy Technology Data Exchange (ETDEWEB)
Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Anglada-Escude, Guillem; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015-1305 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Wende, Sebastian, E-mail: parriaga@astro.puc.cl [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, D-37077 Goettingen (Germany)
2013-07-01
We report two low-mass companions orbiting the nearby K7 dwarf GJ 221 that have emerged from reanalyzing 4.4 yr of publicly available HARPS spectra complemented with 2 years of high-precision Doppler measurements with Magellan/PFS. The HARPS measurements alone contain the clear signal of a low-mass companion with a period of 125 days and a minimum mass of 53.2 M{sub Circled-Plus} (GJ 221b), falling in a mass range where very few planet candidates have been found (sub-Saturn desert). The addition of 17 PFS observations allows the confident detection of a second low-mass companion (6.5 M{sub Circled-Plus }) in a hot orbit (3.87 day period, GJ 221c). Spectroscopic and photometric calibrations suggest that GJ 221 is slightly depleted ([Fe/H] {approx} -0.1) compared to the Sun, so the presence of two low-mass companions in the system confirms the trend that slightly reduced stellar metallicity does not prevent the formation of planets in the super-Earth to sub-Saturn mass regime.
Galardi, Silvia; Mercatelli, Neri; Giorda, Ezio; Massalini, Simone; Frajese, Giovanni Vanni; Ciafrè, Silvia Anna; Farace, Maria Giulia
2007-08-10
MicroRNAs are short regulatory RNAs that negatively modulate protein expression at a post-transcriptional level and are deeply involved in the pathogenesis of several types of cancers. Here we show that miR-221 and miR-222, encoded in tandem on chromosome X, are overexpressed in the PC3 cellular model of aggressive prostate carcinoma, as compared with LNCaP and 22Rv1 cell line models of slowly growing carcinomas. In all cell lines tested, we show an inverse relationship between the expression of miR-221 and miR-222 and the cell cycle inhibitor p27(Kip1). We recognize two target sites for the microRNAs in the 3' untranslated region of p27 mRNA, and we show that miR-221/222 ectopic overexpression directly results in p27 down-regulation in LNCaP cells. In those cells, we demonstrate that the ectopic overexpression of miR-221/222 strongly affects their growth potential by inducing a G(1) to S shift in the cell cycle and is sufficient to induce a powerful enhancement of their colony-forming potential in soft agar. Consistently, miR-221 and miR-222 knock-down through antisense LNA oligonucleotides increases p27(Kip1) in PC3 cells and strongly reduces their clonogenicity in vitro. Our results suggest that miR-221/222 can be regarded as a new family of oncogenes, directly targeting the tumor suppressor p27(Kip1), and that their overexpression might be one of the factors contributing to the oncogenesis and progression of prostate carcinoma through p27(Kip1) down-regulation.
49 CFR 1544.221 - Carriage of prisoners under the control of armed law enforcement officers.
2010-10-01
... Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY: AIR CARRIERS AND COMMERCIAL OPERATORS Operations § 1544.221 Carriage... custody of an armed law enforcement officer aboard an aircraft for which screening is required unless, in...
Directory of Open Access Journals (Sweden)
Veronica Goitia
2015-01-01
Full Text Available Introduction. More than 60 cases of 7p22 duplications and deletions have been reported with over 16 of them occurring without concomitant chromosomal abnormalities. Patient and Methods. We report a 29-month-old male diagnosed with autism. Whole genome chromosome SNP microarray (REVEAL demonstrated a 1.3 Mb interstitial duplication of 7p22.1 ->p22.1 arr 7p22.1 (5,436,367–6,762,394, the second smallest interstitial 7p duplication reported to date. This interval included 14 OMIM annotated genes (FBXL18, ACTB, FSCN1, RNF216, OCM, EIF2AK1, AIMP2, PMS2, CYTH3, RAC1, DAGLB, KDELR2, GRID2IP, and ZNF12. Results. Our patient presented features similar to previously reported cases with 7p22 duplication, including brachycephaly, prominent ears, cryptorchidism, speech delay, poor eye contact, and outburst of aggressive behavior with autism-like features. Among the genes located in the duplicated segment, ACTB gene has been proposed as a candidate gene for the alteration of craniofacial development. Overexpression of RNF216L has been linked to autism. FSCN1 may play a role in neurodevelopmental disease. Conclusion. Characterization of a possible 7p22.1 Duplication Syndrome has yet to be made. Recognition of the clinical spectrum in patients with a smaller duplication of 7p should prove valuable for determining the minimal critical region, helping delineate a better prediction of outcome and genetic counseling
Strain in epitaxial high-index Bi{sub 2}Se{sub 3}(221) films grown by molecular-beam epitaxy
Energy Technology Data Exchange (ETDEWEB)
Li, Bin [Physics Department, The University of Hong Kong, Pokfulam Road (Hong Kong); Chen, Weiguang [College of Physics and Electronic Engineering, Henan Normal University, Xinxiang, Henan 453007 (China); School of Physics and Electronic Engineering, Zhengzhou Normal University, Zhengzhou, Henan 450044 (China); Guo, Xin; Ho, Wingkin [Physics Department, The University of Hong Kong, Pokfulam Road (Hong Kong); Dai, Xianqi [College of Physics and Electronic Engineering, Henan Normal University, Xinxiang, Henan 453007 (China); School of Physics and Electronic Engineering, Zhengzhou Normal University, Zhengzhou, Henan 450044 (China); Jia, Jinfeng [Key Laboratory of Artificial Structures and Quantum Control (Ministry of Education), Collaborative Innovation Center of Advanced Microstructures, Department of Physics and Astronomy, Shanghai Jiaotong University, 800 Dongchuan Road, Shanghai 200240 (China); Xie, Maohai, E-mail: mhxie@hku.hk [Physics Department, The University of Hong Kong, Pokfulam Road (Hong Kong)
2017-02-28
Highlights: • High-index, off c-axis, Bi{sub 2}Se{sub 3} has been grown by molecular beam epitaxy on In{sub 2}Se{sub 3}. • A retarded strain relaxation process in such high-index Bi{sub 2}Se{sub 3} is observed, enabling experimentally probe strain effect on topological insulators. • It has been shown by calculation that the Dirac electrons participate in chemical bonding at the heterointerface. - Abstract: High-index Bi{sub 2}Se{sub 3}(221) film has been grown on In{sub 2}Se{sub 3}-buffered GaAs(001), in which a much retarded strain relaxation dynamics is recorded. The slow strain-relaxation process of in epitaxial Bi{sub 2}Se{sub 3}(221) can be attributed to the layered structure of Bi{sub 2}Se{sub 3} crystal, where the epifilm grown along [221] is like a pile of weakly-coupled quintuple layer slabs stacked side-by-side on substrate. Finally, we reveal strong chemical bonding at the interface of Bi{sub 2}Se{sub 3} and In{sub 2}Se{sub 3} by plotting differential charge contour calculated by first-principle method. This study points to the feasibility of achieving strained TIs for manipulating the properties of topological systems.
2010-01-01
... OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.221 How does OPM compute...
Knoll, Marko
2012-01-01
MicroRNAs regulieren komplexe Genexpressions Programme von Zellen auf post-transkriptionaler Ebene. Ich habe gefunden, dass miR-128a, 221 und 222 in zwei nah ver-wandten Stadien der B-Zellentwicklung in der Maus unterschiedlich exprimiert sind: hoch in Pax5-/- CD19- pro/präB Zellen und niedrig in Pax5+/+ CD19+ präB-I Zellen. Die Ex-pression von miR-221 und 222, aber nicht die von 128a, wird durch Pax5 Expression kon-trolliert. Überexpression von diesen miRNAs in Wildtyp präB-I durch Transdukt...
Schindler, Corinna S; Carreira, Erick M
2009-11-01
This critical review showcases examples of rapid formation of complexity in total syntheses starting from 7-oxabicyclo[2.2.1]hept-5-ene derivatives. An overview of methods allowing synthetic access to these building blocks is provided and their application in recently developed synthetic transformations to structurally complex systems is illustrated. In addition, the facile access to a novel oxabicyclo[2.2.1]heptene derived building block is presented which significantly enlarges the possibilities of previously known chemical transformations and is highlighted in the enantioselective route to the core of the banyaside and suomilide natural products (107 references).
Energy Technology Data Exchange (ETDEWEB)
Jaussaud, Ch
2003-01-01
Hydrolysis of protactinium (V) according to the reactions: PaO(OH){sup 2+} +H{sub 2}O {r_reversible} PaO(OH){sub 2}{sup +} + H{sup +} (K{sub 2}] PaO(OH){sup 2+} +2H{sub 2}O {r_reversible} PaO(OH){sub 5} + H{sup +} (K{sub 3}) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na{sup +}/H{sup +}/ClO{sub 4}{sup -} system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients {epsilon}{sub (i,j)} as well as the Pitzer parameters {beta}{sup (0)} and {beta}{sup (1)} were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)
Galardi, Silvia; Mercatelli, Neri; Farace, Maria G.; Ciafrè, Silvia A.
2011-01-01
MicroRNAs (miRNAs) are potent negative regulators of gene expression involved in all aspects of cell biology. They finely modulate virtually all physiological pathways in metazoans, and are deeply implicated in all main pathologies, among which cancer. Mir-221 and miR-222, two closely related miRNAs encoded in cluster from a genomic region on chromosome X, are strongly upregulated in several forms of human tumours. In this work, we report that the ectopic modulation of NF-kB modifies miR-221/222 expression in prostate carcinoma and glioblastoma cell lines, where we had previously shown their oncogenic activity. We identify two separate distal regions upstream of miR-221/222 promoter which are bound by the NF-kB subunit p65 and drive efficient transcription in luciferase reporter assays; consistently, the site-directed mutagenesis disrupting p65 binding sites or the ectopical inhibition of NF-kB activity significantly reduce luciferase activity. In the most distal enhancer region, we also define a binding site for c-Jun, and we show that the binding of this factor cooperates with that of p65, fully accounting for the observed upregulation of miR-221/222. Thus our work uncovers an additional mechanism through which NF-kB and c-Jun, two transcription factors deeply involved in cancer onset and progression, contribute to oncogenesis, by inducing miR-221/222 transcription. PMID:21245048
2010-01-01
... forms for small business issuers; and incorporation of Regulation FD (Fair Disclosure). 335.221 Section... forms for small business issuers; and incorporation of Regulation FD (Fair Disclosure). (a) The.... Industry Guide 3, Statistical Disclosure by Bank Holding Companies, is codified at 17 CFR 229.802. (c) A...
Autophosphorylation of JAK2 on Tyrosines 221 and 570 Regulates Its Activity
Argetsinger, Lawrence S.; Kouadio, Jean-Louis K.; Steen, Hanno; Stensballe, Allan; Jensen, Ole N.; Carter-Su, Christin
2004-01-01
The tyrosine kinase JAK2 is a key signaling protein for at least 20 receptors in the cytokine/hematopoietin receptor superfamily and is a component of signaling by insulin receptor and several G-protein-coupled receptors. However, there is only limited knowledge of the physical structure of JAK2 or which of the 49 tyrosines in JAK2 are autophosphorylated. In this study, mass spectrometry and two-dimensional peptide mapping were used to determine that tyrosines 221, 570, and 1007 in JAK2 are a...
Fragrance material review on 1-(3,3-dimethylbicyclo[2.2.1]hept-2-yl)ethane-1-one.
Scognamiglio, J; Letizia, C S; Api, A M
2013-12-01
A toxicologic and dermatologic review of 1-(3,3-dimethylbicyclo[2.2.1]hept-2-yl)ethane-1-one when used as a fragrance ingredient is presented. 1-(3,3-Dimethylbicyclo[2.2.1]hept-2-yl)ethane-1-one is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all available toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for 1-(3,3-dimethylbicyclo[2.2.1]hept-2-yl)ethane-1-one were evaluated then summarized and includes physical properties, skin irritation, mucous membrane (eye) irritation, and skin sensitization data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (Belsito, D., Bickers, D., Bruze, M., Calow, P., Dagli, M., Fryer, A.D., Greim, H., Miyachi, Y., Saurat, J.H., Sipes, I.G., 2013. A Toxicologic and Dermatologic Assessment of Alkyl Cyclic Ketones When Used as Fragrance Ingredients (submitted for publication) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.
12 CFR 221.106 - Reliance in “good faith” on statement of purpose of loan.
2010-01-01
..., under that paragraph a lending bank may accept such statement only if it is “acting in good faith.” As the Board stated in the interpretation contained in § 221.101, the “requirement of ‘good faith’ is of...) Furthermore, the same requirement of “good faith” is to be applied whether the statement accepted by the bank...
25 CFR 1000.221 - Can the Secretary grant a waiver of regulations to a Tribe/Consortium?
2010-04-01
..., DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.221 Can the Secretary grant a... 25 Indians 2 2010-04-01 2010-04-01 false Can the Secretary grant a waiver of regulations to a...
Parity violation in proton-proton scattering at 221 MeV
International Nuclear Information System (INIS)
Berdoz, A.R.; Birchall, J.; Bland, J.B.; Campbell, J.R.; Green, A.A.; Hamian, A.A.; Lee, L.; Page, S.A.; Ramsay, W.D.; Reitzner, S.D.; Sekulovich, A.M.; Sum, V.; Oers, W.T.H. van; Woo, R.J.; Bowman, J.D.; Mischke, R.E.; Coombes, G.H.; Helmer, R.; Kadantsev, S.; Levy, C.D.P.
2003-01-01
TRIUMF experiment 497 has measured the parity-violating longitudinal analyzing power A z in p(vector sign)p elastic scattering at 221.3 MeV incident proton energy. This comprehensive paper includes details of the corrections, some of magnitude comparable to A z itself, required to arrive at the final result. The largest correction was for the effects of first moments of transverse polarization. The addition of the result, A z =[0.84±0.29 (stat.)±0.17 (syst.)]x10 -7 , to the p(vector sign)p parity-violation experimental data base greatly improves the experimental constraints on the weak meson-nucleon coupling constants h ρ pp and h ω pp , and also has implications for the interpretation of electron parity-violation experiments
Dual Selectivity Expressed in [2+2+1] Dynamic Clipping of Unsymmetrical [2]Catenanes
Energy Technology Data Exchange (ETDEWEB)
Liu, Yi
2010-06-11
A {pi}-templated dynamic [2+2+1] clipping protocol is established for the synthesis of [2]catenanes from two parts dialdehyde, two parts diamine and one part tetracationic cyclophane. It is further diversified for the selective formation of an unsymmetrical [2]catenane showing great translational selectivity by employing two different dialdehydes in a one-pot reaction. The dual selectivity and the dynamic nature are verified by {sup 1}H NMR spectroscopy, X-ray single crystal structural studies and exchange experiments.
Tănase, Constantin I; Drăghici, Constantin; Căproiu, Miron Teodor; Shova, Sergiu; Mathe, Christophe; Cocu, Florea G; Enache, Cristian; Maganu, Maria
2014-01-01
An amine group was synthesized starting from an optically active bicyclo[2.2.1]heptane compound, which was then used to build the 5 atoms ring of a key 6-chloropurine intermediate. This was then reacted with ammonia and selected amines obtaining new adenine- and 6-substituted adenine conformationally constrained carbocyclic nucleoside analogues with a bicyclo[2.2.1]heptane skeleton in the sugar moiety. X-ray crystallography confirmed an exo-coupling of base to the ring and a L configuration of the nucleoside analogues. The compounds were tested for anticancer activity. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Dalvi Rupa
2016-01-01
Full Text Available BACKGROUND: Balanced non-robertsonian translocation (RT, involving acrocentric chromosomes, is a rare event and only a few cases are reported. Most of the RTs are balanced involving acrocentric chromosomes with the breakpoints (q10;q10. MATERIALS AND METHODS: Chromosome analysis was performed as per standard procedure – Giemsa-trypsin banding with 500 band resolution was analyzed for chromosome identification. RESULTS: In the present study, we report a rare balanced non-RTs involving chromosomes 13 and 15 with cytogenetic finding of 46, XX, t(13;15(p11.2;q22.1. CONCLUSION: To the best of our knowledge, this is the first such report of an unusual non-RT of t(13:15 with (p11.2;q22.1 break points.
Jin, Xiaoxin; Cai, Lifeng; Wang, Changfa; Deng, Xiaofeng; Yi, Shengen; Lei, Zhao; Xiao, Qiangsheng; Xu, Hongbo; Luo, Hongwu; Sun, Jichun
2018-02-23
Hepatocellular carcinoma is one of the most common solid tumors in the digestive system. The prognosis of patients with hepatocellular carcinoma is still poor due to the acquisition of multi-drug resistance. TNF Related Apoptosis Inducing Ligand (TRAIL), an attractive anticancer agent, exerts its effect of selectively inducing apoptosis in tumor cells through death receptors and the formation of the downstream death-inducing signaling complex, which activates apical caspases 3/8 and leads to apoptosis. However, hepatocellular carcinoma cells are resistant to TRAIL. Non-coding RNAs, including long non-coding RNAs (lncRNAs) and miRNAs have been regarded as major regulators of normal development and diseases, including cancers. Moreover, lncRNAs and miRNAs have been reported to be associated with multi-drug resistance. In the present study, we investigated the mechanism by which TRAIL resistance of hepatocellular carcinoma is affected from the view of non-coding RNA regulation. We selected and validated candidate miRNAs, miR-24 and miR-221, that regulated caspase 3/8 expression through direct targeting, and thereby affecting TRAIL-induced tumor cell apoptosis TRAIL resistance of hepatocellular carcinoma. In addition, we revealed that CASC2, a well-established tumor suppressive long non-coding RNA, could serve as a "Sponge" of miR-24 and miR-221, thus modulating TRAIL-induced tumor cell apoptosis TRAIL resistance of hepatocellular carcinoma. Taken together, we demonstrated a CASC2/miR-24/miR-221 axis, which can affect the TRAIL resistance of hepatocellular carcinoma through regulating caspase 3/8; through acting as a "Sponge" of miR-24 and miR-221, CASC2 may contribute to improving hepatocellular carcinoma TRAIL resistance, and finally promoting the treatment efficiency of TRAIL-based therapies.
Rakha, Emad A; Armour, John A L; Pinder, Sarah E; Paish, Claire E; Ellis, Ian O
2005-05-01
Loss of the chromosomal material at 16q22.1 is one of the most frequent genetic aberrations found in both lobular and low-grade nonlobular invasive carcinoma of the breast, indicating the presence of a tumour suppressor gene (TSG) at this region in these tumours. However, the TSG (s) at the 16q22.1 in the more frequent nonlobular carcinomas is still unknown. Multiplex Amplifiable Probe Hybridisation (MAPH) is a simple, accurate and a high-resolution technique that provides an alternative approach to DNA copy-number measurement. The aim of our study was to examine the most likely candidate genes at 16q22.1 using MAPH assay combined with protein expression analysis by immunohistochemistry. We identified deletion at 16q22.1 that involves some or all of these genes. We also noticed that the smallest region of deletion at 16q22.1 could be delineated to a 3 Mb region centromeric to the P-cadherin gene. Apart from the correlation between E-cadherin protein expression and its gene copy number, no correlation was detected between the expression of E2F-4, CTCF, TRF2 or P-cadherin with their gene's copy number. In the malignant tissues, no significant loss or decrease of protein expression of any gene other than E-cadherin was seen in association with any specific tumour type. No expression of VE-cadherin or Ksp-cadherin was detected in the normal and/or malignant tissues of the breast in these cases. However, there was a correlation between increased nuclear expression of E2F-4 and tumours with higher histological grade (p = 0.04) and positive lymph node disease (p = 0.02), suggesting that it may have an oncogenic rather than a tumour suppressor role. The malignant breast tissues also showed abnormal cytoplasmic cellular localisation of CTCF, compared to its expression in the normal parenchymal cells. In conclusion, we have demonstrated that MAPH is a potential technique for assessment of genomic imbalances in malignant tissues. Although our results support E-cadherin as the
2010-01-01
... experience that in some nonqualified plans, particularly stock purchase plans, the credit arrangement is... financing of stock options and stock purchase rights qualified or restricted under Internal Revenue Code... PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.119 Applicability of plan-lender...
Technical basis for removal of 221-T tunnel from airborne radiological area status
International Nuclear Information System (INIS)
Geuther, W.J.
1996-01-01
This document provides the technical basis for removal of the 221-T Tunnel from airborne radiological control. T Plant Radiological Control has evaluated air sampling data and engineering controls, and determined the necessary administrative controls to make this transition. With these administrative controls (specified within document) in place, the tunnel can be removed from Airborne Radioactive Area status. The removal of the tunnel from airborne status will allow work to be performed within the tunnel under controlled conditions, as outlined in this technical basis, without the use of respiratory protection equipment
26 CFR 1.221-1 - Deduction for interest paid on qualified education loans after December 31, 2001.
2010-04-01
... Individuals § 1.221-1 Deduction for interest paid on qualified education loans after December 31, 2001. (a) In... interest paid by the taxpayer during the taxable year on a qualified education loan. See paragraph (b)(4... paid on qualified education loans after December 31, 2001, in taxable years ending after December 31...
International Nuclear Information System (INIS)
Butabaev, Yu.S.
1994-01-01
The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs
The transmutation of bogwera in Luke 2:21 in the 1857 English-Setswana Bible
Directory of Open Access Journals (Sweden)
Itumeleng D. Mothoagae
2017-09-01
Full Text Available In her article on ‘translating ngaka’ (diviner-healer, Musa Dube argues that in the writings of Robert Moffat and subsequently in his translation of the Bible into Setswana, the person of the ngaka, rather than being portrayed as occupying a central and positive role in Setswana culture, is relegated to a marginal position and is even depicted as evil and an imposter. The article seeks to argue that firstly, there is a fundamental connection between ngaka and bogwera in Setswana tradition. This is because ngaka performed the rite of initiation and was a central figure in the circumcision (rupa of those undergoing the rite of imitation. Secondly, in his 1857 English–Setswana Bible Moffat alters the word bogwera in Luke 2:21. In representing and translating bogwera as circumcision in Luke 2:21 Moffat rewrites and reorders the political, economic and religious beliefs of Batswana. It is in the transmogrification of bogwera in Luke 2:21 that an act of hybridisation and creolisation takes place through the ordering of the Batswana cosmology and culture. I would further argue that not only did this marginalisation colour the perceptions of the Batswana regarding bogwera, but also that the translated text was used as a tool to disrupt, marginalise, replace, subvert and colonise the spiritual spaces of the Batswana. Furthermore, the article attempts to critically engage with the translated text from an ideological criticism within postcolonial theory, engaging with the fundamental question: why did Moffat translate and alter bogwera as circumcision rather than using the proper word which is rupa (circumcision? Selected letters published in the newspaper Mahoko a Becwana (Words of Batswana are quoted and discussed, as it is in these letters that we are confronted with an act of hybridisation and creolisation. The letters also point to the effects of such a translation and transmogrification as a discursive tool to reorder and to
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Copies of tariffs made from filer's printer... Electronically Filed Tariffs § 221.550 Copies of tariffs made from filer's printer(s) located in Department's... obtained by any user at Departmental Headquarters from the printer or printers placed in Tariff Public...
DEFF Research Database (Denmark)
Shaposhnikov, Sergey A.; Akopov, Sergey B.; Chernov, Igor P.
2007-01-01
There is abundant evidence that the DNA in eukaryotic cells is organized into loop domains that represent basic structural and functional units of chromatin packaging. To explore the DNA domain organization of the breast cancer loss-of-heterozygosity region on human chromosome 16q22.1, we have...... in the region are regulated and of how the structural architecture and functional organization of the DNA are related....... identified a significant portion of the scaffold/matrix attachment regions (S/MARs) within this region. Forty independent putative S/MAR elements were assigned within the 16q22.1 locus. More than 90% of these S/MARs are AT rich, with GC contents as low as 27% in 2 cases. Thirty-nine (98%) of the S...
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Bank loans to purchase stock of American...) Interpretations § 221.114 Bank loans to purchase stock of American Telephone and Telegraph Company under Employees' Stock Plan. (a) The Board of Governors interpreted this part in connection with proposed loans by a bank...
Kemeny, Nancy; Kingham, T. Peter; Allen, Peter J.; D’Angelica, Michael I.; DeMatteo, Ronald P.; Betel, Doron; Klimstra, David; Jarnagin, William R.; Ventura, Andrea
2016-01-01
Background MicroRNAs (miRNAs) are potential biomarkers in various malignancies. We aim to characterize miRNA expression in intrahepatic cholangiocarcinoma (ICC) and identify circulating plasma miRNAs with potential diagnostic and prognostic utility. Methods Using deep-sequencing techniques, miRNA expression between tumor samples and non-neoplastic liver parenchyma were compared. Overexpressed miRNAs were measured in plasma from an independent cohort of patients with cholangiocarcinoma using RT-qPCR and compared with that healthy volunteers. The discriminatory ability of the evaluated plasma miRNAs between patients and controls was evaluated with receiving operating characteristic (ROC) curves. Results Small RNAs from 12 ICC and 11 tumor-free liver samples were evaluated. Unsupervised hierarchical clustering using the miRNA expression data showed clear grouping of ICC vs. non-neoplastic liver parenchyma. We identified 134 down-regulated and 128 upregulated miRNAs. Based on overexpression and high fold-change, miR21, miR200b, miR221, and miR34c were measured in plasma from an independent cohort of patients with ICC (n = 25) and healthy controls (n = 7). Significant overexpression of miR-21 and miR-221 was found in plasma from ICC patients. Furthermore, circulating miR-21 demonstrated a high discriminatory ability between patients with ICC and healthy controls (AUC: 0.94). Conclusion Among the differentially expressed miRNAs in ICC, miR-21 and miR-221 are overexpressed and detectable in the circulation. Plasma expression levels of these miRNAs, particularly miR-21, accurately differentiates patients with ICC from healthy controls and could potentially serve as adjuncts in diagnosis. Prospective validation and comparison with other hepatobiliary malignancies is required to establish their potential role as diagnostic and prognostic biomarkers. PMID:27685844
2010-04-01
... Individuals § 1.221-2 Deduction for interest due and paid on qualified education loans before January 1, 2002... interest due and paid by the taxpayer during the taxable year on a qualified education loan. The deduction is allowed only with respect to interest due and paid on a qualified education loan during the first...
Energy Technology Data Exchange (ETDEWEB)
Chesne, A; Regnaut, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1955-07-01
Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [French] Description des conditions de separation du thorium, de l'uranium 233 et du protactinium 233 en solution chlorhydrique par absorption puis elution selective sur resine echangeuse d'anions. Une precipitation du thoriun par l'acide oxalique permet la recuperation de l'acide chlorhydrique qui est recycle, la principale matiere premiere consommee etant l'acide oxalique. (auteurs)
Studies of α-spectra in 221Fr, 217At, 213Bi and 213Po decays
International Nuclear Information System (INIS)
Chumin, V.G.; Fominykh, V.I.; Furyaev, T.A.; Gromov, K.Ya.; Jabber, J.K.; Kalyapkin, K.V.; Kudrya, S.A.; Tsupko-Sitnikov, V.V.
1997-01-01
The alpha-recoil phenomenon is used to gain data on the weak components of the α-spectra of the nuclides from the 225 Ac equilibrium chain. It is established that there is no experimental basis for introducing the 450 keV level of 213 Bi in the 217 At decay and the 868 keV level of 209 Tl in the 213 Bi decay. Excitation of the 759 keV level in the 217 At decay is confirmed. The intensities of the 221 Fr, 217 At and 213 Bi β - -decay are measured
Directory of Open Access Journals (Sweden)
Mulatinho Milene
2012-06-01
Full Text Available Abstract Background Recently, array-comparative genomic hybridization (aCGH platforms have significantly improved the resolution of chromosomal analysis allowing the identification of genomic copy number gains and losses smaller than 5 Mb. Here we report on a young man with unexplained severe mental retardation, autism spectrum disorder, congenital malformations comprising hypospadia and omphalocele, and episodes of high blood pressure. An ~ 6 Mb interstitial deletion that includes the causative genes is identified by oligonucleotide-based aCGH. Results Our index case exhibited a de novo chromosomal abnormality at 2q22 [del(2(q22.1q22.3dn] which was not visible at the 550 haploid band level. The deleted region includes eight genes: HNMT, SPOPL, NXPH2, LOC64702, LRP1B, KYNU, ARHGAP15 and GTDC1. Discussion aCGH revealed an ~ 6 Mb deletion in 2q22.1 to 2q22.3 in an as-yet unique clinical case associated with intellectual disability, congenital malformations and autism spectrum disorder. Interestingly, the deletion is co-localized with a fragile site (FRA2K, which could be involved in the formation of this chromosomal aberration. Further studies are needed to determine if deletions of 2q22.1 to 2q22.3 define a new microdeletion syndrome.
Aneurysm-Specific miR-221 and miR-146a Participates in Human Thoracic and Abdominal Aortic Aneurysms
Directory of Open Access Journals (Sweden)
Premakumari Venkatesh
2017-04-01
Full Text Available Altered microRNA expression is implicated in cardiovascular diseases. Our objective was to determine microRNA signatures in thoracic aortic aneurysms (TAAs and abdominal aortic aneurysms (AAAs compared with control non-aneurysmal aortic specimens. We evaluated the expression of fifteen selected microRNA in human TAA and AAA operative specimens compared to controls. We observed significant upregulation of miR-221 and downregulation of miR-1 and -133 in TAA specimens. In contrast, upregulation of miR-146a and downregulation of miR-145 and -331-3p were found only for AAA specimens. Upregulation of miR-126 and -486-5p and downregulation of miR-30c-2*, -155, and -204 were observed in specimens of TAAs and AAAs. The data reveal microRNA expression signatures unique to aneurysm location and common to both thoracic and abdominal pathologies. Thus, changes in miR-1, -29a, -133a, and -221 are involved in TAAs and miR-145, -146, and -331-3p impact AAAs. This work validates prior studies on microRNA expression in aneurysmal diseases.
Energy Technology Data Exchange (ETDEWEB)
Freedman, Vicky L.; Zhang, Z. F.; Keller, Jason M.; Chen, Yousu
2007-05-30
This report documents numerical flow and transport simulations performed that establish initial waste acceptance criteria for the potential waste streams that may be safely sequestered in the 221-U Building and similar canyon structures. Specifically, simulations were executed to identify the maximum loading of contaminant mass (without respect to volume) that can be emplaced within the 221-U Building with no more than 1 pCi/m2 of contaminant migrating outside the structure within a 1,000 year time period. The initial scoping simulations were executed in one dimension to assess important processes, and then two dimensions to establish waste acceptance criteria. Two monolithic conditions were assessed: (1) a grouted canyon monolith; and (2) a canyon monolith filled with sand, both assuming no cracks or fissures were present to cause preferential transport. A three-staged approach was taken to account for different processes that may impact the amount of contaminant that can be safely sequestered in canyon structure. In the first stage, flow and transport simulations established waste acceptance criteria based on a linear (Kd) isotherm approach. In the second stage, impacts on thermal loading were examined and the differences in waste acceptance criteria quantified. In the third stage of modeling, precipitation/dissolution reactions were considered on the release and transport of the contaminants, and the subsequent impact on the maximum contaminant loading. The reactive transport modeling is considered a demonstration of the reactive transport capability, and shows the importance of its use for future performance predictions once site-specific data have been obtained.
Attachments for fire modeling for Building 221-T, T Plant canyon deck and railroad tunnel
International Nuclear Information System (INIS)
Oar, D.L.
1995-01-01
The purpose of this attachment is to provide historical information and documentation for Document No. WHC-SD-CP-ANAL-008 Rev 0, ''Fire Modeling for Building 221-T--T Plant Canyon Deck and Railroad Tunnel'', dated September 29, 1994. This data compilation contains the following: Resumes of the Technical Director, Senior Engineer and Junior Engineer; Review and Comment Record; Software Files; CFAST Input and Output Files; Calculation Control Sheets; and Estimating Sprinkler Actuation Time in the Canyon and Railroad Tunnel. The T Plant was originally a fuel reprocessing facility. It was modified later to decontaminate and repair PuRex process equipment
Directory of Open Access Journals (Sweden)
Feng Cheng
2017-01-01
Full Text Available RNA-binding proteins (RBPs and miRNAs are capable of controlling processes in normal development and cancer. Both of them could determine RNA transcripts fate from synthesis to decay. One such RBP, Dead end (Dnd1, is essential for regulating germ-cell viability and suppresses the germ-cell tumors development, yet how it exerts its functions in breast cancer has remained unresolved. The level of Dnd1 was detected in 21 cancerous tissues paired with neighboring normal tissues by qRT-PCR. We further annotated TCGA (The Cancer Genome Atlas mRNA expression profiles and found that the expression of Dnd1 and Bim is positively correlated (p=0.04. Patients with higher Dnd1 expression level had longer overall survival (p=0.0014 by KM Plotter tool. Dnd1 knockdown in MCF-7 cells decreased Bim expression levels and inhibited apoptosis. While knockdown of Dnd1 promoted the decay of Bim mRNA 3′UTR, the stability of Bim-5′UTR was not affected. In addition, mutation of miR-221-binding site in Bim-3′UTR canceled the effect of Dnd1 on Bim mRNA. Knockdown of Dnd1 in MCF-7 cells confirmed that Dnd1 antagonized miR-221-inhibitory effects on Bim expression. Overall, our findings indicate that Dnd1 facilitates apoptosis by increasing the expression of Bim via its competitive combining with miR-221 in Bim-3′UTR. The new function of Dnd1 may contribute to a vital role in breast cancer development.
2010-02-23
... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...
MOX-fuel inherent proliferation-protection due to {sup 231}Pa admixture
Energy Technology Data Exchange (ETDEWEB)
Kryuchkov, E.F.; Glebov, V.B.; Apse, V.A.; Shmelev, A.N. [Moscow Engineering Physics Institute (State University), Moscow (Russian Federation)
2003-07-01
The proliferation protection levels of MOX-fuel containing small additions of protactinium are evaluated for equilibrium closed and open cycles of a light-water reactor (LWR).Analysis of the ways to the proliferation protection of MOX-fuel by small {sup 231}Pa addition and comparison of this way with another options for giving MOX-fuel the proliferation self-protection property enable us to make the 3 following conclusions: -1) Unique nature of protactinium as a small addition to MOX-fuel is determined by the following properties: - Protactinium is available in the nature (uranium ore) as a long-lived mono-isotope {sup 231}Pa, - under neutron irradiation, {sup 231}Pa is converted into {sup 232}U, which is a long-term source of high energy gamma-radiation and practically non-separable from main fuel mass, - essentially, {sup 231}Pa is a high-quality burnable neutron absorber. -2) From the proliferation self-protection point of view, nuclear fuel cycle closure with fuel recycle is a preferable option because, under this condition, introduction of protactinium into MOX-fuel allows to create the inherent radiation barrier which is in action during full cycle of fuel management at the level corresponding to the accepted today criterion of the Spent Fuel Standard (SFS). In particular, the considered example of multiple MOX-fuel recycle with small addition of {sup 231}Pa (0.2% HM) at each cycle demonstrates a possibility to reach the proliferation protection level of fresh MOX-fuel corresponding to once irradiated fuel with the same cooling time. In this case, the lethal dose (at 30 cm distance from fuel assembly) is received within the minute range. -3) Introduction of {sup 231}Pa into MOX-fuel composition in amount of 0.5% HM allows to prolong action of the SFS from 100 to 200 years. If {sup 231}Pa content is increased up to 5% HM, then MOX-fuel conserves the proliferation self-protection property in respect to short-term unauthorized actions for 200-year period of its
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
Bae, Ji-Eun; Kim, In Jung; Nam, Ki Hyun
2017-11-04
Many fluorescent proteins (FPs) exhibit fluorescence quenching at a low pH. This pH-induced non-fluorescent state of an FP serves as a useful indicator of the cellular pH. ZsYellow is widely used as an optical marker in molecular biology, but its pH-induced non-fluorescent state has not been characterized. Here, we report the pH-dependent spectral properties of ZsYellow, which exhibited the pH-induced non-fluorescence state at a pH below 4.0. We determined the crystal structures of ZsYellow at pH 3.5 (non-fluorescence state) and 8.0 (fluorescence state), which revealed the cis-configuration of the chromophore without pH-induced isomerization. In the non-fluorescence state, Arg95, which is involved in stabilization of the exited state of the chromophore, was found to more loosely interact with the carbonyl oxygen atom of the chromophore when compared to the interaction at pH 8.0. In the fluorescence state, Glu221, which is involved in the hydrogen bonding network around the chromophore, stably interacted with Gln42 and His202. By contrast, in the non-fluorescence state, the protonated conserved Glu221 residue exhibited a large conformational change and was separated from His202 by 5.46 Å, resulting in breakdown of the hydrogen bond network. Our results provide insight into the critical role of the conserved Glu221 residue for generating the pH-induced non-fluorescent state. Copyright © 2017 Elsevier Inc. All rights reserved.
Synthesis of 1-Methyl-3-oxo-7-oxabicyclo[2.2.1]hept-5-ene-2-carboxylic Acid Methyl Ester
Directory of Open Access Journals (Sweden)
Gil Valdo José da Silva
2005-11-01
Full Text Available A simple and efficient method for the preparation of 1-methyl-3-oxo-7- oxabicyclo[2.2.1]hept-5-en-2-carboxylic acid methyl ester (1 is described. The first step is a highly regioselective Diels-Alder reaction between 2-methylfuran and methyl-3-bromo- propiolate. A remarkably difficult ketal hydrolysis reaction was effected by treatment with HCl, a simple reagent that was shown to be more efficient, in this case, than commonly used more elaborate methods.
International Nuclear Information System (INIS)
Zeeneldin, A.A.; Salem, S.E.; Ibrahim, A.A.; Tabashy, R.H.; Alieldin, N.H.
2013-01-01
Background: Hepatocellular carcinoma (HCC) is a major health problem in Egypt as well as in many countries. Trans arterial chemo embolization (TACE) is a treatment modality applicable to locally advanced HCC beyond surgery or ablative therapies and is associated with survival improvements. The aim of this study was to assess the outcomes of TACE in our center over the past four years. Methods: This is a retrospective cohort study that included 221 patients with locally advanced HCC treated with TACE in a single center between the years 2007 and 2010. The median age was 57 years with male predominance. Liver cirrhosis, viral hepatitis and Bilharziasis were encountered in 64%, 31% and 8% of patients, respectively. Abdominal pain was the most common presenting symptom (67%). Most cases were diagnosed based on radiology (57%) with a TNM stage I or II (73%) and a median AFP value of 150 ng/m L. Results: 221 patients received 440 cycles of TACE with a median of 2 cycles per patient. Cisplatin and doxorubicin (50 mg per cycle, each) were the most commonly used drugs. Impaired liver function was the most common toxicity. Liver cell failure occurred in 17% of patients. An objective tumor response was achieved in 44% of cases. The median overall survival (OS) was 16 months (95% Cl, 13-19 months) and the median progression free survival (PFS) was 6 months (95% Cl, 4.3-7.8 months). Responding patients, Child-Pugh class A and patients receiving standard doses of chemotherapy had a significantly better OS than their counterparts. Only Child-Pugh class A was associated with significantly longer PFS (p < 0.001). Conclusion: TACE produces reasonable responses and fair survival rates in locally advanced HCC but with noticeable toxicities. Proper patients selection and prompt liver support are mandates for improving TACE outcomes.
Directory of Open Access Journals (Sweden)
Ryoichi Tanaka
Full Text Available Although many chemotherapeutic strategies against cancer have been developed, pancreatic cancer is one of the most aggressive and intractable types of malignancies. Therefore, new strategies and anti-cancer agents are necessary to treat this disease. Metformin is a widely used drug for type-2 diabetes, and is also known as a promising candidate anti-cancer agent from recent studies in vitro and in vivo. However, the mechanisms of metformin's anti-cancer effects have not been elucidated. We demonstrated that metformin suppressed the expression of miR-221, one of the most well-known oncogenic microRNAs, in human pancreatic cancer PANC-1 cells. Moreover, we showed that the down-regulation of miR-221 by metformin caused G1-phase arrest via the up-regulation of p27, one of the direct targets of miR-221. Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL is also a promising agent for cancer treatment. While recent studies showed that treatment with only TRAIL was not effective against pancreatic cancer cells, the present data showed that metformin sensitized p53-mutated pancreatic cancer cells to TRAIL. Metformin induced the expressions of death receptor 5 (DR5, a receptor for TRAIL, and Bim with a pro-apoptotic function in the downstream of TRAIL-DR5 pathway. We suggest that the up-regulation of these proteins may contribute to sensitization of TRAIL-induced apoptosis. The combination therapy of metformin and TRAIL could therefore be effective in the treatment of pancreatic cancer.
Feasibility studies of thermonuclear neutron capture synthesis of SHE
International Nuclear Information System (INIS)
Meldner, H.W.
1978-01-01
A variety of thermonuclear neutron sources and neutron capture targets were investigated for their potential of allowing signigicant production of heavy, perhaps superheavy, isotopes. The neutron sources considered range from inertial confinement microexplosives to (underground) macroexplosives. Optimal capture targets appear to be composites containing uranium and protactinium. 1 figure
Pombo-Villar, E.; Wiederhold, K.-H.; Mengod, G.; Palacios, J.M.; Supavilai, P.; Boddeke, H.W.G.M.
1992-01-01
The preparation and the biological activities of the four stereoisomers of 3-[5-(3-amino-1,2,5-oxadiazol)yl]-1-azabicyclo [2.2.1]heptane are described. The most potent stereoisomer, 3a, has the 3R,4R configuration, and in vitro activities in (pD2(% efficacy): ileum 8.8 (87%), hippocampus 9.8 (116%)
POMBOVILLAR, E; WIEDERHOLD, KH; MENGOD, G; PALACIOS, JM; SUPAVILAI, P; BODDEKE, HWGM
1992-01-01
The preparation and the biological activities of the four stereoisomers of 3-[5-(3-amino-1,2,4-oxadiazol)yl]-1-azabicyclo [2.2.1]heptane are described. The most potent stereoisomer, 3a, has the 3R,4R configuration, and in vitro activities in (pD2(% efficacy): ileum 8.8 (87%), hippocampus 9.8 (116%)
Induction of resistance to rice tungro virus disease in rice cultivar Pusa 2-21 through irradiation
International Nuclear Information System (INIS)
Mathur, S.C.; Rao, M.; Prakash, Jitendra
1979-01-01
The dry seeds of Pusa 2-21, a moderately resistant rice cultivar, were subjected to 10, 15 and 20 Krad (dose rate 12.3 Krad/min) radiation dosages of gamma rays to induce resistance against rice tungro virus disease. The height of M 1 seedling was significantly reduced in 15 and 20 Krad treatments. However, there was no effect of gamma irradiation on seed germination. A limited population of M 2 and M 3 generation was screened at the rate of 3 viruliferous leafhoppers/seedling using single plant caging technique. In M 2 generation 22.0, 17.6 and 25.0 percent seedlings exhibited green colour (symptomless) representing resistant reaction to the disease in 10, 15 and 20 Krad treatments, respectively. Out of 1470 seedlings in M 3 generation, 2.7 percent seedlings showing no symptoms of tungro could be isolated indicating the possibility of inducing higher degree of resistance than that of the parent to RTV through irradiation for the first time. (auth.)
Vogt, Julia; Wernstedt, Annekatrin; Ripperger, Tim; Pabst, Brigitte; Zschocke, Johannes; Kratz, Christian; Wimmer, Katharina
2016-11-01
Biallelic PMS2 mutations are responsible for more than half of all cases of constitutional mismatch repair deficiency (CMMRD), a recessively inherited childhood cancer predisposition syndrome. The mismatch repair gene PMS2 is partly embedded within one copy of an inverted 100-kb low-copy repeat (LCR) on 7p22.1. In an individual with CMMRD syndrome, PMS2 was found to be homozygously inactivated by a complex chromosomal rearrangement, which separates the 5'-part from the 3'-part of the gene. The rearrangement involves sequences of the inverted 100-kb LCR and a human endogenous retrovirus element and may be associated with an inversion that is indistinguishable from the known inversion polymorphism affecting the ~0.7-Mb sequence intervening the LCR. Its formation is best explained by a replication-based mechanism (RBM) such as fork stalling and template switching/microhomology-mediated break-induced replication (FoSTeS/MMBIR). This finding supports the hypothesis that the inverted LCR can not only facilitate the formation of the non-allelic homologous recombination-mediated inversion polymorphism but it also promotes the occurrence of more complex rearrangements that can be associated with a large inversion, as well, but are mediated by a RBM. This further suggests that among the inversion polymorphism on 7p22.1, more complex rearrangements might be hidden. Furthermore, as the locus is embedded in a common fragile site (CFS) region, this rearrangement also supports the recently raised hypothesis that CFS sequence motifs may facilitate replication-based rearrangement mechanisms.
Molten salt reactors: chemistry
International Nuclear Information System (INIS)
1983-01-01
This work is a critical analysis of the 1000 MW MSBR project. Behavior of rare gases in the primary coolant circuit, their extraction from helium. Coating of graphite by molybdenum, chemistry of protactinium and niobium produced in the molten salt, continuous reprocessing of the fuel salt and use of stainless steel instead of hastelloy are reviewed [fr
REGENERATION OF FISSION-PRODUCT-CONTAINING MAGNESIUM-THORIUM ALLOYS
Chiotti, P.
1964-02-01
A process of regenerating a magnesium-thorium alloy contaminated with fission products, protactinium, and uranium is presented. A molten mixture of KCl--LiCl-MgCl/sub 2/ is added to the molten alloy whereby the alkali, alkaline parth, and rare earth fission products (including yttrium) and some of the thorium and uranium are chlorinated and
A ±6 ms-Accuracy, 0.68 mm2, and 2.21 μW QRS Detection ASIC
Directory of Open Access Journals (Sweden)
Sheng-Chieh Huang
2012-01-01
Full Text Available Healthcare issues arose from population aging. Meanwhile, electrocardiogram (ECG is a powerful measurement tool. The first step of ECG is to detect QRS complexes. A state-of-the-art QRS detection algorithm was modified and implemented to an application-specific integrated circuit (ASIC. By the dedicated architecture design, the novel ASIC is proposed with 0.68 mm2 core area and 2.21 μW power consumption. It is the smallest QRS detection ASIC based on 0.18 μm technology. In addition, the sensitivity is 95.65% and the positive prediction of the ASIC is 99.36% based on the MIT/BIH arrhythmia database certification.
Energy Technology Data Exchange (ETDEWEB)
Chumakov, Yu. M. [Academy of Sciences of Moldova, Institute of Applied Physics (Moldova, Republic of); Paholnitcaia, A. Yu. [State University of Moldova (Moldova, Republic of); Petrenko, P. A. [Academy of Sciences of Moldova, Institute of Applied Physics (Moldova, Republic of); Tsapkov, V. I., E-mail: vtsapkov@gmail.com [State University of Moldova (Moldova, Republic of); Poirier, D. [Centre Hospitalier Universitaire de Quebec (Canada); Gulea, A. P. [State University of Moldova (Moldova, Republic of)
2015-01-15
Two crystal modifications of nitrato-(2-[2-(1-pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) aquacopper (I and II) and two modifications of chloro-(2-[2-phenyl(pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) copper (III and IV) have been synthesized and studied by X-ray diffraction. In structures I and II, the copper atoms coordinate a monodeprotonated molecule of the organic ligand, nitrate ions, and a water molecule. In crystals of I, the complexes are monomeric, whereas complexes II are linked via nitrate ions to form polymeric chains. In both structures the coordination polyhedron of the copper atom can be described as a distorted tetragonal bipyramid—(4 + 1 + 1) in I and (4 + 2) in II. These coordination polyherdra have different compositions. In structures III and IV, the metal atoms coordinate a monodeprotonated (2-[2-phenyl(pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazole molecule and chloride ions. In III the complex-forming ion has square-planar coordination geometry, whereas structure IV consists of centrosymmetric dimers with two bridging chlorine atoms. It was found that nitrato-(2-[2-(1-pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) aquacopper possesses antitumor activity.
Properties of Group Five and Group Seven transactinium elements
International Nuclear Information System (INIS)
Wilk, Philip A.
2001-01-01
The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150
Phthalocyaninato complexes of thorium, protactinium and uranium
International Nuclear Information System (INIS)
Beck, O.F.
1985-01-01
For the preparation of Bis(phthalocyaninato)-actinoid(IV) complexes, AnPc 2 , a new optimizing synthesis procedure was developed, with which it was possible to prepare spectrally pure, that is, H 2 Pc-free, ThPc 2 , UPc 2 and the isostructurally similar 231 PaPc 2 .PaPc 2 . This was verified with the help of electron spectra, which were compared to preparations which were synthesized in another manner. The corresponding perfluorinated compounds were also produced for thorium and uranium by use of tetrafluorophthalic acid nitrile instead of phthalic acid nitrile as initial product. Electron and infrared spectra show the typical bands of the non-substituted complexes. By the attempt to produce a mono(phthalocyaninato)-thorium complex with the use of ThI 4 as initial material a pyridine-extracted pure ThPcI 2 (py) 2 was obtained with a typical mono(phthalocyaninato) complex electron spectrum, an extremely moisture sensitive compound which in water or acids decomposes and produces H 2 Pc. (orig./RB) [de
Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221F-HET/Drums
Energy Technology Data Exchange (ETDEWEB)
Lunsford, G.F.
1998-10-26
Since beginning operations in 1954, the Savannah River Site FB-Line produced Weapons Grade Plutonium for the United States National Defense Program. The facility mission was mainly to process dilute plutonium solution received from the 221-F Canyon into highly purified plutonium metal. As a result of various activities (maintenance, repair, clean up, etc.) in support of the mission, the facility generated a transuranic heterogeneous debris waste stream. Prior to January 25, 1990, the waste stream was considered suspect mixed transuranic waste (based on potential for inclusion of F-Listed solvent rags/wipes) and is not included in this characterization. Beginning January 25, 1990, Savannah River Site began segregation of rags and wipes containing F-Listed solvents thus creating a mixed transuranic waste stream and a non-mixed transuranic waste stream. This characterization addresses the non-mixed transuranic waste stream packaged in 55-gallon drums after January 25, 1990.Characterization of the waste stream was achieved using knowledge of process operations, facility safety basis documentation, facility specific waste management procedures and storage / disposal records. The report is fully responsive to the requirements of Section 4.0 "Acceptable Knowledge" from the WIPP Transuranic Waste Characterization Quality Assurance Plan, CAO-94-1010, and provides a sound, (and auditable) characterization that satisfies the WIPP criteria for Acceptable Knowledge.
An extraction method of uranium 233 from the thorium irradiates in a reactor core
International Nuclear Information System (INIS)
Chesne, A.; Regnaut, P.
1955-01-01
Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [fr
Radioactivity studies. Progress report, January 1-December 31, 1982
International Nuclear Information System (INIS)
Cohen, N.
1983-06-01
During the last year, the research program in actinide biokinetics in nonhuman primates has been expanded to include preliminary studies of the element neptunium. Recently, Np-237, which is known to be present in high-level nuclear reactor waste, has received increased attention as a potential long-range hazard to man. In addition to the neptunium studies, the metabolism of protactinium-233, the daughter of Np-237, has been investigated. Although characterization of Pa-233 metabolism was originally conducted in order to correct for Pa-233 interference during in vivo and in vitro gamma spectrometry of Np-237, several other considerations indicated that Pa might be of radiological concern itself and should thereby warrant further investigation. Due to the limited amount of data in the literature defining the biokinetics of both neptunium and protactinium, metabolis studies of these nuclides are now being conducted in adult female baboons in a manner similar to that which has been successfully performed at this laboratory for Am-241 and Cm-243,244. Procedures routinely performed include external whole-body counting, excreta collection (separation and measurement), blood sampling, biopsies of liver and bone, and complete tissue and organ analysis after sacrifice
Gilbert, Zachary W; Hue, Ryan J; Tonks, Ian A
2016-01-01
Pyrroles are structurally important heterocycles. However, the synthesis of polysubstituted pyrroles is often challenging. Here, we report a multicomponent, Ti-catalysed formal [2+2+1] reaction of alkynes and diazenes for the oxidative synthesis of penta- and trisubstituted pyrroles: a nitrenoid analogue to classical Pauson-Khand-type syntheses of cyclopentenones. Given the scarcity of early transition-metal redox catalysis, preliminary mechanistic studies are presented. Initial stoichiometric and kinetic studies indicate that the mechanism of this reaction proceeds through a formally Ti(II)/Ti(IV) redox catalytic cycle, in which an azatitanacyclobutene intermediate, resulting from [2+2] alkyne + Ti imido coupling, undergoes a second alkyne insertion followed by reductive elimination to yield pyrrole and a Ti(II) species. The key component for catalytic turnover is the reoxidation of the Ti(II) species to a Ti(IV) imido via the disproportionation of an η(2)-diazene-Ti(II) complex.
Properties of Group Five and Group Seven transactinium elements
Energy Technology Data Exchange (ETDEWEB)
Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)
2001-05-01
The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was
Directory of Open Access Journals (Sweden)
Regina Ferreira Rezek
2014-01-01
Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.
The f electron collapse revisited
International Nuclear Information System (INIS)
Bennett, B.I.
1987-03-01
A reexamination of the collapse of 4f and 5f electrons in the lanthanide and actinide series is presented. The calculations show the well-known collapse of the f electron density at the thresholds of these series along with an f 2 collapse between thorium and protactinium. The collapse is sensitive to the choice of model for the exchange-correlation potential and the behavior of the potential at large radius
A guide to ventilation requirements for uranium mines and mills. Regulatory guide G-221
International Nuclear Information System (INIS)
2003-06-01
The purpose of G-221 is to help persons address the requirements for the submission of ventilation-related information when applying for a Canadian Nuclear Safety Commission (CNSC) licence to site and construct, operate or decommission a uranium mine or mill. This guide is also intended to help applicants for a uranium mine or mill licence understand their operational and maintenance obligations with respect to ventilation systems, and to help CNSC staff evaluate the adequacy of applications for uranium mine and mill licences. This guide is relevant to any application for a CNSC licence to prepare a site for and construct, operate or decommission a uranium mine or mill. In addition to summarizing the ventilation-related obligations or uranium mine and mill licensee, the guide describes and discusses the ventilation-related information that licence applicants should typically submit to meet regulatory requirements. The guide pertains to any ventilation of uranium mines and mills for the purpose of assuring the radiation safety of workers and on-site personnel. This ventilation may be associated with any underground or surface area or premise that is licensable by the CNSC as part of a uranium mine or mill. These areas and premises typically include mine workings, mill buildings, and other areas or premises involving or potentially affected by radiation or radioactive materials. Some examples of the latter include offices, effluent treatment plants, cafeterias, lunch rooms and personnel change-rooms. (author)
Directory of Open Access Journals (Sweden)
Andrea Cristina Zanetti
2016-06-01
Full Text Available Article 221 of the Brazilian Civil Code defines the form of evidence to provethe obligations between contracting parties, asserting that just the existence of contract signed by the parties, which are in the free disposal of theirs property, it´s enough to be proven the obligatory relationship between them, independent the adjusted value of the obligation. As noted, the Brazilian Civil Code of 2002 no longer requires that the contracts need to be signed by two witnesses to attest their existence and binding force between the parties. However, Article 784, item III, of Rule n. 13.105/15 (new Civil Procedure Code which will come into force in March 2016, makes it clear that it will only be considered extrajudicial title of the executionaction the particular document signed by the debtor and two (2 witnesses, keeping the expression of Art.585, item II of the CPC/1973. In this sense, one can say that art. 784 of Rule No. 13.105/15 would be contradicting the terms of Art. 221 of the Civil Code/2002? After all,the new Civil Procedure Code requires the presence of two witnesses in private documents (contracts in general. We would be facing an antinomy? This academic paperanalyzesthese issues, contributing to the study of antinomy between the rules of Civil Code and the new Civil Procedure Code, without conclude all the questions related a potential antinomies between these two legislations. These are issues that need tobe carefullyreviewedby the jurist, in searches, for the future solutions.
Directory of Open Access Journals (Sweden)
Adrià Cases Ibáñez
2015-12-01
Full Text Available Review to Enric Pujol (ed. & Òscar Jané (est., Antologia de memòries i dietaris personals catalans sobre la Guerra de Successió, Barcelona, Institut d’Estudis Catalans, 2014, 286 pp. ISBN: 978-84-9965-221-4
Preparation of protactinium measurement source by electroplating method
International Nuclear Information System (INIS)
Li Zongwei; Yang Weifan; Fang Keming; Yuan Shuanggui; Guo Junsheng; Pan Qiangyan
1998-01-01
An electroplating method for the preparation of Pa sources is described, and the main factors (such as pH value of solution, electroplating time and current density) influencing the electroplating of Pa are tested and discussed with 233 Pa as a tracer. A thin and uniform electroplating Pa-Layer of 1 mg/cm 2 thick on thin stainless steel disk was obtained. The Pa source was measured by a HPGe detector to determine the chemical efficiency
Directory of Open Access Journals (Sweden)
Kinya Okamoto
Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.
Energy Technology Data Exchange (ETDEWEB)
Boulay, P [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes
1968-04-01
The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [French] L'utilisation a une echelle de plus en plus large du plutonium-239 pose un probleme de la mesure de la contamination par aerosol au niveau du poumon. Une methode de mesure directe de la charge pulmonaire en plutonium-239 est possible grace a l'utilisation d'un compteur proportionnel a fenetre de grande surface. Un compteur de ce type a specialement ete realise dans ce but. La mise au point de l'appareillage permet une sensibilite suffisante pour deceler une contamination au niveau de la Q.M.A (quantite maximale admissible). D'autre part, une methode 'd'etalonnage interne' de l'individu a l'aide d'un simulateur de plutonium, le protactinium-233, est decrite. (auteur)
Determination of thorium in native gold by radiochemical neutron activation analysis
International Nuclear Information System (INIS)
Liu, Y.; Kraehenbuehl, U.
1995-01-01
Thorium concentrations in 11 native gold samples from different sources, e.g. placer gold, vein and lode gold were determined. Thorium was determined by radiochemical separation and measurement of protactinium from irradiated native gold samples. The chemical yield of the separation procedures is 90%. Other elements were measured by gamma-ray spectroscopy. The radiochemical separation procedures described in this work make accurate determination of Th concentrations in native gold at picogram concentrations possible. (orig.)
Marçalo, Joaquim; Gibson, John K.
2009-09-01
An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.
International Nuclear Information System (INIS)
Bagnall, K.W.
1987-01-01
This chapter of coordination compound chemistry is devoted to the actinides and starts with a general survey. Most of the chapter relates to thorium and uranium but protactinium, neptunium and plutonium are included. There are sections on nitrogen, phosphorus, sulfur, selenium, tellurium and halogen ligands of the metals in their +3, +4, +5 and +6 oxidation states and of the transplutonium elements in their +2, +3, +4, and +5 oxidation states. (UK)
International Nuclear Information System (INIS)
Goodman, P.; Miller, P.
1993-01-01
The discovery of a series of layer-perovskite superconducting compounds by Maeda et al. (1988) presented a challenge for present day electron diffraction techniques, due to their common occurrence as mixed phases, and the existence of complex structural modulations of more than one type. Cowley's (1976) theory developed specifically for describing diffraction effects from layered crystals having a micro-domainal sub-structure seems particularly well suited to the task of solving these structures, while the technique of extended-crystal diffraction is shown here to be capable of providing data of sufficient precision for this analysis. The present study is made on the 221 compound of PbBiSrCaCuO. Using the above diffraction techniques it is shown that the true symmetry of the whole structure is orthorhombic, Amaa, and not monoclinic as previously assumed, and that the superlattice reflections arise as a result of a basic microdomainal constitution, rather than from a uniform and incommensurate modulation. 8 figs
Directory of Open Access Journals (Sweden)
Germán Adolfo Morong Reyes
2016-05-01
Full Text Available Review of Richard Parra, «La tiranía del Inca. El Inca Garcilaso y la escritura política en el Perú colonial (1568-1617», Lima, Ediciones Copé, 2015, 508 pp., ISBN 978-6124-20-221-6
International Nuclear Information System (INIS)
Smirnova, N.N.; Nikishchenkova, L.V.; Bykova, T.A.; Kulagina, T.G.; Belov, G.P.; Novikova, E.V.
2006-01-01
By adiabatic vacuum and dynamic calorimetry, the temperature dependence of heat capacity for alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide has been determined over the 6-510K range with an uncertainty of 0.2-0.5% between 6 and 350K and 0.5-1.5% from 330 to 510K. In the above temperature ranges, the physical transformations of the copolymer have been detected and their thermodynamic characteristics have been estimated. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the copolymer has been measured at 298.15K. Based on the experimental data, the thermodynamic functions of the copolymer, namely, the heat capacity C p - bar (T), enthalpy H o (T)-H o (0), entropy S o (T)-S o (0) and Gibbs function G o (T)-H o (0) have been determined for the range from T->0 to 400K. The enthalpy of combustion Δ c H o and the thermodynamic parameters Δ f H o , Δ f S o , Δ f G o and lnK f - bar of reaction of formation of the copolymer from simple substances at T=298.15K and p=0.1MPa have been calculated. The data cited in the present work and literature data were used to calculate the thermodynamic characteristics of the alternating copolymerization in bulk of bicyclo[2,2,1]-hepta-2,5-diene and CO in the 0-340K range at standard pressure as well as to compare them with the thermodynamic characteristics of the synthesis of isomeric polyketone
Directory of Open Access Journals (Sweden)
Özgür Yılmaz
2017-10-01
Full Text Available The reaction between 1,3-cyclohexadiene and dimethyl 7-oxabicyclo[2.2.1]hepta-2,5-diene-2,3-dicarboxylate both without a catalyst and with different catalysts, in both atmospheric and at high pressure, over 20 days were studied. At the end of the reactions, different products (retro Diels-Alder addition product 5 and Diels-Alder addition product 6 were obtained in different yields. When we look at the percentage of the addition product, it is observed that the yield of reaction at high pressure in water is the highest. All structures of these products were characterized by 1H-NMR, 13C-NMR, MS, and IR spectroscopy.
Energy Technology Data Exchange (ETDEWEB)
None
1991-07-01
The now HB-Line is located an top of the 221-H Building on the fifth and sixth levels and is designed to replace the aging existing HB-Line production facility. The new HB-Line consists of three separate facilities: the Scrap Recovery Facility, Neptunium Facility, and Plutonium Oxide Facility. The Scrap Recovery Facility is designed to routinely generate nitrate solutions of {sup 235}U{sup 239}Pu and Pu-238 fromscrap for purification by anion exchange or by solvent extraction in the canyon. The now facility incorporates improvements in: (1) engineered controls for nuclear criticality, (2) cabinet integrity and engineered barriers to contain contamination and minimize personnel exposure to airborne contamination, (3) shielding and remote operations to decrease radiation exposure, and (4) equipment and ventilation design to provide flexibility and improved process performance.
Energy Technology Data Exchange (ETDEWEB)
Coulombeau, A [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires
1969-07-01
A systematic experimental study of the reduction of four bicyclo(2-2-1)hepta n-2-ones by dissolved alkaline and alkaline-earth metals in liquid ammonia is reported. Chapter one: models of metal-ammonia solutions and mechanisms of the reduction of ketones by these solutions are rapidly recalled. Chapter two: results obtained in the thermodynamic equilibration of three pairs of epimeric alcohols which formally derive from three of the starting ketones are presented. Chapter three: deals with the results obtained in the reduction of the ketones in the absence or the presence of a proton source. A new interpretation of these results is given and is based upon two different effects: - the torsional interaction created by the bridgehead substituent on the C-O bond which favours the formation of the endo alcohol; - the difference of steric hindrance between the two sides (exo and endo) defined by the plane of the carbonyl group of the starting molecule, which favours the attack of the metal cation from one side or the other, and therefore the formation of the exo or the endo epimer. This mechanism is generalised in a model which is tested by means of some examples published in the literature. It then appears able to construe correctly the obtained results. (author) [French] Une etude experimentale systematique de la reduction de quatre bicyclo-(2-2-1)heptanones-2 par les metaux alcalins et alcalino-terreux dissous dans l'ammoniac liquide a ete effectuee. 1er chapitre: on y rappelle rapidement les modeles proposes pour la structure des solutions metalliques dans l'ammoniac liquide, ainsi que les mecanismes de reduction des cetones par ces solutions. 2eme chapitre: on y presente les resultats obtenus lors de l'equilibration thermodynamique de trois couples d'alcools epimeres derivant de trois des cetones reduites. 3eme chapitre: il concerne les resultats obtenus lors de la reduction des cetones en l'absence ou en presence de donneurs de protons. Une interpretation nouvelle
Directory of Open Access Journals (Sweden)
Garraffo H Martin
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines constitute the largest class of poison-frog alkaloids. Some alkaloids have been shown to act as noncompetitive blockers at nicotinic acetylcholine receptors but the proposed structures and the biological activities of most of the 5,8-disubstituted indolizidines have not been determined because of limited supplies of the natural products. We have therefore conducted experiments to confirm proposed structures and determine biological activities using synthetic compounds. Recently, we reported that one of this class of alkaloids, (--235B', acts as a noncompetitive antagonist for α4β2 nicotinic receptors, and its sensitivity is comparable to that of the classical competitive antagonist for this receptor, dihydro-β-erythroidine. Results The enantioselective syntheses of (--209B, (--231C, (--233D, (--235B", (--221I, and what proved to be an epimer of natural 193E, starting from common chiral lactams have been achieved. When we performed electrophysiological recordings to examine the effects of the synthetic alkaloids on two major subtypes of nicotinic receptors (α4β2 and α7 expressed in Xenopus laevis oocytes, (--231C effectively blocked α4β2 receptor responses (IC50 value, 1.5 μM with a 7.0-fold higher potency than for blockade of α7 receptor responses. In contrast, synthetic (--221I and (--epi-193E were more potent in blocking α7 receptor responses (IC50 value, 4.4 μM and 9.1 μM, respectively than α4β2 receptor responses (5.3-fold and 2.0-fold, respectively. Conclusion We achieved the total synthesis of (--209B, (--231C, (--233D, (--235B", (--221I, and an epimer of 193E starting from common chiral lactams, and the absolute stereochemistry of natural (--233D was determined. Furthermore, the relative stereochemistry of (--231C and (--221I was also determined. The present asymmetric synthesis of the proposed structure for 193E revealed that the C-8 configuration of natural 193E
Energy Technology Data Exchange (ETDEWEB)
Smirnova, N.N. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation)]. E-mail: smirnova@ichem.unn.runnet.ru; Nikishchenkova, L.V. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Bykova, T.A. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Kulagina, T.G. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Belov, G.P. [Institute of Problems of Chemical Physics of Russian Academy Sciences, 142432 Chernogolovka, Moscow Region (Russian Federation); Novikova, E.V. [Institute of Problems of Chemical Physics of Russian Academy Sciences, 142432 Chernogolovka, Moscow Region (Russian Federation)
2006-12-01
By adiabatic vacuum and dynamic calorimetry, the temperature dependence of heat capacity for alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide has been determined over the 6-510K range with an uncertainty of 0.2-0.5% between 6 and 350K and 0.5-1.5% from 330 to 510K. In the above temperature ranges, the physical transformations of the copolymer have been detected and their thermodynamic characteristics have been estimated. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the copolymer has been measured at 298.15K. Based on the experimental data, the thermodynamic functions of the copolymer, namely, the heat capacity C{sub p}{sup -}bar (T), enthalpy H{sup o}(T)-H{sup o}(0), entropy S{sup o}(T)-S{sup o}(0) and Gibbs function G{sup o}(T)-H{sup o}(0) have been determined for the range from T->0 to 400K. The enthalpy of combustion {delta}{sub c}H{sup o} and the thermodynamic parameters {delta}{sub f}H{sup o}, {delta}{sub f}S{sup o}, {delta}{sub f}G{sup o} and lnK{sub f}{sup -}bar of reaction of formation of the copolymer from simple substances at T=298.15K and p=0.1MPa have been calculated. The data cited in the present work and literature data were used to calculate the thermodynamic characteristics of the alternating copolymerization in bulk of bicyclo[2,2,1]-hepta-2,5-diene and CO in the 0-340K range at standard pressure as well as to compare them with the thermodynamic characteristics of the synthesis of isomeric polyketone.
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
Protactinium-231 found in natural thorium irradiated in JMTR
International Nuclear Information System (INIS)
Suzuki, Susumu; Mitsugashira, Toshiaki; Hara, Mitsuo; Satoh, Isamu; Shiokawa, Yoshinobu; Satoh, Michiko
1987-01-01
Natural thorium dioxides, which differed in the content of 230 Th, were irradiated in JMTR(Japan Material Testing Reactor). 232 U, 233 U, 231 Pa, 233 Pa, and remaining Th were measured radiometrically. High production of 231 Pa and high consumption of 230 Th were observed and it was necessary to assume large resonance capture of 230 Th in order to explain the production of 231 Pa and the consumption of 230 Th. (author)
International Nuclear Information System (INIS)
Boulay, P.
1968-04-01
The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [fr
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Preparation of uranium-230 as a new uranium tracer
International Nuclear Information System (INIS)
Hashimoto, T.; Kido, K.; Sotobayashi, T.
1977-01-01
A uranium isotope, 230 U(T=20.8 d), was produced from the 231 Pa(γ,n) 230 Pa→viaβ - decay 230 U process with a bremsstrahlung irradiation on a protactinium target. After standing for about one month to obtain a maximal growth of 230 U, the uranium was chemically purified, applying an ion-exchange method. The purity of the 230 U obtained was examined with alpha spectrometry and an intrinsic alpha peak due to 230 U as a new uranium tracer in an alpha spectrometric analysis of uranium isotopes is described. (author)
Zubkov, F I; Kvyatkovskaya, E A; Nikitina, E V; Amoyaw, P N-A; Kouznetsov, V V; Lazarenko, V A; Khrustalev, V N
2017-08-02
It has been proved that the reaction between furfuryl amines and N-R-maleimides leads to the formation of aza-Michael addition products - 3-(furylmethylamino)-N-R-pyrrolidine-2,5-diones, instead of 7-oxa-2-azabicyclo[2.2.1]hept-5-enes, as this journal reported previously.
Directory of Open Access Journals (Sweden)
CHEMPAKAM JANARDHANAN ATHIRA
2011-02-01
Full Text Available Ethyl 2-[2-(1-acetyl-2-oxopropylazo]-4,5-dimethyl-3-thiophenecarboxyate was synthesized by coupling diazotized ethyl 2-amino-4,5-dimethylthiophene-3-carboxylate with acetylacetone. Based on various spectral studies and elemental analysis, an intramolecularly hydrogen-bonded azo-enol structural form was assigned for the ligand. This ligand is versatile in forming a series of lanthanide(III complexes, viz., lanthanum(III, cerium(III, praseodymium(III, neodymium(III, samarium(III and gadolinium(III, which were characterized through various spectral studies, elemental analysis, magnetic susceptibility measurements, molar conductance and thermal analysis. The spectral data revealed that the ligand acted as a neutral tridentate, coordinating to the metal ion through one of the azo nitrogen atoms, the ester carbonyl and the enolic oxygen of the acetylacetone moiety, without deprotonation. Molar conductance values adequately supported their non-electrolytic nature. The ligand and lanthanum(III complex were subjected to X-ray diffraction studies. In addition, the lanthanum(III complex underwent a facile transesterification reaction on refluxing with methanol for a long period. The thermal behaviour of the lanthanum(III complex was also examined
Stoffels, I; Dissemond, J; Poeppel, T; Klötgen, K; Hillen, U; Körber, A; Schadendorf, D; Klode, J
2012-01-01
Sentinel lymph node excision (SLNE) for the detection of regional nodal metastases and staging of malignant melanoma has resulted in some controversies in international discussions as it is a surgical intervention with potential morbidity. The present retrospective study seeks to clarify the reliability of preoperative ultrasonography (US) in direct comparison to the result of SLNE and seeks to identify potential advantages of preoperative ultrasound if performed in conjunction with lymphoscintigraphy in detecting malignant melanoma metastases in sentinel lymph node (SLN). We retrospectively analysed data from 221 patients with primary malignant melanoma with a Breslow index of ≥ 1.0 mm. Of the 221 patients, 77.4% (n = 171) had a negative SLN. In 50 patients (22.6%), the histopathological investigation of 71 excised lymph nodes resulted in a positive SLN. The US examination demonstrated a sensitivity of 13.6%, a specificity of 96.9%, a positive predictive value of 97.2% and a negative predictive value of 12.6%. SLNE alone shows a sensitivity of 94%, a specificity of 98.6%, a positive predictive value of 100% and a negative predictive value of 98.3%. Preoperative US in conjunction with dynamic lymphoscintigraphy, followed by SLNE, demonstrated a detecting ratio of 100% (n = 28) for micrometastases and 98.6% (n = 42/43) for macrometastases. In conclusion, this study confirms that preoperative US alone cannot replace the vital information obtained during dynamic lymphoscintigraphy. But preoperative US is an important component of the staging procedure in melanoma patients and has clear advantages when performed in conjunction with dynamic lymphoscintigraphy. Therefore, we recommend preoperative US before every SLNE. © 2011 The Authors. Journal of the European Academy of Dermatology and Venereology © 2011 European Academy of Dermatology and Venereology.
Directory of Open Access Journals (Sweden)
Adrià Cases Ibáñez
2015-12-01
Full Text Available Review to Enric Pujol (ed., introductory study of Òscar Jané, Antologia de memòries i dietaris personals catalans sobre la Guerra de Successió, Barcelona, Institut d’Estudis Catalans, secció històrico-arqueològica, 2014, pp. 286. ISBN: 978-84-9965-221-4
Kłos, Jacek; Alexander, Millard H.; Kumar, Praveen; Poirier, Bill; Jiang, Bin; Guo, Hua
2016-05-01
We report new and more accurate adiabatic potential energy surfaces (PESs) for the ground X˜ 1A1 and electronically excited C˜ 1B2(21A') states of the SO2 molecule. Ab initio points are calculated using the explicitly correlated internally contracted multi-reference configuration interaction (icMRCI-F12) method. A second less accurate PES for the ground X ˜ state is also calculated using an explicitly correlated single-reference coupled-cluster method with single, double, and non-iterative triple excitations [CCSD(T)-F12]. With these new three-dimensional PESs, we determine energies of the vibrational bound states and compare these values to existing literature data and experiment.
International Nuclear Information System (INIS)
Gagnaire, Genevieve
1971-01-01
In connection with investigations involving the interactions of substituted groups in the bicyclo (2,2,1) heptane molecules, the chemical reactivity and some physical properties of polyfunctional compounds have been studied. A new method for preparation of β-fenchylic derivatives is presented, the first described terpenic nitroxide radical have been prepared from oxazolidinic compounds. The stereochemistry of the base induced elimination reaction of 6-exo tosyl and 6-endo tosyl oxy epi-camphor is dependent of the geometry of these compounds. On the other hand, the results indicate that the most important part of the structure is the position of the carbonyl group. Tricyclenic and camphenic derivatives are obtained with different rates. An explanation for these results involve several possible basic abstractions of acid protons, and the competition between these different reactions. The oxazolidinic compounds are obtained by reacting 2-amino 2-methyl 1-propanol with norcamphor and norbornane-2,5 dione. The geometrical configuration of the different stereoisomers is deduced from the measured dipolar interaction parameter D. The cotton effects of the γ-diketones do not show any interaction between the two carbonyl groups, in the fenchylic and bornylic series. The two carbonyl bond angles of the substituted α-diketones do not seem to be sensitive to any substitution of an alkoxy group. So, a new quadrant rule is proposed; compatible results are obtained, except for a methyl group in the α position. At least, PMR studies of terpenic polyfunctional compounds demonstrate the influence of the substitution on the geometry of the carbon skeleton. A new coupling constant 4 J HH is examined. (author) [fr
International Nuclear Information System (INIS)
Coulombeau, A.
1969-01-01
A systematic experimental study of the reduction of four bicyclo(2-2-1)hepta n-2-ones by dissolved alkaline and alkaline-earth metals in liquid ammonia is reported. Chapter one: models of metal-ammonia solutions and mechanisms of the reduction of ketones by these solutions are rapidly recalled. Chapter two: results obtained in the thermodynamic equilibration of three pairs of epimeric alcohols which formally derive from three of the starting ketones are presented. Chapter three: deals with the results obtained in the reduction of the ketones in the absence or the presence of a proton source. A new interpretation of these results is given and is based upon two different effects: - the torsional interaction created by the bridgehead substituent on the C-O bond which favours the formation of the endo alcohol; - the difference of steric hindrance between the two sides (exo and endo) defined by the plane of the carbonyl group of the starting molecule, which favours the attack of the metal cation from one side or the other, and therefore the formation of the exo or the endo epimer. This mechanism is generalised in a model which is tested by means of some examples published in the literature. It then appears able to construe correctly the obtained results. (author) [fr
The speciation of dissolved elements in aquatic solution. Radium and actinides
International Nuclear Information System (INIS)
Haesaenen, E.
1994-01-01
In the publication, the chemistry and speciation of radium, thorium, protactinium, uranium, neptunium, lutonium, americium and curium in ground-water environment is reviewed. Special attention is given to the transuranium elements, which have a central role in the repository of nuclear wastes. The most important methods used in the speciation of these elements is presented. The laser-induced methods, developed in the 1980's, are especially discussed. These have made it possible, e.g., to speciate the transuranium elements in their very low, actual repository ground-water concentrations (10-100 ng/l). (54 refs., 10 figs., 3 tabs.)
Directory of Open Access Journals (Sweden)
Yong-Suk eLee
2016-03-01
Full Text Available A novel esterase, MtEst45, was isolated from a fosmid genomic library of Microbulbifer thermotolerans DAU221. The encoding gene is predicted to have a mass of 45,564 Da and encodes 495 amino acids, excluding a 21 amino acid signal peptide. MtEst45 showed a low amino acid identity (approximately 23–24% compared with other lipolytic enzymes belonging to Family III, a closely related bacterial lipolytic enzyme family. MtEst45 also showed a conserved GXSXG motif, G131IS133YG135, which was reported as active site of known lipolytic enzymes, and the putative catalytic triad composed of D237 and H265. Because these mutants of MtEst45, which was S133A, D237N, and H265L, had no activity, these catalytic triad essential for the enzyme catalysis. MtEst45 was overexpressed in Escherichia coli BL21 (DE3 and purified via His-tag affinity chromatography. The optimal pH and temperature of MtEst45 were estimated to be 8.17 and 46.27°C by response surface methodology, respectively. Additionally, MtEst45 was also active between 1–15°C. The optimal hydrolysis substrate for MtEst45 among p-nitrophenyl esters (C2–C18 was p-nitrophenyl butyrate, and the Km and Vmax values were 0.0998 mM and 550 μmol/min/mg of protein, respectively. MtEst45 was strongly inhibited by Hg2+, Zn2+, and Cu2+ ions; by phenylmethanesulfonyl fluoride; and by β-mercaptoethanol. Ca2+ did not affect the enzyme’s activity. These biochemical properties, sequence identity, and phylogenetic analysis suggest that MtEst45 represents a novel and valuable bacterial lipolytic enzyme family and is useful for biotechnological applications.
Tănase, Constantin I; Drăghici, Constantin; Cojocaru, Ana; Galochkina, Anastasia V; Orshanskaya, Jana R; Zarubaev, Vladimir V; Shova, Sergiu; Enache, Cristian; Maganu, Maria
2015-10-01
New nucleoside analogues with an optically active bicyclo[2.2.1]heptane skeleton as sugar moiety and 6-substituted adenine were synthesized by alkylation of 6-chloropurine intermediate. Thymine and uracil analogs were synthesized by building the pyrimidine ring on amine 1. X-ray crystallography confirmed an exo-coupling of the thymine to the ring and an L configuration of the nucleoside analogue. The library of compounds was tested for their inhibitory activity against influenza virus A∖California/07/09 (H1N1)pdm09 and coxsackievirus B4 in cell culture. Compounds 13a and 13d are the most promising for their antiviral activity against influenza, and compound 3c against coxsackievirus B4. Compounds 3b and 3g were tested for anticancer activity. Copyright © 2015 Elsevier Ltd. All rights reserved.
Bai, Ying; Chen, Yibing; Kong, Xiangdong
2018-02-02
It has been reported that mutations in arginine vasopressin type 2 receptor (AVPR2) cause congenital X-linked nephrogenic diabetes insipidus (NDI). However, only a few cases of AVPR2 deletion have been documented in China. An NDI pedigree was included in this study, including the proband and his mother. All NDI patients had polyuria, polydipsia, and growth retardation. PCR mapping, long range PCR and sanger sequencing were used to identify genetic causes of NDI. A novel 22,110 bp deletion comprising AVPR2 and ARH4GAP4 genes was identified by PCR mapping, long range PCR and sanger sequencing. The deletion happened perhaps due to the 4-bp homologous sequence (TTTT) at the junctions of both 5' and 3' breakpoints. The gross deletion co-segregates with NDI. After analyzing available data of putative clinical signs of AVPR2 and ARH4GAP4 deletion, we reconsider the potential role of AVPR2 deletion in short stature. We identified a novel 22.1-kb deletion leading to X-linked NDI in a Chinese pedigree, which would increase the current knowledge in AVPR2 mutation.
STANDARD ATOMIC WEIGHT VALUES FOR THE MONONUCLIDIC ELEMENTS - 2001
International Nuclear Information System (INIS)
HOLDEN, N.E.
2001-01-01
Atomic Mass Evaluations have had a major impact on the values of the atomic weights for the twenty mononuclidic elements plus two elements, Thorium and Protactinium, which have no stable nuclides but a characteristic terrestrial isotopic composition. This paper reviews the history of the atomic weight values of these elements in the years, since the reference mass standard changed from 16 O to 12 C. There is a problem for Thorium, which is considered to have an abundance value of 100%, but is not treated as such in the Standard Atomic Weights' Table. Recommendations for handling the Standard Atomic Weight values for 2001 are presented
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
Energy Technology Data Exchange (ETDEWEB)
Dalvi, Aditi A. [Bhabha Atomic Research Centre, Mumbai (India). Analytical Chemistry Div.; Homi Bhabha National Institute, Mumbai (India); Verma, Rakesh
2017-07-01
A simple and fast radiochemical method for the separation of protactinium ({sup 231}Pa) from siliceous cake for its determination by gamma ray spectrometry is described. The method involves (a) a novel approach, the fusion of the siliceous cake with sodium peroxide, (b) the dissolution of the fused mass in nitric acid and (c) the co-precipitation of {sup 231}Pa with manganese dioxide formed in-situ by the addition of solid manganous sulfate and potassium permanganate to the solution. The fusion, effected in a single step, is simpler and highly effective in comparison to methods reported hitherto in literature. The radiochemical yield of {sup 231}Pa, determined using 311.9 keV gamma ray of {sup 233}Pa radiotracer is quantitative (∝90%). The decontamination factors calculated using gamma ray spectrometry and energy dispersive X-ray fluorescence measurements show that the separation from the interfering radionuclides is high whereas separation from major and minor elements is good. Separation by ion-exchange method in hydrochloric acid, hydrofluoric acid and oxalic acid media have comparatively much lower yields. The concentration of {sup 231}Pa in the siliceous cake measured using interference-free 283.6 keV gamma ray was found to be (6.4 ± 0.33) μg kg{sup -1}. The measured concentration of {sup 231}Pa was well above the limit of quantitation whereas the coefficient of variation was ∝5%. The improvement in the limit of detection was due to the reduction in spectral background. Systematic evaluation of various uncertainty parameters showed that the major contributors to the combined uncertainty were efficiency of the high purity germanium detector and the counting statistics. The present sample decomposition and separation methods are robust, simple to perform and can be effectively used for the determination and hence source prospecting of protactinium.
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Large-scale shell model calculations for the N=126 isotones Po-Pu
International Nuclear Information System (INIS)
Caurier, E.; Rejmund, M.; Grawe, H.
2003-04-01
Large-scale shell model calculations were performed in the full Z=82-126 proton model space π(Oh 9/2 , 1f 7/2 , Oi 13/2 , 2p 3/2 , 1f 5/2 , 2p 1/2 ) employing the code NATHAN. The modified Kuo-Herling interaction was used, no truncation was applied up to protactinium (Z=91) and seniority truncation beyond. The results are compared to experimental data including binding energies, level schemes and electromagnetic transition rates. An overall excellent agreement is obtained for states that can be described in this model space. Limitations of the approach with respect to excitations across the Z=82 and N=126 shells and deficiencies of the interaction are discussed. (orig.)
International Nuclear Information System (INIS)
Szabo, B.J.
1982-01-01
Uranium-series dating ussumes that fossil bones rapidly takes up uranium, although no thorium or protactinium, soon after burial, and that the bone neither gains nor loses uranium and 230 Th, and 231 Pa. The report analyses elephant molar-tooth fragments for uranium series dating. Three samples were heated for eight hours, the concentrations were determined on a solid-source mass spectrometer, and the 234 U/ 238 U, 230 Th/ 234 U and 231 Pa/ 235 U activivy ratios were determined by alpha spectrometric analyses using chemical and instrumental procedures. There is no firm radiometric age estimate of the prehistoric site of Ternifine, Algeria but is believe to be between 200 000 and 1 100 000 years
Calculation of a TBP extraction column
International Nuclear Information System (INIS)
Lima Soares, M.L. de.
1973-01-01
Problems involving the number of stages in an extraction column and the equipment needed in most aqueous methods of reprocessing of nuclear fuels were studied. A solution for the separation of uranium from fission products in a feed solution that contains these components plus nitric acid, thorium and protactinium is obtained. The program has peculiarities such as treatment of tracer components; acceptance of decontamination and recuperation factors better than the set values for the solution; occurrence of niaxima concentrations; change of key component; criterion for ending of section; corrections for interaction; input data not including concentration estimates of the raffinate and organic extract; set of limitations for the concentrations based on input data to help convergence
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
International Nuclear Information System (INIS)
Busron Masduki; Didiek Herhady, R.
2002-01-01
It was carried out thorium-uranium extraction using one stage mixer settler to investigate the influenced of salting out agent of nitric acid and nitric aluminium. The result of this experiment showed the salting out of agent for nitric aluminium of 0.5 M much more significantly increase the distribution coefficient of uranium, but not for the thorium. The distribution coefficient of thorium much more significantly increased after nitric aluminium addition ≥1.0 M. There was not any meaningly differences the waste volume between nitric acid and nitric aluminium in its utilization. Reductor agent of ion Fe 2+ for chromi and decontaminate agent for protactinium in feed extraction, did not any influences of thorium and uranium distribution coefficient. (author)
Baglioni, Michele; Fornari, Francesca; Giannone, Ferdinando; Ravaioli, Matteo; Cescon, Matteo; Chieco, Pasquale; Bolondi, Luigi; Gramantieri, Laura
2014-01-01
To successfully target Notch receptors as part of a multidrug anticancer strategy, it will be essential to fully characterize the factors that are modulated by Notch signaling. We recently reported that Notch3 silencing in HCC results in p53 up-regulation in vitro and, therefore, we focused on the mechanisms that associate Notch3 to p53 protein expression. We explored the regulation of p53 by Notch3 signalling in three HCC cell lines HepG2, SNU398 and Hep3B.We found that Notch3 regulates p53 at post-transcriptional level controlling both Cyclin G1 expression and the feed-forward circuit involving p53, miR-221 and MDM2. Moreover, our results were validated in human HCCs and in a rat model of HCC treated with Notch3 siRNAs. Our findings are becoming an exciting area for further in-depth research toward targeted inactivation of Notch3 receptor as a novel therapeutic approach for increasing the drug-sensitivity, and thereby improving the treatment outcome of patients affected by HCC. Indeed, we proved that Notch3 silencing strongly increases the effects of Nutilin-3. With regard to therapeutic implications, Notch3-specific drugs could represent a valuable strategy to limit Notch signaling in the context of hepatocellular carcinoma over-expressing this receptor. PMID:25431954
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Energy Technology Data Exchange (ETDEWEB)
Coquema, C; Coulomb, R; Goldsztein, M; Schiltz, J C [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1961-07-01
The existence in the uranium families of two long-life descendants: ionium (half-life 80000 years) and protactinium (half-life 32000 years), together with the differences in geochemical behaviour of the various natural radio-elements, particularly thorium, make it possible to envisage several models of geological time-scales covering-periods from 0 to 500000 years The theory of two of the most important models i s developed and methods are described for making radiochemical measurements on the various nuclides which are essential for resolving these models (U{sup 238}, Th{sup 234}, Th{sup 230}, Ra{sup 226}, Pa{sup 231}, Th{sup 232}, Th{sup 228}, Po{sup 210}) An example of dating is given in the case of a secondary mineralisation on a weathered portion of a deposit in the Limouzat (Forez). Samples of autunite and chalcolite taken at different levels of the mine were calculated to be between 30000 and 240000 years old. (authors) [French] L'existence dans les familles de l'uranium de deux descendants a vie longue: ionium (periode 80000 ans) et protactinium (periode 32000 ans), ainsi que les differences tie comportement geochimique des divers radioelements naturels, en particulier du thorium, permettent d'envisager plusieurs modeles d'echelles geochronologiques couvrant un domaine allant de 0 a 500000 ans. Nous developpons la theorie de deux de ces modeles les plus importants, et decrivons les methodes de dosage radiochimiques des divers nucleides dont la connaissance est necessaire a la resolution des modeles ({sup 238}U, {sup 234}Th, {sup 230}Th, {sup 226}Ra, {sup 231}Pa, {sup 232}Th, {sup 228}Th, {sup 210}Po). On donne un exemple de chronologie d'une mineralisation secondaire sur la partie alteree du gisement du Liznouzat (Forez). Des echantillons d'autunite et de chalcolite pris a differents niveaux de la mine ont pu etre dates de 30000 a 240000 ans. (auteurs)
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Hosoya, Masahiro; Otani, Yuko; Kawahata, Masatoshi; Yamaguchi, Kentaro; Ohwada, Tomohiko
2010-10-27
Helical structures of oligomers of non-natural β-amino acids are significantly stabilized by intramolecular hydrogen bonding between main-chain amide moieties in many cases, but the structures are generally susceptible to the environment; that is, helices may unfold in protic solvents such as water. For the generation of non-hydrogen-bonded ordered structures of amides (tertiary amides in most cases), control of cis-trans isomerization is crucial, even though there is only a small sterical difference with respect to cis and trans orientations. We have established methods for synthesis of conformationally constrained β-proline mimics, that is, bridgehead-substituted 7-azabicyclo[2.2.1]heptane-2-endo-carboxylic acids. Our crystallographic, 1D- and 2D-NMR, and CD spectroscopic studies in solution revealed that a bridgehead methoxymethyl substituent completely biased the cis-trans equilibrium to the cis-amide structure along the main chain, and helical structures based on the cis-amide linkage were generated independently of the number of residues, from the minimalist dimer through the tetramer, hexamer, and up to the octamer, and irrespective of the solvent (e.g., water, alcohol, halogenated solvents, and cyclohexane). Generality of the control of the amide equilibrium by bridgehead substitution was also examined.
Kilany, Walid H; Safwat, Marwa; Mohammed, Samy M; Salim, Abdullah; Fasina, Folorunso Oludayo; Fasanmi, Olubunmi G; Shalaby, Azhar G; Dauphin, Gwenaelle; Hassan, Mohammed K; Lubroth, Juan; Jobre, Yilma M
2016-01-01
In Egypt, ducks kept for commercial purposes constitute the second highest poultry population, at 150 million ducks/year. Hence, ducks play an important role in the introduction and transmission of avian influenza (AI) in the Egyptian poultry population. Attempts to control outbreaks include the use of vaccines, which have varying levels of efficacy and failure. To date, the effects of vaccine efficacy has rarely been determined in ducks. In this study, we evaluated the protective efficacy of a live recombinant vector vaccine based on a turkey Herpes Virus (HVT) expressing the H5 gene from a clade 2.2 H5N1 HPAIV strain (A/Swan/Hungary/499/2006) (rHVT-H5) and a bivalent inactivated H5N1 vaccine prepared from clade 2.2.1 and 2.2.1.1 H5N1 seeds in Mulard ducks. A 0.3ml/dose subcutaneous injection of rHVT-H5 vaccine was administered to one-day-old ducklings (D1) and another 0.5ml/dose subcutaneous injection of the inactivated MEFLUVAC was administered at 7 days (D7). Four separate challenge experiments were conducted at Days 21, 28, 35 and 42, in which all the vaccinated ducks were challenged with 106EID50/duck of H5N1 HPAI virus (A/chicken/Egypt/128s/2012(H5N1) (clade 2.2.1) via intranasal inoculation. Maternal-derived antibody regression and post-vaccination antibody immune responses were monitored weekly. Ducks vaccinated at 21, 28, 35 and 42 days with the rHVT-H5 and MEFLUVAC vaccines were protected against mortality (80%, 80%, 90% and 90%) and (50%, 70%, 80% and 90%) respectively, against challenges with the H5N1 HPAI virus. The amount of viral shedding and shedding rates were lower in the rHVT-H5 vaccine groups than in the MEFLUVAC groups only in the first two challenge experiments. However, the non-vaccinated groups shed significantly more of the virus than the vaccinated groups. Both rHVT-H5 and MEFLUVAC provide early protection, and rHVT-H5 vaccine in particular provides protection against HPAI challenge.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Banaras Hindu University, Varanasi 221 005, India; Department of Endocrinology, Institute of Medical Sciences, Banaras Hindu University, Varanasi 221 005, India; Department of Surgery, Institute of Medical Sciences, Banaras Hindu University, Varanasi 221 005, India; Urology and Infertility Clinic, Sah Nursing Home, ...
The promoter for a variant surface glycoprotein gene expression site in Trypanosoma brucei
Zomerdijk, J. C.; Ouellette, M.; ten Asbroek, A. L.; Kieft, R.; Bommer, A. M.; Clayton, C. E.; Borst, P.
1990-01-01
The variant-specific surface glycoprotein (VSG) gene 221 of Trypanosoma brucei is transcribed as part of a 60 kb expression site (ES). We have identified the promoter controlling this multigene transcription unit by the use of 221 chromosome-enriched DNA libraries and VSG gene 221 expression site
Yu, H; Yan, H; Li, J; Li, Z; Zhang, X; Ma, Y; Mei, L; Liu, C; Cai, L; Wang, Q; Zhang, F; Iwata, N; Ikeda, M; Wang, L; Lu, T; Li, M; Xu, H; Wu, X; Liu, B; Yang, J; Li, K; Lv, L; Ma, X; Wang, C; Li, L; Yang, F; Jiang, T; Shi, Y; Li, T; Zhang, D; Yue, W
2017-07-01
Many schizophrenia susceptibility loci have been identified through genome-wide association studies (GWASs) in European populations. However, until recently, schizophrenia GWASs in non-European populations were limited to small sample sizes and have yielded few loci associated with schizophrenia. To identify genetic risk variations for schizophrenia in the Han Chinese population, we performed a two-stage GWAS of schizophrenia comprising 4384 cases and 5770 controls, followed by independent replications of 13 single-nucleotide polymorphisms in an additional 4339 schizophrenia cases and 7043 controls of Han Chinese ancestry. Furthermore, we conducted additional analyses based on the results in the discovery stage. The combined analysis confirmed evidence of genome-wide significant associations in the Han Chinese population for three loci, at 2p16.1 (rs1051061, in an exon of VRK2, P=1.14 × 10 -12 , odds ratio (OR)=1.17), 6p22.1 (rs115070292 in an intron of GABBR1, P=4.96 × 10 -10 , OR=0.77) and 10q24.32 (rs10883795 in an intron of AS3MT, P=7.94 × 10 -10 , OR=0.87; rs10883765 at an intron of ARL3, P=3.06 × 10 -9 , OR=0.87). The polygenic risk score based on Psychiatric Genomics Consortium schizophrenia GWAS data modestly predicted case-control status in the Chinese population (Nagelkerke R 2 : 1.7% ~5.7%). Our pathway analysis suggested that neurological biological pathways such as GABAergic signaling, dopaminergic signaling, cell adhesion molecules and myelination pathways are involved in schizophrenia. These findings provide new insights into the pathogenesis of schizophrenia in the Han Chinese population. Further studies are needed to establish the biological context and potential clinical utility of these findings.
Directory of Open Access Journals (Sweden)
Jana Lorenzová
2010-01-01
Full Text Available This retrospective study evaluated a canine patient group operated on for mammary neoplasms (221 females. After surgical treatment, the animals were divided based on histological findings into groups and subgroups according to the WHO system. In the individual groups and subgroups the length of their survival following a mammary tumour surgery and death causes were followed. Of their total number, 164 tumours were malignant, 39 were benign and 18 were mammary hyperplasias. With regard to malignant tumours, invasive tubular carcinoma (20.81% was identified most frequently; fibroadenoma reached the highest occurrence (10.41% as regards benign tumours. The length of survival in females with malignant tumours ranged from 12 to 37.4 months, depending on histological subtypes. In females with benign mammary neoplasms the length of survival ranged from 39.1 to 59.3 months and in animals with hyperplasia it was 50.2 months. As a result of mammary tumour, 41 females (25% died in the malignant tumour group, none died in the benign tumour group and 2 females (11.1% died in the hyperplasia group. The survival periods in surgically treated patients with mammary tumours were shorter for solid and complex carcinomas, compared to patients affected with the remainder of the histological subtypes. The longest survival period following operation was recorded in the group suffering from adenoma. The least favourable illness prognosis for patients with mammary tumours in respect to linking the death cause to the mammary tumour was for those having invasive papillary carcinoma. The most favourable illness prognosis was for patients with benign tumours and non-invasive tubular carcinoma. A frequent death cause in females with mammary tumours was another illness unrelated to mammary tumours.
International Nuclear Information System (INIS)
Zal U'yun Wan Mahmood; Zaharudin Ahmad; Abdul Kadir Ishak; Norfaizal Mohamed; Che Abd Rahim Mohamed
2011-01-01
Protactinium and thorium activities were measured in eight surface sediment taken in 2004 to determine effectiveness scavenging of 231 Pa at Sabah-Sarawak coastal waters. The result found that activity ratios of 231 Pa ex / 230 Th ex were ranged from 0.07 to 0.13 at all sampling stations. The high 231 Pa ex / 230 Th ex activity ratio than the production ratio of 0.093 in seawater at station SR 01, SR 02, SR 04, SB 02 and SB 05, revealed that 231 Pa is effectively removed from the water column into the sediment in comparison with 230 Th at those stations. Low percentage of 230 Th ex (90-95%) in comparison with 231 Pa ex at all stations can be attributed to less efficiently scavenged of 230 Th onto particles prior deposited at the marine sediment bed. (author)
Definition of breeding gain for molten salt reactors - 147
International Nuclear Information System (INIS)
Nagy, K.; Kloosterman, J.L.; Lathouwers, D.; Van der Hagen, T.H.J.J.
2010-01-01
The graphite-moderated Molten Salt Reactor (MSR) is a potential breeder reactor using the thorium fuel cycle. The MSR has unique properties due to the possibility of making changes to the salt composition during operation. Most important is the extraction of protactinium, which separates the fissile uranium production into two volumes: the reactor core and the external stockpile. The paper focuses on the definition of breeding gain in such a system. The prospects of using breeding gain expressions defined for solid fuel reactors are investigated and new definitions are given which incorporate the processes occurring in the reactor core and the external stockpile. The difference of the growth rate of the mass of fissile material and breeding gain is pointed out. The new definitions are applied to an optimization study of the graphite-salt lattice of a breeder MSR. (authors)
Method for converting UF5 to UF4 in a molten fluoride salt
International Nuclear Information System (INIS)
Bennett, M.R.; Bamberge, C.E.; Kelmers, A.D.
1980-01-01
The subject relates to fuel preparation for molten salt breeder reactors, and more particularly to the reconstitution of spent molten fuel salt after fission product removal. During the course of reactor operation, fission products including rare earths and bred-in protactinium build up in the fuel salt and adversely affect the nuclear properties of the fuel. In order to more efficiently operate the reactor, the level of neutron poison fission products must be kept at a minimum. This is accomplished by continuously removing spent fuel from the primary circuit, processing it to remove fission products, and returning the reprocessed molten salt to the primary circuit. It is desirable for safety and economy that the fuel processing plant be a component of the reactor itself and that the salt be kept in the molten state throughout the processing system. (auth)
North Atlantic ocean circulation and abrupt climate change during the last glaciation.
Henry, L G; McManus, J F; Curry, W B; Roberts, N L; Piotrowski, A M; Keigwin, L D
2016-07-29
The most recent ice age was characterized by rapid and hemispherically asynchronous climate oscillations, whose origin remains unresolved. Variations in oceanic meridional heat transport may contribute to these repeated climate changes, which were most pronounced during marine isotope stage 3, the glacial interval 25 thousand to 60 thousand years ago. We examined climate and ocean circulation proxies throughout this interval at high resolution in a deep North Atlantic sediment core, combining the kinematic tracer protactinium/thorium (Pa/Th) with the deep water-mass tracer, epibenthic δ(13)C. These indicators suggest reduced Atlantic overturning circulation during every cool northern stadial, with the greatest reductions during episodic Hudson Strait iceberg discharges, while sharp northern warming followed reinvigorated overturning. These results provide direct evidence for the ocean's persistent, central role in abrupt glacial climate change. Copyright © 2016, American Association for the Advancement of Science.
An aerial radiological survey of the Central Savannah River Site, Aiken, South Carolina
International Nuclear Information System (INIS)
Feimster, E.L.
1991-09-01
An aerial radiological survey was conducted over a 194-square- kilometer (75-square-mile) area encompassing the central portion of the Savannah River Site (SRS). The survey was flown during February 10--27, 1987. These radiological measurements were used as baseline data for the central area and for determining the extent of man-made radionuclide distribution. Previous SRS surveys included small portions of the area; the 1987 survey was covered during the site- wide survey conducted in 1979. Man-made radionuclides (including cobalt-60, cesium-137, protactinium-234m, and elevated levels of uranium-238 progeny) that were detected during the survey were typical of those produced by the reactor operations and material processing activities being conducted in the area. The natural terrestrial radiation levels were consistent with those measured during prior surveys of other SRS areas. 1 refs., 4 figs
Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean
International Nuclear Information System (INIS)
Roy-Barman, M.
2009-01-01
The 'boundary scavenging' box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces 'almost' linear 230 Th profiles (as observed in the data) despite lateral transport. However, omitting lateral transport biases the 230 Th based particle flux estimates by as much as 50%. 231 Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231 Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232 Th is modelled using the same transport parameters as 230 Th but a different source function. The main source of the 232 Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230 Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230 Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230 Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231 Pa/ 230 Th ratio in arctic sediments. (authors)
Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean
Directory of Open Access Journals (Sweden)
M. Roy-Barman
2009-12-01
Full Text Available The "boundary scavenging" box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces "almost" linear 230Th profiles (as observed in the data despite lateral transport. However, omitting lateral transport biaises the 230Th based particle flux estimates by as much as 50%. 231Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232Th is modelled using the same transport parameters as 230Th but a different source function. The main source of the 232Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231Pa/230Th ratio in arctic sediments.
2010-10-01
..., catching, taking, or harvesting of fish, shellfish, marine animals, pearls, shells, or marine vegetation or..., or harvesting of fish, shellfish, marine animals, pearls, shells, or marine vegetation. (g) Fish...
2010-01-01
... of any activity for profit or the management or preservation of property. Indirectly secured. (1... continuously invested in exempted securities (as defined in 15 U.S.C. 78c(a)(12)); or (iii) A company which...
Vogten, Hubert; Martens, Harrie; Koper, Rob
2005-01-01
Changes in this release: This version contains: added support for Apache Derby database (aka IBM Cloudscape), moved JBoss specific code from general code base to own package, improved TimerSchedule setup, fixed a number of bugs.
2010-01-01
... part of Asia lying west of and including Iran. Area No. 3 means all of Asia and the islands adjacent... for sale. Carrier means an air carrier or foreign air carrier subject to section 41504 of 49 U.S.C.... Contract of carriage means those fares, rules, and other provisions applicable to the foreign air...
46 CFR 221.63 - Investigation.
2010-10-01
... investigate the matter and decide whether there is sufficient evidence to establish a prima facie case that a violation occurred. (b) If that Officer decides there is a prima facie case, then that Officer may enter...
2010-07-01
... FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF... natural resource for which compensation for loss of subsistence use is claimed; (b) A description of the... compensation available to the claimant for loss of subsistence. ...
2010-10-01
... buildings, structures, equipment, or systems used to provide emergency services, such as fire protection... Definitions. (a) Educational institution means: (1) Any elementary school as defined by section 801(c) of the Elementary and Secondary Education Act of 1965; or (2) Any secondary school as defined by section 801(h) of...
Al-Wabli, Reem I.; Salman, Asmaa; Shyni, V.; Ghabbour, Hazem A.; Joe, I. Hubert; Almutairi, Maha S.; Maklad, Yousreya A.; Attia, Mohamed I.
2018-03-01
Cancer is one of the most serious health problems worldwide and it is considered the second major cause of mankind deaths. We report the synthesis and spectroscopic characterization of N-(4-chloro-2-{[2-(1H-indol-2-ylcarbonyl)hydrazinyl](oxo)acetyl}phenyl)acetamide (CICHOPA, 5) as a new antiproliferative glyoxylamide derivative. Molecular structure of CICHOPA (5) was unequivocally confirmed via X-ray analysis and it was crystallized in the monoclinic, P21/c, a = 14.3956 (4) Å, b = 8.9307 (3) Å, c = 34.9507 (10) Å, β = 94.439 (1)°, V = 4479.9 (2) Å3, Z = 8. The in vitro anticancer potential of the title molecule 5 was examined toward four types of human cancer cell lines. Vibrational profile of the CICHOPA molecule was investigated with the aid of density functional theory approach. Natural bond orbital, and natural population analyses as well as HOMO and LUMO molecular orbitals studies were carried out in order to explore the possible intermolecular delocalization or hyperconjugation in the title compound. The binding mode of compound 5 to its target protein was predicted through a molecular docking investigation. The in vitro antiproliferative activity of the title compound 5 was examined against four human cancer cell lines and showed growth inhibitory activity at concentrations of 25 and 50 μM.
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
q-deformed conformal superalgebra and its Hopf subalgebras
International Nuclear Information System (INIS)
Dobrev, V.K.; Lukierski, J.; Sobczyk, J.; Tolstoy, V.N.
1992-07-01
We present in detail a Hopf superalgebra U q (su(2,2/2)) which is a q-deformation of the conformal superalgebra su(2,2/1). The superalgebra U q (su(2,2/1)) contains as a subalgebra a q-deformed super-Poincare algebra and as Hopf subalgebras two conjugate 16-generator q-deformed super-Weyl algebras, which are q-deformation of parabolic subalgebras of su(2,2/1). We use several (anti-) involutions, including the standard Cartan involution and a *-antiinvolution under which the super-Weyl algebras are *-subalgebras of U q (su(2,2/1)). The q-deformed Lorentz algebra is Hopf subalgebra of both Weyl algebras and is preserved by all (anti-) involutions considered. (author). 26 refs
International Nuclear Information System (INIS)
Thomason, H.P.; Williams, S.J.
1992-02-01
Experimental determinations of the solubilities of americium, plutonium, neptunium, protactinium, thorium, radium, lead, tin, palladium and zirconium are reported. These elements have radioactive isotopes of concern in assessments of radioactive waste disposal. All measurements were made under the highly alkaline conditions typical of the near field of a radioactive waste repository which uses cementitious materials for many of the immobilisation matrices, the backfill and the engineered structures. Low redox potentials, typical of those resulting from the corrosion of iron and steel, were simulated for those elements having more than one accessible oxidation state. The dissolved concentrations of the elements were defined using ultrafiltration. In addition, the corrosion of iron and stainless steel was shown to generate low redox potentials in solution and the solubility of iron(II) at high pH was measured and found to be sufficient for it to act as a redox buffer with respect to neptunium and plutonium. (author)
A Study of the 384 KeV Complex Gamma Emission from Plutonium-239
International Nuclear Information System (INIS)
Forsyth, R.S.; Ronqvist, N.
1965-11-01
Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241
Radioactivity studies. Progress report, April 30, 1984-June 1, 1985
International Nuclear Information System (INIS)
Cohen, N.
1985-06-01
This report includes information pertaining to metabolic studies of neptunium and protactinium in the adult baboon. Recent investigations have provided additional data on the uptake, distribution, retention and excretion of Np-237, Np-239 and Pa-233 in baboons following single intravenous and gavage administrations. Data is also presented on the gastrointestinal absorption of isotopes of uranium, neptunium and plutonium in individual baboons after receiving multiple gavage administrations at selected time intervals and nutritional states. The gastrointestinal (GI) absorption (f 1 values) and retention factors have been calculated for each of these nuclides. We have begun metabolic studies on the adult tamarin (Saquinis labiatus). Data are presented in this report on the preliminary results of the metabolism of Np-239 bicarbonate intravenously injected into three females and one male tamarin. These data are discussed in comparison with similar results obtained with our baboons and with other species. 28 refs., 20 figs., 14 tabs
Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures
International Nuclear Information System (INIS)
Kluge, E.; Lieser, K.H.
1981-01-01
The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)
A Study of the 384 KeV Complex Gamma Emission from Plutonium-239
Energy Technology Data Exchange (ETDEWEB)
Forsyth, R S; Ronqvist, N
1965-11-15
Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241.
Criteria for achieving actinide reduction goals
International Nuclear Information System (INIS)
Liljenzin, J.O.
1996-01-01
In order to discuss various criteria for achieving actinide reduction goals, the goals for actinide reduction must be defined themselves. In this context the term actinides is interpreted to mean plutonium and the so called ''minor actinides'' neptunium, americium and curium, but also protactinium. Some possible goals and the reasons behind these will be presented. On the basis of the suggested goals it is possible to analyze various types of devices for production of nuclear energy from uranium or thorium, such as thermal or fast reactors and accelerator driven system, with their associated fuel cycles with regard to their ability to reach the actinide reduction goals. The relation between necessary single cycle burn-up values, fuel cycle processing losses and losses to waste will be defined and discussed. Finally, an attempt is made to arrange the possible systems on order of performance with regard to their potential to reduce the actinide inventory and the actinide losses to wastes. (author). 3 refs, 3 figs, 2 tabs
Dosimetry of the gastrointestinal tract
International Nuclear Information System (INIS)
Sullivan, M.F.; Cross, F.T.; Dagle, G.E.
1987-01-01
In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs
DeLay, J
2016-09-01
Autopsy of animals that die in the perianesthetic period allows identification of anesthetic and surgical complications as well as preexisting disease conditions that may have contributed to mortality. In most studies to date investigating perianesthetic mortality in animals, inclusion of autopsy data is very limited. This retrospective study evaluated autopsy findings in 221 cases of perianesthetic death submitted to a veterinary diagnostic laboratory from primary care and referral hospitals. Canine (n = 105; 48%) and feline (n = 90; 41%) cases predominated in the study, involving elective (71%) and emergency (19%) procedures. The clinical history provided to the pathologist was considered incomplete in 42 of 221 cases (19%), but this history was considered essential for evaluating the circumstances of perianesthetic death. Disease had been recognized clinically in 69 of 221 animals (31%). Death occurred in the premedication or sedation (n = 19; 9%), induction (n = 22; 11%), or maintenance (n = 73; 35%) phases or in the 24 hours postanesthesia (n = 93 animals; 45%). Lesions indicative of significant natural disease were present in 130 of 221 animals (59%), mainly involving the heart, upper respiratory tract, or lungs. Surgical or anesthesia-associated complications were identified in 10 of 221 cases (5%). No lesions were evident in 80 of 221 animals (36%), the majority of which were young, healthy, and undergoing elective surgical procedures. Lesions resulting from cardiopulmonary resuscitation were identified in 75 of 221 animals (34%). Investigation of perianesthetic death cases should be done with knowledge of prior clinical findings and antemortem surgical and medical procedures; the autopsy should particularly focus on the cardiovascular and respiratory system, including techniques to identify pneumothorax and venous air embolism. © The Author(s) 2016.
Pan, Tzu-Yu; Chiou, Shyh-Shin; Wang, Chun-Chi; Wu, Shou-Mei
2014-12-01
An inverse-shifting polymerase chain reaction (IS-PCR) combined with short-end capillary gel electrophoresis (CGE) was developed for genotyping of intron 22 inversion Type 1 (Inv22-1) and Type 2 (Inv22-2) of hemophilia A (HA). Severe HA cases are affected by intron 22 inversion around 45-50%. Inv22-1 has higher frequency than Inv22-2. The aim of this study is to distinguish them by genotyping. In order to improve Inv22 genotyping efficiency, five primers were designed and applied to differentiate the wild type, Inv22-1, Inv22-2 and carrier. Three amplicons of 405, 457 and 512 bp were recognized for wild type; 333, 457 and 584 bp for Inv22-1; 385, 405 and 584 bp for Inv22-2. The Inv22-1 carrier has 5 amplicons including 333, 405, 457, 512, 584 bp and Inv22-2 carrier is differentiated by 385, 405, 457, 512 and 584 bp. The amplicons between Inv22-1 and Inv22-2 carriers are only different in 333 bp for Inv22-1 carrier and 385 bp for Inv22-2 carrier. Capillary gel electrophoresis (CGE) was used for separation within 5 min. The separation voltage was set at 8 kV (cathode at detector), and the temperature was kept at 25°C. The sieving matrix was 89 mM Tris, 89 mM boric acid, 2mM EDTA containing 0.4% (w/v) HPMC and 1 μM of YO-PRO(®)-1 Iodide. Total of 50 HA patients (including 35 non-Inv22, 14 Inv22-1, and one Inv22-2 patients) and 7 HA carriers were diagnosed in the application. Seven random samples (5 patients and 2 carriers) were subjected to comparison and gave identical results of DNA sequencing and this modified IS-PCR. Copyright © 2014 Elsevier B.V. All rights reserved.
Reply to Keller and Springborn: No doubt about invasion debt
Czech Academy of Sciences Publication Activity Database
Essl, F.; Dullinger, S.; Rabitsch, W.; Hulme, P. E.; Hülber, K.; Jarošík, Vojtěch; Kleinbauer, I.; Krausmann, F.; Kühn, I.; Nentwig, W.; Vila, M.; Genovesi, P.; Gherardi, F.; Desprez-Loustau, M.-L.; Roques, A.; Pyšek, Petr
2011-01-01
Roč. 108, č. 25 (2011), s. 221-221 ISSN 0027-8424 Institutional research plan: CEZ:AV0Z60050516 Keywords : biological invasions * invasion debt * economics Subject RIV: EF - Botanics Impact factor: 9.681, year: 2011
African Journals Online: Nigeria
African Journals Online (AJOL)
Items 201 - 221 of 221 ... (iii) to provide a forum for discussion of library and information science ... Tropical Freshwater Biology promotes the publication of scientific .... discoveries and engineering design/fabrication reports related to any branch ...
Publications | Page 221 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...
39 CFR 221.6 - Field organization.
2010-07-01
...). (d) Customer Service District Offices. Functional units and reporting relationships are as follows: (1) Functional units. The 80 district offices coordinate the day-to-day management of post offices... units. Areas are responsible for: (i) Customer service districts (CSDs). (ii) Post offices (POs). (iii...
46 CFR 221.13 - General approval.
2010-10-01
...; (iii) Bareboat or demise Charters of vessels operating in the coastwise trade. A Documented Vessel... such transfer would be contrary to the foreign policy of the United States as declared by an executive... bulk cargo vessels engaged in carrying bulk raw and processed agricultural commodities from the United...
Publications | Page 221 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Use this search tool to locate a specific publication for your field of research. ... of ICT-based interventions in linking African farmers to markets (open access) ... in Ecuadorean Floriculture Workers: Toward Validating a Low-cost Test Battery ...
14 CFR 221.40 - Specific requirements.
2010-01-01
... or types of passenger service (that is, first class, coach, day coach, night coach, tourist, economy... individual carrier's provisions apply to the through transportation over the applicable joint routes...
Publications | Page 221 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The standard. ... In reality, policy making and implementation are often irrational, unpredictable and highly political. ... Background: The degree of Maternal and Child Health (MCH) is still a major problem in health development in Indonesia.
Kvaalide kvainimine / Daniel C. Dennett ; tõlk. Bruno Mölder
Dennett, Daniel C., 1942-
1997-01-01
Järgneb Akadeemia 1998, nr. 1, lk. 189-221. Lk. 209-221 järelsõna: B. Mölder. Dennett ja kvaalid. Sisald. bibliogr. Tõlke allikas: Quining Qualia. In: Conciousness in Contemporary Science. - Oxford, 1988, lk. 42-77
Dicty_cDB: Contig-U14955-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Bartonella rochalimae Humboldt 131... 221 5e-56 AJ271200_1( AJ271200 |pid:none) Wolbachia sp. partial ftsZ ...ne) Sequence 11 from Patent WO03035874. 221 5e-56 DQ676486_1( DQ676486 |pid:none)
Wesselink, Christiaan; Marcus, Michael W.; Jansonius, Nomdo M.
2012-01-01
Purpose: To identify risk factors for visual field progression in glaucoma and to compare different statistical approaches with this risk factor analysis. Patients and Methods: We included 221 eyes of 221 patients. Progression was analyzed using Nonparametric Progression Analysis applied to Humphrey
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
Structural and mechanical behaviour of 5% Al2O3-reinforced Fe ...
Indian Academy of Sciences (India)
Author Affiliations. Pallav Gupta1 Devendra Kumar1 Om Parkash1 A K Jha2. Department of Ceramic Engineering, Indian Institute of Technology (Banaras Hindu University), Varanasi 221 005, India; Department of Mechanical Engineering, Indian Institute of Technology (Banaras Hindu University), Varanasi 221 005, India ...
Czech Academy of Sciences Publication Activity Database
Brož, J.; Urbanová, J.; Janíčková Žďárská, D.; Doničová, V.; Brabec, Marek
2014-01-01
Roč. 63, Supplement 1 (2014), A221-A221 ISSN 0012-1797. [American Diabetes Association. Scientific Sessions /74./. 13.06.2014-17.06.2014, San Francisco] Institutional support: RVO:67985807 Keywords : continuous monitoring * type I diabetes * semiparametric modeling Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition
Neiella marinum gen. nov., sp. nov., isolated from sea cucumber
A novel strain, designated J221**T, was isolated from the intestine of a sea cucumber, Apostichopus japonicus, collected from earthen ponds in Qingdao, China. The strain is Gram-negative, oxidase-positive, aerobic, and rod-shaped cell. Growth of strain J221T was observed at temperatures between 10...
Indian Academy of Sciences (India)
Unknown
Department of Metallurgical Engineering, Banaras Hindu University, Varanasi 221 005, India. †Small Industries Service Institute, Industrial Estate, Varanasi 221 006, India. MS received 11 October 2002. Abstract. Delayed failure tests were carried out on hydrogen charged API X-65 grade line-pipe steel in as received ...
Leung, T. K. Daisy; Riechers, Dominik A.
2016-02-01
We report the detection of CO(J = 3 \\to 2) line emission in the strongly lensed submillimeter galaxy (SMG) SMM J0939+8315 at z = 2.221, using the Combined Array for Research in Millimeter-wave Astronomy. SMM J0939+8315 hosts a type-2 quasar, and is gravitationally lensed by the radio galaxy 3C220.3 and its companion galaxy at z = 0.685. The 104 GHz continuum emission underlying the CO line is detected toward 3C220.3 with an integrated flux density of Scont = 7.4 ± 1.4 mJy. Using the CO(J = 3 \\to 2) line intensity of ICO(3-2) = (12.6 ± 2.0) Jy km s-1, we derive a lensing- and excitation-corrected CO line luminosity of {L}{{CO(1-0)}}\\prime = (3.4 ± 0.7) × 1010 (10.1/μL) K km s-1 pc2 for the SMG, where μL is the lensing magnification factor inferred from our lens modeling. This translates to a molecular gas mass of Mgas = (2.7 ± 0.6) × 1010 (10.1/μL) M⊙. Fitting spectral energy distribution models to the (sub)-millimeter data of this SMG yields a dust temperature of T = 63.1{}-1.3+1.1 K, a dust mass of Mdust = (5.2 ± 2.1) × 108 (10.1/μL) M⊙, and a total infrared luminosity of LIR = (9.1 ± 1.2) ×1012 (10.1/μL) L⊙. We find that the properties of the interstellar medium of SMM J0939+8315 overlap with both SMGs and type-2 quasars. Hence, SMM J0939+8315 may be transitioning from a starbursting phase to an unobscured quasar phase as described by the “evolutionary link” model, according to which this system may represent an intermediate stage in the evolution of present-day galaxies at an earlier epoch.
Czech Academy of Sciences Publication Activity Database
Sláma, Karel; Lukáš, J.
2013-01-01
Roč. 110, č. 2 (2013), s. 221-230 ISSN 1210-5759 Grant - others:Ministerstvo zemědělství(CZ) MZe0002700604 Institutional support: RVO:60077344 Keywords : Lepidoptera * Galleria mellonella * Coleoptera Subject RIV: ED - Physiology Impact factor: 1.076, year: 2013 http://www.eje.cz/pdfs/110/2/221
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. Graeme Mitchison. Articles written in Journal of Genetics. Volume 83 Issue 2 August 2004 pp 221-221 Obituary. Francis Crick (1916–2004) · Graeme Mitchison · More Details Fulltext PDF. Journal of Genetics. Current Issue : Vol. 97, Issue 1. Current Issue Volume 97 | Issue 1
African Journals Online: Nigeria
African Journals Online (AJOL)
Items 201 - 221 of 221 ... Log in or Register to get access to full text downloads. .... related to veterinary sciences, including livestock health and production, diseases of ... Asian languages and literatures, History, Philosophy, Religion, Music, Theatre Arts, etc. ... WAJM is open access and available for free download as of 2010.
1989-01-01
8217The Nature and Status of Ethnobotany," Chronica Botanica , Vol 6, pp 219-221. Jones, Volney H. 1957. "Botany," The Identification of Non- artifactual...Chronica Botanica , Vol. 6, pp. 219-221. CULTURAL Ethnobotany, general JONES, VOLNEY H., 1957, Botany. In Taylor, W., (editor), The Identification of Non
24 CFR 200.853 - Applicability.
2010-04-01
... “tenant-based” assistance); (2) Section 202 Program of Supportive Housing for the Elderly (Capital...); and (4) Section 202 loan program for projects for the elderly and handicapped (including 202/8... Insurance); (4) Section 221(d)(3) of the NHA (Market Interest Rate (MIR) Program); (5) Section 221(d)(3) and...
Neutron activation determination of rhenium in mineral raw materials of complex composition
International Nuclear Information System (INIS)
Shiryaeva, M.B.; Lyubimova, L.N.; Salmin, Yu.P.; Ryumina, K.N.; Tatarkin, M.A.
1984-01-01
The method of neutron-activation rhenium determination in mineral raw material of complex composition is developed, according to which easily hydrolized elements: scandium, iron, lanthanum, ytterbium, protactinium, hafnium and partially ruthenium and osmium are isolated in the form of hydroxides after smelting of a sample, which has been previously irradiated in nuclear reactor (thermal neutron flux 1.2x10 13 n/cm 2 xs for 22 hr) with sodium peroxide and leaching of the melt by water. To separate Re from other interfering elements extraction of perrhenate-ion by methylethylketone from alkali solution is used. Interfering effect of gold is eliminated by its extraction with TBP 30% solution in toluence or benzene from 1 M HNO 3 . Activity of rhenium preparations, singled out from samples of comparison, is measured, using multichannel γ-spectrometer with Ge(Li)-coaxial detector of high resolution (approximately 2.0-2.2 keV over the line 122 keV 5+ Co). Relative standard deviation in Re content range 5x10 -7 -5x10 -2 % does not exceed 0.3
A brief history of the ''Delayed'' discovery of nuclear fission
International Nuclear Information System (INIS)
Holden, N.E.
1989-08-01
This year marks the Fiftieth Anniversary of the discovery of Nuclear Fission. In the early 1930's, the neutron was discovered, followed by the discovery of artificial radioactivity and then the use of the neutron to produce artificial radioactivity. The first experiments resulting in the fission of uranium took place in 1934. A paper which speculated on fission as an explanation was almost immediately published, yet no one took it seriously not even the author herself. Why did it take an additional five years before anyone realized what had occurred? This is an abnormally long time in a period when discoveries, particularly in nuclear physics, seemed to be almost a daily occurrence. The events which led up to the discovery are recounted, with an attempt made to put them into their historical perspective. The role played by Mendeleev's Periodic Table, the role of the natural radioactive decay chain of uranium, the discovery of protactinium, the apparent discovery of masurium (technetium) and a speculation on the reason why Irene Curie may have missed the discovery of nuclear fission will all be discussed. 43 refs
Use of tetracycline as complexing agent in radiochemical separations
International Nuclear Information System (INIS)
Saiki, M.; Nastasi, M.J.C.; Lima, F.W.
1981-01-01
The use of the antibiotic agent tetracycline (TC) for analytical purposes in solvent extraction procedures is presented. Individual extraction curves for the lanthanides, zinc, scandium, uranium, thorium, neptunium and protactinium were obtained. Separation of those elements from one another, and of uranium from selenium, bromine, antimony, barium, tantalum and tungsten was carried out. In all cases benzyl alcohol was the diluent used to dissolve tetracycline hydrochloride. Sodium chloride was used as supporting electrolyte for the lanthanide separations and sodium perchlorate for the other elements mentioned. Stability or formation constants for the lanthanide complexes as well as for thorium complex with tetracycline were determined by using the methods of average number of ligands, the limiting value (for thorium), the two parameters and the weighted least squares. For the lanthanides, the stability constants of the complexes Ln(TC) 3 go from 9.35+-0.22 for lanthanum up to 10.84+-0.11 for lutetium. For the Th(TC) 4 complex the formation constant is equal to 24.6+-0.3. Radioisotopes of the respective elements were used as tracers for the determinations. (author)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics.
2010-01-01
... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to policy...
International Nuclear Information System (INIS)
Ma, Qinglin; Tan, Juan; Cui, Xiaoxu; Luo, Di; Yu, Miao; Liang, Chen; Qiao, Wentao
2014-01-01
Prototype foamy virus encodes a transactivator called Bel1 that enhances viral gene transcription and is essential for PFV replication. Nuclear localization of Bel1 has been reported to rely on two proximal basic motifs R 199 H 200 and R 221 R 222 R 223 that likely function together as a bipartite nuclear localization signal. In this study, we report that mutating R 221 R 222 R 223 , but not R 199 H 200 , relocates Bel1 from the nucleus to the cytoplasm, suggesting an essential role for R 221 R 222 R 223 in the nuclear localization of Bel1. Although not affecting the nuclear localization of Bel1, mutating R 199 H 200 disables Bel1 from transactivating PFV promoters. Results of EMSA reveal that the R 199 H 200 residues are vital for the binding of Bel1 to viral promoter DNA. Moreover, mutating R 199 H 200 in Bel1 impairs PFV replication to a much greater extent than mutating R 221 R 222 R 223 . Collectively, our findings suggest that R 199 H 200 directly participate in Bel1 binding to viral promoter DNA and are indispensible for Bel1 transactivation activity. - Highlights: • The R 221 R 222 R 223 residues are essential for the nuclear localization of Bel1. • Although not affecting the nuclear localization of Bel1, mutating R 199 H 200 disables Bel1 from transactivating PFV promoters. • The R 199 H 200 residues directly participate in Bel1 binding to viral promoter DNA. • Mutating R 199 H 200 in Bel1 impairs PFV replication to a much greater extent than mutating R 221 R 222 R 223
Izac, Jerilyn R; Oliver, Lee D; Earnhart, Christopher G; Marconi, Richard T
2017-05-31
The lipoprotein OspA is produced by the Lyme disease spirochetes primarily in unfed ticks. OspA production is down-regulated by the blood meal and it is not produced in mammals except for possible transient production during late stage infection in patients with Lyme arthritis. Vaccination with OspA elicits antibody (Ab) that can target spirochetes in the tick midgut during feeding and inhibit transmission to mammals. OspA was the primary component of the human LYMErix™ vaccine. LYMErix™ was available from 1998 to 2002 but then pulled from the market due to declining sales as a result of unsubstantiated concerns about vaccination induced adverse events and poor efficacy. It was postulated that a segment of OspA that shares sequence similarity with a region in human LFA-1 and may trigger putative autoimmune events. While evidence supporting such a link has not been demonstrated, most efforts to move forward with OspA as a vaccine component have sought to eliminate this region of concern. Here we identify an OspA linear epitope localized within OspA amino acid residues 221-240 (OspA 221-240 ) that lacks the OspA region suggested to elicit autoimmunity. A peptide consisting of residues 221-240 was immunogenic in mice. Ab raised against OspA 221-240 peptide surface labeled B. burgdorferi in IFAs and displayed potent Ab mediated-complement dependent bactericidal activity. BLAST analyses identified several variants of OspA 221-240 and a closely related sequence in OspB. It is our hypothesis that integration of the OspA 221-240 epitope into a multivalent-OspC based chimeric epitope based vaccine antigen (chimeritope) could result in a subunit vaccine that protects against Lyme disease through synergistic mechanisms. Copyright © 2017. Published by Elsevier Ltd.
Two novel deletions (array CGH findings) in pigment dispersion syndrome.
Mikelsaar, Ruth; Molder, Harras; Bartsch, Oliver; Punab, Margus
2007-12-01
We report the first male with pigment dispersion syndrome and a balanced translocation t(10;15)(p11.1;q11.1). Cytogenetic analyses using Giemsa banding and FISH methods, and array CGH were performed. Array CGH analyses did not show altered DNA sequences in the breakpoints of the translocation, but revealed two novel deletions in 2q22.1 and 18q22.1. We suppose that the coexistence of t(10;15) and pigment dispersion syndrome in our patient is a coincidence. The deletion in 2q22.1, where the gene LRP1B has been located, may play a major role in the dysembryogenesis of the eye and cause the disorder.
76 FR 44279 - Radio Broadcasting Services; Clinchco, VA, and Coal Run, KY
2011-07-25
...] Radio Broadcasting Services; Clinchco, VA, and Coal Run, KY AGENCY: Federal Communications Commission... Station WPKE-FM, Coal Run Kentucky, from Channel 276A to Channel 221C3. DATES: Effective August 1, 2011... 221C3 at Coal Run, Kentucky, are 37-23-57 NL and 82-23-42 WL, and for Channel 276A at Clinchco, Virginia...
Directory of Open Access Journals (Sweden)
Rizwana Tasmin
Full Text Available Salmonella Typhimurium is the leading cause of human non-typhoidal gastroenteritis in the US. S. Kentucky is one the most commonly recovered serovars from commercially processed poultry carcasses. This study compared the genotypic and phenotypic properties of two Salmonella enterica strains Typhimurium (ST221_31B and Kentucky (SK222_32B recovered from commercially processed chicken carcasses using whole genome sequencing, phenotype characterizations and an intracellular killing assay. Illumina MiSeq platform was used for sequencing of two Salmonella genomes. Phylogenetic analysis employing homologous alignment of a 1,185 non-duplicated protein-coding gene in the Salmonella core genome demonstrated fully resolved bifurcating patterns with varying levels of diversity that separated ST221_31B and SK222_32B genomes into distinct monophyletic serovar clades. Single nucleotide polymorphism (SNP analysis identified 2,432 (ST19 SNPs within 13 Typhimurium genomes including ST221_31B representing Sequence Type ST19 and 650 (ST152 SNPs were detected within 13 Kentucky genomes including SK222_32B representing Sequence Type ST152. In addition to serovar-specific conserved coding sequences, the genomes of ST221_31B and SK222_32B harbor several genomic regions with significant genetic differences. These included phage and phage-like elements, carbon utilization or transport operons, fimbriae operons, putative membrane associated protein-encoding genes, antibiotic resistance genes, siderophore operons, and numerous hypothetical protein-encoding genes. Phenotype microarray results demonstrated that ST221_31B is capable of utilizing certain carbon compounds more efficiently as compared to SK222_3B; namely, 1,2-propanediol, M-inositol, L-threonine, α-D-lactose, D-tagatose, adonitol, formic acid, acetoacetic acid, and L-tartaric acid. ST221_31B survived for 48 h in macrophages, while SK222_32B was mostly eliminated. Further, a 3-fold growth of ST221_31B was
AIMSsim Version 2.2.1, User Manual
National Research Council Canada - National Science Library
Schoenborn, Oliver
2007-01-01
This user manual provides an overview of how to use the software developed to support the empirical investigation of a simulated user interface for an Advanced Integrated Multi sensor Surveillance (AIMS) system...
Gender | Page 221 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
One-pagers are a publication of IDRC's Globalization, Growth and Poverty program ... and processing have not kept pace with population growth and economic growth. ... the ways that environment interacts with an effective technology policy.
24 CFR 235.221 - Waived title objections.
2010-04-01
... a material extent. (6) Federal tax liens and rights of redemption arising thereform if the following... to an outstanding right of redemption in IRS if (i) the Federal tax lien was perfected subsequent to... MORTGAGE INSURANCE AND ASSISTANCE PAYMENTS FOR HOME OWNERSHIP AND PROJECT REHABILITATION Contract Rights...
28 CFR 2.21 - Reparole consideration guidelines.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Reparole consideration guidelines. 2.21....21 Reparole consideration guidelines. (a)(1) If revocation is based upon administrative violation(s... analogy with listed federal offense behaviors. (b) The guidelines for parole consideration specified at 28...
14 CFR 221.212 - Special tariff permission.
2010-01-01
...) When a filer submits an electronic tariff or an amendment to an electronic tariff for which authority... in the Government Filing File and the Filing Advice Status File, and shall be referenced in such a... notice. (b) When a filer submits an electronic tariff or an amendment to the electronic tariff for which...
22 CFR 22.1 - Schedule of fees.
2010-04-01
...: (a) Taking possession of personal effects; making an inventory under an official seal (unless... Waiver] 250. (e) Refugee or significant public benefit parole case processing [35-Refugee/Parole] No fee...
Gender | Page 221 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Humanity is rediscovering the need for a harmonious relationship with the Earth. Through Agenda 21, the global action plan for sustainable development into the 21st century, we have recognized the need for an integrated approach to planning and managing our land resources. To do otherwise would risk further ...
Alamethicin in lipid bilayers: combined use of X-ray scattering and MD simulations.
Pan, Jianjun; Tieleman, D Peter; Nagle, John F; Kucerka, Norbert; Tristram-Nagle, Stephanie
2009-06-01
We study fully hydrated bilayers of two di-monounsaturated phospholipids diC18:1PC (DOPC) and diC22:1PC with varying amounts of alamethicin (Alm). We combine the use of X-ray diffuse scattering and molecular dynamics simulations to determine the orientation of alamethicin in model lipids. Comparison of the experimental and simulated form factors shows that Alm helices are inserted transmembrane at high humidity and high concentrations, in agreement with earlier results. The X-ray scattering data and the MD simulations agree that membrane thickness changes very little up to 1/10 Alm/DOPC. In contrast, the X-ray data indicate that the thicker diC22:1PC membrane thins with added Alm, a total decrease in thickness of 4 A at 1/10 Alm/diC22:1PC. The different effect of Alm on the thickness changes of the two bilayers is consistent with Alm having a hydrophobic thickness close to the hydrophobic thickness of 27 A for DOPC; Alm is then mismatched with the 7 A thicker diC22:1PC bilayer. The X-ray data indicate that Alm decreases the bending modulus (K(C)) by a factor of approximately 2 in DOPC and a factor of approximately 10 in diC22:1PC membranes (P/L approximately 1/10). The van der Waals and fluctuational interactions between bilayers are also evaluated through determination of the anisotropic B compressibility modulus.
Directory of Open Access Journals (Sweden)
Lindahl Sofia
2011-02-01
Full Text Available Abstract Background The thermostable β-glucosidase (TnBgl1A from Thermotoga neapolitana is a promising biocatalyst for hydrolysis of glucosylated flavonoids and can be coupled to extraction methods using pressurized hot water. Hydrolysis has however been shown to be dependent on the position of the glucosylation on the flavonoid, and e.g. quercetin-3-glucoside (Q3 was hydrolysed slowly. A set of mutants of TnBgl1A were thus created to analyse the influence on the kinetic parameters using the model substrate para-nitrophenyl-β-D-glucopyranoside (pNPGlc, and screened for hydrolysis of Q3. Results Structural analysis pinpointed an area in the active site pocket with non-conserved residues between specificity groups in glycoside hydrolase family 1 (GH1. Three residues in this area located on β-strand 5 (F219, N221, and G222 close to sugar binding sub-site +2 were selected for mutagenesis and amplified in a protocol that introduced a few spontaneous mutations. Eight mutants (four triple: F219L/P165L/M278I, N221S/P165L/M278I, G222Q/P165L/M278I, G222Q/V203M/K214R, two double: F219L/K214R, N221S/P342L and two single: G222M and N221S were produced in E. coli, and purified to apparent homogeneity. Thermostability, measured as Tm by differential scanning calorimetry (101.9°C for wt, was kept in the mutated variants and significant decrease (ΔT of 5 - 10°C was only observed for the triple mutants. The exchanged residue(s in the respective mutant resulted in variations in KM and turnover. The KM-value was only changed in variants mutated at position 221 (N221S and was in all cases monitored as a 2-3 × increase for pNPGlc, while the KM decreased a corresponding extent for Q3. Turnover was only significantly changed using pNPGlc, and was decreased 2-3 × in variants mutated at position 222, while the single, double and triple mutated variants carrying a mutation at position 221 (N221S increased turnover up to 3.5 × compared to the wild type. Modelling
Operability test procedure for the TK-900 effluent monitoring station
International Nuclear Information System (INIS)
Weissenfels, R.D.
1994-01-01
This procedure will verify that the 221-B liquid effluent monitoring system, installed near the east end of the 6-in. chemical sewer header, functions as intended by design. TK-900B was installed near stairwell 3 in the 221-B electrical gallery by Project W-007H. The system is part of BAT/AKART for the BCE liquid effluent system
Energy Technology Data Exchange (ETDEWEB)
Najmudin, Shabir, E-mail: shabir@dq.fct.unl.pt [REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal); Pinheiro, Benedita A. [CIISA - Faculdade de Medicina Veterinária, Universidade Técnica de Lisboa, Avenida da Universidade Técnica, 1300-477 Lisboa (Portugal); Romão, Maria J. [REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal); Prates, José A. M.; Fontes, Carlos M. G. A., E-mail: shabir@dq.fct.unl.pt [CIISA - Faculdade de Medicina Veterinária, Universidade Técnica de Lisboa, Avenida da Universidade Técnica, 1300-477 Lisboa (Portugal); REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal)
2008-08-01
The N-terminal moiety of C. thermocellum endo-1,4-β-d-xylanase 10B, comprising a carbohydrate-binding module (CBM22-1) and a GH10 E337A mutant domain, has been crystallized in complex with xylohexaose. The crystals belong to the trigonal space group P3{sub 2}21, contain a dimer in the asymmetric unit and diffract to beyond 2.0 Å resolution. The cellulosome of Clostridium thermocellum is a highly organized multi-enzyme complex of cellulases and hemicellulases involved in the hydrolysis of plant cell-wall polysaccharides. The bifunctional multi-modular xylanase Xyn10B is one of the hemicellulase components of the C. thermocellum cellulosome. The enzyme contains an internal glycoside hydrolase family 10 catalytic domain (GH10) and a C-terminal family 1 carbohydrate esterase domain (CE1). The N-terminal moiety of Xyn10B (residues 32–551), comprising a carbohydrate-binding module (CBM22-1) and the GH10 E337A mutant, was crystallized in complex with xylohexaose. The crystals belong to the trigonal space group P3{sub 2}21 and contain a dimer in the asymmetric unit. The crystals diffracted to beyond 2.0 Å resolution.
Czech Academy of Sciences Publication Activity Database
Kubová, Hana
2006-01-01
Roč. 47, č. S4 (2006), s. 221-221 ISSN 0013-9580. [Annual Meeting of the American Epilepsy Society and Canadian League against Epilepsy. 01.12.2006-05.12.2006, San Diego, CA] R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : PTZ-induced seizures * clonazepam * agonist Ro 19-8022 Subject RIV: ED - Physiology
Valuation of American Call Option Considering Uncertain Volatility
Czech Academy of Sciences Publication Activity Database
Hlaváček, Ivan
2010-01-01
Roč. 2, č. 2 (2010), s. 211-221 ISSN 2070-0733 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional research plan: CEZ:AV0Z10190503 Keywords : American options * parabolic variational inequality * uncertain parameter Subject RIV: BA - General Mathematics Impact factor: 0.510, year: 2010 http://www.global-sci.org/aamm/readabs.php?vol=2&no=2&doc=211&year=2010&ppage=221
Liver lead concentrations in raptors in New Jersey, USA, 2008-2010.
Stansley, William; Murphy, Lisa A
2011-08-01
Lead exposure in New Jersey raptors was assessed by analyzing liver samples from carcasses obtained from wildlife rehabilitators. Samples were collected from 221 individuals representing 13 species. Concentrations were within the range of normal background exposure in 12 species. One red-tailed hawk had a liver lead concentration consistent with clinical poisoning (7.4 μg/g wet weight), which represents an incidence of 1% (1/104) in that species and 0.5% (1/221) in the overall sample. A second red-tailed hawk had a liver lead concentration consistent with subclinical exposure (2.1 μg/g wet weight). The combined incidence of elevated exposure (subclinical exposure + clinical poisoning) was 2% (2/104) in red-tailed hawks and 1% (2/221) in the overall sample.
Czech Academy of Sciences Publication Activity Database
Jakubík, Jan; Doležal, Vladimír
2005-01-01
Roč. 272, č. S1 (2005), s. 221-221 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] R&D Projects: GA AV ČR(CZ) IAA5011306; GA ČR(CZ) GP305/02/D090 Institutional research plan: CEZ:AV0Z5011922 Keywords : muscarinic receptors * allosteric interaction * strychnine -like modulators * mutations * extracellular loop Subject RIV: ED - Physiology
International Nuclear Information System (INIS)
1992-11-01
An aerial radiological survey of the Paducah Gaseous Diffusion Plant (PGDP) and surrounding area in Paducah, Kentucky, was conducted during May 15--25, 1990. The purpose of the survey was to measure and document the terrestrial radiological environment at the PGDP and surrounding area for use in effective environmental management and emergency response planning. The aerial survey was flown at an altitude of 61 meters (200 feet) along a series of parallel lines 107 meters (350 feet) apart. The survey encompassed an area of 62 square kilometers (24 square miles), bordered on the north by the Ohio River. The results of the aerial survey are reported as inferred exposure rates at 1 meter above ground level in the form of a gamma radiation contour map. Typical background exposure rates were found to vary from 5 to 12 microroentgens per hour (μR/h). Protactinium-234m, a radioisotope indicative of uranium-238, was detected at several facilities at the PGDR. In support of the aerial survey, ground-based exposure rate and soil sample measurements were obtained at several sites within the survey perimeter. The results of the aerial and ground-based measurements were found to agree within ±15%
An aerial radiological survey of the Portsmouth Gaseous Diffusion Plant and surrounding area
International Nuclear Information System (INIS)
Sampoll-Ramirez, G.
1994-09-01
An aerial radiological survey was conducted from August 10-16, 1993, over a 78-square-kilometer (30-square-mile) area of the Portsmouth Gaseous Diffusion Plant and surrounding area located near Portsmouth, Ohio. The survey was performed at a nominal altitude of 46 meters (150 feet) with a line spacing of 76 meters (250 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level was prepared and overlaid on a set of United States Geological Survey topographic maps of the area and an aerial photograph of the plant. The terrestrial gamma exposure rates varied from about 7 to 14 microroentgens per hour at 1 meter above the ground. Protactinium-234m was observed at six sites within the boundaries of the plant. At a seventh site, only uranium-235 was observed. No other man-made, gamma ray-emitting radioactive material was present in a detectable quantity, either on or off the plant property. Soil sample and pressurized ion chamber measurements were obtained at four locations within the survey boundaries to support the aerial data. The results of the aerial and ground-based measurements were found to agree within ± 7.5%
Growth rates of iron-manganese concretions in the Pacific and Indian oceans
International Nuclear Information System (INIS)
Kuznetsov, Yu.V.; Pospelov, Yu.N.
1978-01-01
Radiochemical analysis has been used for studying the distribution of 231 Pa, 230 Th, 232 Th, 226 Ra, 234 U, and 238 U isotopes in nineteen iron-manganese concretions. The study has shown a considerable violation of the equilibrium between uranium and daughter isotopes, viz, protactinium-231 and thorium-230. A sharp decrease of the ratios between the 231 Pain concretions made it possible to find the growth rates of 10 concretions from pelagic regions of the Pacific and Indian oceans. The obtained data deviate in narrow limits and amount to (3-6)mm/10 6 years when evaluation is made according to 230 Th decay and (4-7)mm/10 6 years when 231 Pa is used. The presence of Ra excess (as compared with mother isotopes 230 Th) in inner layers of the concretions points to the fact that the growth rates determined by the radium method are raised too high due to radium migration from the surface layers into the depth of the concretion. It is shown that accumulation of 231 Pa and 230 Th in concretions accounts for a small part (less than 25%) of their production from uranium dissolved in the sea water
A brief history of the Delayed'' discovery of nuclear fission
Energy Technology Data Exchange (ETDEWEB)
Holden, N.E.
1989-08-01
This year marks the Fiftieth Anniversary of the discovery of Nuclear Fission. In the early 1930's, the neutron was discovered, followed by the discovery of artificial radioactivity and then the use of the neutron to produce artificial radioactivity. The first experiments resulting in the fission of uranium took place in 1934. A paper which speculated on fission as an explanation was almost immediately published, yet no one took it seriously not even the author herself. Why did it take an additional five years before anyone realized what had occurred This is an abnormally long time in a period when discoveries, particularly in nuclear physics, seemed to be almost a daily occurrence. The events which led up to the discovery are recounted, with an attempt made to put them into their historical perspective. The role played by Mendeleev's Periodic Table, the role of the natural radioactive decay chain of uranium, the discovery of protactinium, the apparent discovery of masurium (technetium) and a speculation on the reason why Irene Curie may have missed the discovery of nuclear fission will all be discussed. 43 refs.
International Nuclear Information System (INIS)
Guss, P.P.
1993-04-01
An aerial radiological survey was conducted from July 18 through July 25, 1988, over a 41-square-kilometer (16-square-mile) area surrounding the Babcock and Wilcox nuclear facilities located near Lynchburg, Virginia. The survey was conducted at a nominal altitude of 61 meters (200 feet) with line spacings of 91 meters (300 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level (AGL) was prepared and overlaid on an aerial photograph. The terrestrial exposure rates varied from 8 to 12 microroentgens per hour (μR/h). A search of the data for man-made radiation sources revealed the presence of three areas of high count rates in the survey area. Spectra accumulated over the main plant showed the presence of cobalt-60 ( 60 Co) and cesium-137 ( 137 Cs). A second area near the main plant indicated the presence of uranium-235 ( 235 U). Protactinium-234m ( 234m Pa) and 60 Co Were detected over a building to the east of the main plant. Soil samples and pressurized ion chamber measurements were obtained at four locations within the survey boundaries in support of the aerial data
Parametric analyses of single-zone thorium-fueled molten salt reactor fuel cycle options
International Nuclear Information System (INIS)
Powers, J.J.; Worrall, A.; Gehin, J.C.; Harrison, T.J.; Sunny, E.E.
2013-01-01
Analyses of fuel cycle options based on thorium-fueled Molten Salt Reactors (MSRs) have been performed in support of fuel cycle screening and evaluation activities for the United States Department of Energy. The MSR options considered are based on thermal spectrum MSRs with 3 different separations levels: full recycling, limited recycling, and 'once-through' operation without active separations. A single-fluid, single-zone 2250 MWth (1000 MWe) MSR concept consisting of a fuel-bearing molten salt with graphite moderator and reflectors was used as the basis for this study. Radiation transport and isotopic depletion calculations were performed using SCALE 6.1 with ENDF/B-VII nuclear data. New methodology developed at Oak Ridge National Laboratory (ORNL) enables MSR analysis using SCALE, modeling material feed and removal by taking user-specified parameters and performing multiple SCALE/TRITON simulations to determine the resulting equilibrium operating conditions. Parametric analyses examined the sensitivity of the performance of a thorium MSR to variations in the separations efficiency for protactinium and fission products. Results indicate that self-sustained operation is possible with full or limited recycling but once-through operation would require an external neutron source. (authors)
The raw material and waste activity balance in the projected nuclear power of Russia
International Nuclear Information System (INIS)
Adamov, E.O.; Ganev, I.Kh.; Lopatkin, A.V.; Muratov, V.G.; Orlov, V.V.
1997-01-01
Under discussion is the management of long-lived high-level wastes in the nuclear energy sector of Russia, the development of which on a large scale in the next century is motivated by the need for arresting the increasing consumption of fossil fuels. The prerequisites for the nuclear power growth consists in the design of naturally safe reactors and development of a transmutational nuclear fuel cycle (NFC) technology. The choice of operations in such a cycle and of their quantitative characteristics, is aimed at minimizing the wastes to approach the radiation balance with the natural uranium extracted and put to use. The paper discusses the way the approximation to the balance between the raw material and waste activity is influenced by introduction of the transmutational NFC (in case 2), inclusion of transmutation reactors into the energy mix (case 1), partial disposal of actinide wastes into outer space, and by recycling of protactinium (case 3). It is shown that such a balance can be sustained for a considerable time in cases 2 and 3 or throughout the operation stage of the future nuclear power (case 1). (orig.)
2007-01-01
Active 0 0 Austin Memorial AFRC Camp Mabry 3 72,525 0 0 1311 14.1 357 16 0Army Reserve 0 0 Bergstrom - ( Abia ) Austin 0 0 7 170,221 700 52.5 566 62...AFRC Camp Mabry 3 72,525 0 0 1311 14.1 357 16 0Army Reserve 0 0 Bergstrom - ( Abia ) Austin 0 0 7 170,221 700 52.5 566 62 0Army Guard 0 0* Camp Bullis
2007-06-01
Policy: The Commission as Policy Entrepreneur in the CFSP,” European Foreign Affairs Review 8, no. 2 (2003): 221. 4 Stephan R. Hurt, “The European...Harvey, eds. Millennial Reflections on International Studies. Michigan: University of Michigan Press, 2002. Keohane, Robert, and Lisa L. Martin. “The... Entrepreneur in the CFSP.” European Foreign Affairs Review 8, no. 2 (2003): 221-237. ———.“Mehr als ein Papiertieger? Die Konfliktbearbeitungspolitik
Strong gravity and supersymmetry
International Nuclear Information System (INIS)
Chamseddine, Ali H.; Salam, A.; Strathdee, J.
1977-11-01
A supersymmetric theory is constructed for a strong f plus a weak g graviton, together with their accompanying massive gravitinos, by gaugin the gradel 0Sp(2,2,1)x 0Sp(2,2,1) structure. The mixing term between f and g fields, which makes the strong graviton massive, can be introduced through a spontaneous symmetry-breaking mechanism implemented in this note by constructing a non-linear realization of the symmetry group
40 CFR 264.221 - Design and operating requirements.
2010-07-01
..., and other equipment; and human error. (h) A surface impoundment must have dikes that are designed... (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES... external hydrogeologic forces), physical contact with the waste or leachate to which they are exposed...
14 CFR 221.107 - Notice of contract terms.
2010-01-01
... readily available for public inspection at each airport or other ticket sales office of the carrier... display continuously in a conspicuous public place at each airport or other ticket sales office of the... ticket sales office of the carrier. In addition, all other locations where the carrier's tickets may be...
40 CFR 22.1 - Scope of this part.
2010-07-01
... penalty under sections 1414(g)(3)(B), 1423(c), and 1447(b) of the Safe Drinking Water Act as amended (42 U... pursuant to section 402(a) of the Clean Water Act, as amended (33 U.S.C. 1319(g), 1321(b)(6), and 1342(a... of the Mercury-Containing and Rechargeable Battery Management Act (42 U.S.C. 14304). (b) The...
14 CFR 125.221 - Icing conditions: Operating limitations.
2010-01-01
... appendix C of this part or those for transport category airplane type certification, no pilot may fly— (1... pilot may fly an airplane into known or forecast severe icing conditions. (e) If current weather reports... CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD...
1935 15' Quad #221 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
34 CFR 685.221 - Income-based repayment plan.
2010-07-01
... for the year the borrower certifies family size. Support includes money, gifts, loans, housing, food... of the couple's total eligible loan debt; (B) The adjusted monthly payment for each borrower by...
Lifescience Database Archive (English)
Full Text Available idfti*nns*nntinsysftenntnnif*tnswffngsthk* *csdpntps*tnn**g**kantkcspc*wgysykeistliiivi--- Translated Amino ...nfnnkhfnkk*wilsvtqcttttsntyant*knitktnsdtgtk hhvtghiigswipni*kfidfti*nns*nntinsysftenntnnif*tnswffngsthk* *csdpntps*tnn**g**kant
47 CFR 1.221 - Notice of hearing; appearances.
2010-10-01
... reasons for the Commission's action. (2) A statement as to the matters of fact and law involved, and the... comparative hearings. (c) In order to avail himself of the opportunity to be heard, the applicant, in person... resubmitted with the FRN within ten (10) business days of the date of notification. (g) In comparative...
14 CFR 221.140 - Method of giving concurrence.
2010-01-01
...) Conflicting authority to be avoided. Care should be taken to avoid giving authority to two or more carriers... Aviation shall be used by a carrier to give authority to another carrier to issue and file with the... used as authority to file joint fares or charges in which the carrier to whom the concurrence is given...
12 CFR 221.1 - Authority, purpose, and scope.
2010-01-01
... extend credit for the purpose of buying or carrying margin stock if the credit is secured directly or... Commodity Futures Trading Commission that accept deposits of margin stock in connection with: (i) The... for the purchase or sale of a commodity for future delivery or options on such contracts. (3) This...
46 CFR 502.221 - Briefs; requests for findings.
2010-10-01
... presiding officer shall fix the time and manner of filing briefs and any enlargement of time. The period of... subject index or table of contents with page references and a list of authorities cited. (f) All briefs... pages containing the table of contents, table of authorities, and certificate of service, unless the...
Lifescience Database Archive (English)
Full Text Available uence update 2002.10.25 Translated Amino Acid sequence *mittnvqlmhvpkkvv*lilqstlmitmpvqlilvhhqpvfptpqsivmikr...pvqlihv qiqlvv*ilqfpvtiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm *miitnvqlihvpkkvv*lilqsilmitm...CDSKTGKCINKPYNV ITSGSNLISGLIGGLIGGGTGGKGIAKL*kl Frame B: *mittnvqlmhvpkkvv*lilqstlmitmpvqlilvhhqpvfptpqsivmi...krpvqlihv qiqlvv*ilqfpvtiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm *miitnvqlihvpkkvv*lilqsilmitmpvplipah...mf klnwlckysn*l*r**smyrrlmq*fnwlckhssqc****xmyrrclyqinrcysypxqc x**qqmyn*cmyqrrwg*lipqsilmitmpvqlmhvqxkx---
39 CFR 221.3 - Office of Inspector General.
2010-07-01
... administration of postal programs and operations. (ii) Prevent and detect fraud and abuse in postal programs and..., installing, and/or operating postal operations or programs. (3) Extent of powers. In addition to the... employees as may be necessary for carrying out the functions, powers, and duties of the OIG. (vi) Obtain the...
30 CFR 75.221 - Roof control plan information.
2010-07-01
... installation and spacing of supports for each method of mining used. (6) When an ATRS system is used, the... of pillar recovery, and the sequence of mining pillars. (9) A list of all support materials required... mining approaches within 150 feet of an outcrop. (12) A description of the roof and rib support necessary...
Preparation of 2H- and 13C-labelled precursors of 2-hydroxy-1, 3-butadiene
International Nuclear Information System (INIS)
Turecek, F.
1987-01-01
2-exo-Vinylbicyclo[2.2.1]hept-5-en-2-ols, specifically labelled with 2 H at C-3 and in the vinyl group were prepared from bicyclo[2.2.1]hept-5-en-2-one in several steps. [4- 13 C]oct-1-en-3-one was prepared in five steps from 13 CO 2 . These compounds serve as precursors for the preparation of specifically labelled neutral and ionized 2-hydroxy-1, 3-butadienes. (author)
MicroRNA-Mediated Regulation of ITGB3 and CHL1 Is Implicated in SSRI Action
Directory of Open Access Journals (Sweden)
Keren Oved
2017-11-01
Full Text Available Background: Selective serotonin reuptake inhibitor (SSRI antidepressant drugs are the first-line of treatment for major depressive disorder (MDD but are effective in <70% of patients. Our earlier genome-wide studies indicated that two genes encoding for cell adhesion proteins, close homolog of L1 (CHL1 and integrin beta-3 (ITGB3, and microRNAs, miR-151a-3p and miR-221/222, are implicated in the variable sensitivity and response of human lymphoblastoid cell lines (LCL from unrelated individuals to SSRI drugs.Methods: The microRNAs miR-221, miR-222, and miR-151-a-3p, along with their target gene binding sites, were explored in silico using miRBase, TargetScan, microRNAviewer, and the UCSC Genome Browser. Luciferase reporter assays were conducted for demonstrating the direct functional regulation of ITGB3 and CHL1 expression by miR-221/222 and miR-151a-3p, respectively. A human LCL exhibiting low sensitivity to paroxetine was utilized for studying the phenotypic effect of CHL1 regulation by miR-151a-3p on SSRI response.Results: By showing direct regulation of CHL1 and ITGB3 by miR-151a-3p and miR-221/222, respectively, we link these microRNAs and genes with cellular SSRI sensitivity phenotypes. We report that miR-151a-3p increases cell sensitivity to paroxetine via down-regulating CHL1 expression.Conclusions: miR-151a-3p, miR-221/222 and their (here confirmed respective target-genes, CHL1 and ITGB3, are implicated in SSRI responsiveness, and possibly in the clinical response to antidepressant drugs.
Directory of Open Access Journals (Sweden)
MacMillan Andrée
2005-04-01
Full Text Available Abstract Background X-linked mental retardation (XLMR is the leading cause of mental retardation in males. Mutations in the ARX gene in Xp22.1 have been found in numerous families with both nonsyndromic and syndromic XLMR. The most frequent mutation in this gene is a 24 bp duplication in exon 2. Based on this fact, a panel of XLMR families linked to Xp22 was tested for this particular ARX mutation. Methods Genomic DNA from XLMR families linked to Xp22.1 was amplified for exon 2 in ARX using a Cy5 labeled primer pair. The resulting amplicons were sized using the ALFexpress automated sequencer. Results A panel of 11 families with X-linked mental retardation was screened for the ARX 24dup mutation. Four nonsyndromic XLMR families – MRX29, MRX32, MRX33 and MRX38 – were found to have this particular gene mutation. Conclusion We have identified 4 additional XLMR families with the ARX dup24 mutation from a panel of 11 XLMR families linked to Xp22.1. This finding makes the ARX dup24 mutation the most common mutation in nonsyndromic XLMR families linked to Xp22.1. As this mutation can be readily tested for using an automated sequencer, screening should be considered for any male with nonsyndromic MR of unknown etiology.
International Nuclear Information System (INIS)
Amato, L.C.; Franklin, J.D.; Hyre, R.A.; Lowy, R.M.; Millar, J.S.; Pottmeyer, J.A.; Duncan, D.R.
1994-08-01
This study was intended to characterize and estimate the amounts of equipment and other materials that are candidates for removal and subsequent processing in a solid waste facility when the major processing and handling facilities in the 200 Areas of the Hanford Site are decontaminated and decommissioned. The facilities in this study were selected based on processing history and on the magnitude of the estimated decommissioning cost cited in the Surplus Facilities Program Plan; Fiscal Year 1993 (Winship and Hughes 1992). The facilities chosen for this study include B Plant (221-B), T Plant (221-T), U Plant (221-U), the Uranium Trioxide (UO 3 ) Plant (224-U and 224-UA), the Reduction Oxidation (REDOX) or S Plant (202-S), the Plutonium Concentration Facility for B Plant (224-B), and the Concentration Facility for the Plutonium Finishing Plant (PFP) and REDOX (233-S). This information is required to support planning activities for current and future solid waste treatment, storage, and disposal operations and facilities
First complete genome sequence of parainfluenza virus 5 isolated from lesser panda.
Zhai, Jun-Qiong; Zhai, Shao-Lun; Lin, Tao; Liu, Jian-Kui; Wang, He-Xing; Li, Bing; Zhang, He; Zou, Shu-Zhan; Zhou, Xia; Wu, Meng-Fan; Chen, Wu; Luo, Man-Lin
2017-05-01
Parainfluenza virus 5 (PIV5) is widespread in mammals and humans. Up to now, there is little information about PIV5 infection in lesser pandas. In this study, a PIV5 variant (named ZJQ-221) was isolated from a lesser panda with respiratory disease in Guangzhou zoo in Guangdong province, southern China. The full-length genome of ZJQ-221 was found to be 15,246 nucleotides and consisted of seven non-overlapping genes encoding eight proteins (i.e., NP, V, P, M, F, SH, HN and L). Sequence alignment and genetic analysis revealed that ZJQ-221 shared a close relationship with a PIV5 strain of canine-origin (1168-1) from South Korea. The findings of this study confirm the presence of PIV5 in lesser panda and indicate this mammal as a possible natural reservoir. Furthermore they highlight the urgent need to strengthen viral surveillance and control of PIV5 in zoo animals.
Energy Technology Data Exchange (ETDEWEB)
Amato, L.C.; Franklin, J.D.; Hyre, R.A.; Lowy, R.M.; Millar, J.S.; Pottmeyer, J.A. [Los Alamos Technical Associates, Kennewick, WA (United States); Duncan, D.R. [Westinghouse Hanford Co., Richland, WA (United States)
1994-08-01
This study was intended to characterize and estimate the amounts of equipment and other materials that are candidates for removal and subsequent processing in a solid waste facility when the major processing and handling facilities in the 200 Areas of the Hanford Site are decontaminated and decommissioned. The facilities in this study were selected based on processing history and on the magnitude of the estimated decommissioning cost cited in the Surplus Facilities Program Plan; Fiscal Year 1993 (Winship and Hughes 1992). The facilities chosen for this study include B Plant (221-B), T Plant (221-T), U Plant (221-U), the Uranium Trioxide (UO{sub 3}) Plant (224-U and 224-UA), the Reduction Oxidation (REDOX) or S Plant (202-S), the Plutonium Concentration Facility for B Plant (224-B), and the Concentration Facility for the Plutonium Finishing Plant (PFP) and REDOX (233-S). This information is required to support planning activities for current and future solid waste treatment, storage, and disposal operations and facilities.
1984-01-01
FORMING COMPANY 33 33 BONNER SPRINGS STEPHEN R E INC 95 95 BURLINGTON BRECKCO CONSTRUCTION CO INC 430 430 CHANUTE PORTER H K COMPANY INC 1,792 364 1,428...SEP) PAGE 848 MASS (DOLLARS IN THOUSANDS) LOCATION CONTRACTOR DOD AIR NAME NAME TOTAL ARMY NAVY FORCE DLA OCE ODA RANDOLPH MC GRAW -EDISON COMPANY 45...221 221 GENERAL DYNAMICS CORPORATION 2,127- 2,127- GENERAL DYNAMICS LAND SYS 12,866 12,866 MC DONNELL DOUGLAS CORPORATION 3,549 1,022 2.527 NC GRAW
Structure of fenchone by broadband rotational spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Loru, Donatella; Bermúdez, Miguel A.; Sanz, M. Eugenia [Department of Chemistry, King’s College London, London SE1 1DB (United Kingdom)
2016-08-21
The bicyclic terpenoid fenchone (C{sub 10}H{sub 16}O, 1,3,3-trimethylbicyclo[2.2.1]heptan-2-one) has been investigated by chirped pulse Fourier transform microwave spectroscopy in the 2-8 GHz frequency region. The parent species and all heavy atom isotopologues have been observed in their natural abundance. The experimental rotational constants of all isotopic species observed have been determined and used to obtain the substitution (r{sub s}) and effective (r{sub 0}) structures of fenchone. Calculations at the B3LYP, M06-2X, and MP2 levels of theory with different basis sets were carried out to check their performance against experimental results. The structure of fenchone has been compared with those of norbornane (bicyclo[2.2.1]heptane) and the norbornane derivatives camphor (1,7,7-trimethylbicyclo[2.2.1]heptan-2-one) and camphene (3,3-dimethyl-2-methylenebicyclo[2.2.1]heptane), both with substituents at C{sub 2}. The structure of fenchone is remarkably similar to those of camphor and camphene. Comparison with camphor allows identification of changes in ∠CCC angles due to the different position of the methyl groups. All norbornane derivatives display similar structural changes with respect to norbornane. These changes mainly affect the bond lengths and angles of the six-membered rings, indicating that the substituent at C{sub 2} drives structural adjustments to minimise ring strain after its introduction.
New Genotypes of Enterocytozoon bieneusi Isolated from Sika Deer and Red Deer in China
Directory of Open Access Journals (Sweden)
Jianying Huang
2017-05-01
Full Text Available To examine the occurrence and genotype distribution of Enterocytozoon bieneusi in cervids, 615 fecal samples were collected from red deer (Cervus elaphus and sika deer (Cervus nippon on 10 different farms in Henan and Jilin Province. Enterocytozoon bieneusi was identified and genotyped with a nested PCR analysis of the internal transcribed spacer (ITS region of the rRNA genes, showing an average infection rate of 35.9% (221/615. In this study, 25 ITS genotypes were identified including seven known genotypes (BEB6, EbpC, EbpA, D, HLJDI, HLJD-IV, and COS-I and 18 novel genotypes (designated JLD-I to JLD-XIV, HND-I to HND-IV. Among these, BEB6 (131/221, 59.3% was the predominant genotype (P < 0.01, followed by HLJDI (18/221, 8.1% and JLD-VIII (16/221, 7.2%. BEB6 has recently been detected in humans and nonhuman primates in China. The phylogenetic analysis showed that BEB6, HLJDI, HLJD-IV, COS-I, and 10 novel genotypes (JLD-VII to JLD-XIV, HND-III to HND-IV clustered in group 2. Genotype D, EbpC, and EbpA, known to cause human microsporidiosis worldwide, clustered in group 1, the members of which have zoonotic potential, together with eight novel genotypes (JLD-I to JLD-VI, HND-I to HND-II. Therefore, deer may play a role in the transmission of E. bieneusi to humans.
ORF Alignment: NC_004556 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 221 ... Query: 10 ... RLHEGDALRLLCDIDSASVDAVITDPPYCSGAMRMADRFKPTKRKYINNGTKHVAPDFDC 69 ... RLHEGDALRLLCDIDSASVDAVITDPP...YCSGAMRMADRFKPTKRKYINNGTKHVAPDFDC Sbjct: 1 ... RLHEGDALRLLCDIDSASVDAVITDPP
Global ocean conveyor lowers extinction risk in the deep sea
Henry, Lea-Anne; Frank, Norbert; Hebbeln, Dierk; Wienberg, Claudia; Robinson, Laura; van de Flierdt, Tina; Dahl, Mikael; Douarin, Mélanie; Morrison, Cheryl L.; López Correa, Matthias; Rogers, Alex D.; Ruckelshausen, Mario; Roberts, J. Murray
2014-06-01
General paradigms of species extinction risk are urgently needed as global habitat loss and rapid climate change threaten Earth with what could be its sixth mass extinction. Using the stony coral Lophelia pertusa as a model organism with the potential for wide larval dispersal, we investigated how the global ocean conveyor drove an unprecedented post-glacial range expansion in Earth's largest biome, the deep sea. We compiled a unique ocean-scale dataset of published radiocarbon and uranium-series dates of fossil corals, the sedimentary protactinium-thorium record of Atlantic meridional overturning circulation (AMOC) strength, authigenic neodymium and lead isotopic ratios of circulation pathways, and coral biogeography, and integrated new Bayesian estimates of historic gene flow. Our compilation shows how the export of Southern Ocean and Mediterranean waters after the Younger Dryas 11.6 kyr ago simultaneously triggered two dispersal events in the western and eastern Atlantic respectively. Each pathway injected larvae from refugia into ocean currents powered by a re-invigorated AMOC that led to the fastest postglacial range expansion ever recorded, covering 7500 km in under 400 years. In addition to its role in modulating global climate, our study illuminates how the ocean conveyor creates broad geographic ranges that lower extinction risk in the deep sea.
International Nuclear Information System (INIS)
Vojtech, R.J.
1993-12-01
An aerial radiological survey was conducted during the period of October 14 to November 23, 1991, over an area surrounding the United States Department of Energy's Savannah River Site (SRS). The area is situated 15 kilometers south of Aiken, South Carolina. The purpose of the survey was to measure and document the gamma ray environment of the SRS and surrounding areas. Contour maps showing gamma radiation exposure rates at 1 meter above ground level were constructed from the aerial data and overlaid on a United States Geological Survey map of the area. The exposure rates measured within the survey region are generally uniform and typical of natural background. The reported exposure rate values include an estimated cosmic ray contribution. Enhanced exposure rates not attributable to natural background were measured over several areas within the survey region. The manmade radionuclides detected in these areas, cesium-137, cobalt-60, and protactinium-234m, were produced by the reactor operations and material processing conducted at the SRS. The radiation levels produced by these nuclides are consistent with those levels measured during previous SRS aerial surveys. Radionuclide assays of soil samples and pressurized ion chamber measurements were obtained at four locations within the survey boundaries
Oral intake of radionuclides in the population
International Nuclear Information System (INIS)
Johansson, L.
1982-11-01
Dose factors of some radionuclides have been reviewed with respect to a chronic oral intake by members of the public. The radionuclides taken into account are Pu-239, Np-237, Ra-226, Th-230, Pa-231, Tc-99 and I-129, all of which might be of potential hazard at a long term storage disposal. The parameter which has the major influence on the dose factor, for most of the radionuclides studied, is the uptake from the gut. In order to assess the dose factor it is therefore essential to make a good estimate of the gastrointestinal uptake of the radionuclides under the actual conditions. The annual limit of intake (ALI) given in ICRP 30, is intended to be applicable on a population of workers, and for a single intake. Since the gut uptake figures in the ICRP-publication are based mainly on uptake values recieved in experiment animals, given single relatively large oral doses of the isotope studied. From a review of current literature, gut absorbation factors and dose factors, to be used for members of the public at a chronic oral intake, are suggested. Compared with those for workers in ICRP 30, the dose factors increases for plutonium and protactinium, and decreases for neptunium. (Author)
Cationic Phospholipids Forming Cubic Phases: Lipoplex Structure and Transfection Efficiency
Energy Technology Data Exchange (ETDEWEB)
Koynova, Rumiana; Wang, Li; MacDonald, Robert C. (NWU)
2008-10-29
The transfection activity and the phase behavior of two novel cationic O-alkyl-phosphatidylcholines, 1,2-dioleoyl-sn-glycero-3-hexylphosphocholine (C6-DOPC) and 1,2-dierucoyl-sn-glycero-3-ethylphosphocholine (di22:1-EPC), have been examined with the aim of more completely understanding the mechanism of lipid-mediated DNA delivery. Both lipids form cubic phases: C6-DOPC in the entire temperature range from -10 to 90 C, while di22:1-EPC exhibits an irreversible lamellar-cubic transition between 50 and 70 C on heating. The lipoplexes formed by C6-DOPC arrange into hexagonal phase, while the lipoplexes of di22:1-EPC are lamellar. Both lipids exhibit lower transfection activity than the lamellar-forming 1,2-dioleoyl-sn-glycero-3-ethylphosphocholine (EDOPC). Thus, for the studied cationic phospholipid-DNA systems, the lipoplex phase state is a factor that does not seem to correlate with transfection activity. The parameter that exhibits better correlation with the transfection activity within the present data set is the phase state of the lipid dispersion prior to the addition of DNA. Thus, the lamellar lipid dispersion (EDOPC) produces more efficient lipoplexes than the dispersion with coexisting lamellar and cubic aggregates (diC22:1-EPC), which is even more efficient than the purely cubic dispersions (C6-DOPC; diC22:1-EPC after heating). It could be inferred from these data and from previous research that cubic phase lipid aggregates are unlikely to be beneficial to transfection. The lack of correlation between the phase state of lipoplexes and their transfection activity observed within the present data set does not mean that lipid phase state is generally unimportant for lipofection: a viewpoint now emerging from our previous studies is that the critical factor in lipid-mediated transfection is the structural evolution of lipoplexes within the cell, upon interacting and mixing with cellular lipids.
Cationic phospholipids forming cubic phases: lipoplex structure and transfection efficiency.
Koynova, Rumiana; Wang, Li; Macdonald, Robert C
2008-01-01
The transfection activity and the phase behavior of two novel cationic O-alkyl-phosphatidylcholines, 1,2-dioleoyl- sn-glycero-3-hexylphosphocholine (C6-DOPC) and 1,2-dierucoyl- sn-glycero-3-ethylphosphocholine (di22:1-EPC), have been examined with the aim of more completely understanding the mechanism of lipid-mediated DNA delivery. Both lipids form cubic phases: C6-DOPC in the entire temperature range from -10 to 90 degrees C, while di22:1-EPC exhibits an irreversible lamellar-cubic transition between 50 and 70 degrees C on heating. The lipoplexes formed by C6-DOPC arrange into hexagonal phase, while the lipoplexes of di22:1-EPC are lamellar. Both lipids exhibit lower transfection activity than the lamellar-forming 1,2-dioleoyl- sn-glycero-3-ethylphosphocholine (EDOPC). Thus, for the studied cationic phospholipid-DNA systems, the lipoplex phase state is a factor that does not seem to correlate with transfection activity. The parameter that exhibits better correlation with the transfection activity within the present data set is the phase state of the lipid dispersion prior to the addition of DNA. Thus, the lamellar lipid dispersion (EDOPC) produces more efficient lipoplexes than the dispersion with coexisting lamellar and cubic aggregates (diC22:1-EPC), which is even more efficient than the purely cubic dispersions (C6-DOPC; diC22:1-EPC after heating). It could be inferred from these data and from previous research that cubic phase lipid aggregates are unlikely to be beneficial to transfection. The lack of correlation between the phase state of lipoplexes and their transfection activity observed within the present data set does not mean that lipid phase state is generally unimportant for lipofection: a viewpoint now emerging from our previous studies is that the critical factor in lipid-mediated transfection is the structural evolution of lipoplexes within the cell, upon interacting and mixing with cellular lipids.
Cady, Sarah; Wang, Tuo; Hong, Mei
2011-01-01
The influenza A M2 protein forms a proton channel for virus infection and also mediates virus assembly and budding. The minimum protein length that encodes both functions contains the transmembrane (TM) domain (roughly residues 22 to 46) for the amantadine-sensitive proton-channel activity and an amphipathic cytoplasmic helix (roughly residues 45 to 62) for curvature induction and virus budding. However, structural studies involving the TM domain with or without the amphipathic helix differed on the drug-binding site. Here we use solid-state NMR spectroscopy to determine the amantadine binding site in the cytoplasmic-helix-containing M2(21–61). 13C-2H distance measurements of 13C-labeled protein and 2H-labeled amantadine showed that in DMPC bilayers, the first equivalent of drug bound S31 inside the M2(21–61) pore, similar to the behavior of M2TM in DMPC bilayers. The non-specific surface site of D44 observed in M2TM is disfavored in the longer peptide. Thus, the pharmacologically relevant drug-binding site in the fully functional M2(21–61) is S31 in the TM pore. Interestingly, when M2(21–61) was reconstituted into a virus-mimetic membrane containing 30% cholesterol, no chemical shift perturbation was observed for pore-lining residues, while M2TM in the same membrane exhibited drug-induced chemical shift changes. Reduction of the cholesterol level and the use of unsaturated phospholipids shifted the conformational equilibrium of M2TM fully to the bound state, but did not rescue drug binding to M2(21–61). These results suggest that the amphipathic helix, together with cholesterol, modulates the ability of the TM helices to bind amantadine. Thus, the M2 protein interacts with the lipid membrane and small-molecule inhibitors in a complex fashion, and a careful examination of the environmental dependence of the protein conformation is required to fully understand the structure-function relation of this protein. PMID:21661724
The discovery of plutonium reorganized the periodic table and aided the discovery of new elements
International Nuclear Information System (INIS)
Clark, David L.
2009-01-01
The modern Periodic Table derives principally from the work of the great Russian scientist Dimitri Mendeleev, who in 1869 enunciated a 'periodic law' that the properties of the elements are a periodic function of their atomic weights, and arranged the 65 known elements in a 'periodic table'. Fundamentally, every column in the main body of the Periodic Table is a grouping of elements that display similar chemical and physical behavior. Similar properties are therefore exhibited by elements with widely different mass. Chemical periodicity is central to the study of chemistry, and no other generalization comes close to its ability to systematize and rationalize known chemical facts. With the development of atomic theory, and an understanding of the electronic structure of atoms, chemical periodicity and the periodic table now find their natural explanation in the electronic structure of atoms. Moving from left to right along any row, the elements are arranged sequentially according to nuclear charge (the atomic number). Electrons counter balance that nuclear charge, hence each successive element has one more electron in its configuration. The electron configuration, or distribution of electrons among atomic orbitals, may be determined by application of the Pauli principle (paired spin in the same orbital) and the aufbau principle (which outlines the order of filling of electrons into shells of orbitals - s, p, d, f, etc.) such that in a given atom, no two electrons may have all four quantum numbers identical. In 1939, only three elements were known to be heavier than actinium: thorium, protactinium, and uranium. All three exhibited variable oxidation states and a complex chemistry. Thorium, protactinium and uranium were assumed to be d-transition metals and were placed in the Periodic Table under hafnium, tantalum, and tungsten, respectively. By 1940, McMillan and Abelson bombarded uranium atoms with slow neutrons and successfully identified atoms of element 93, which
National Research Council Canada - National Science Library
Ferreira, H. C
2010-01-01
... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Channel Modeling Fundamentals . . . . . . . . . . . . . . . . . . . . . . . . 2.2.1 Brief Review of Indoor/Outdoor Topologies . . . . . . . . . . . . . . 2.2.1.1 Low...
20 CFR 410.221 - Prescribed application and request forms.
2010-04-01
... SAFETY ACT OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Requirements for Entitlement; Duration of... Safety Act of 1969 (widow's claim)), SSA-48 (application for benefits under the Black Lung Benefits Act of 1972 (child's claim)), and SSA-49 (application for benefits under the Black Lung Act of 1972...
Publications | Page 221 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Mariage et divorce à Dakar : itinéraires féminins (restricted access) · Trois exemples de recherche-action dans le secteur public québécois (open access) · Exercice Outcome Mapping : TIC et Gouvernance Locale (restricted access) · Atelier de formation des membres de la COPES-AOC en mobilisation des ressources, ...
All projects related to | Page 221 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Total Funding: CA$ 2,972,900.00. Neglected Issues Relating to African Health Systems: An Incentive for Reform. Project. Inequalities in access to and quality of health services result in poorer health for disadvantaged groups. Topic: WEST AFRICA, ACCESS TO HEALTH CARE, RESEARCH CAPACITY, HEALTH ...
24 CFR 221.305 - Condition of the multifamily structure.
2010-04-01
... has been damaged by fire and such property was not covered by fire insurance at the time of the damage... from the insurance benefits for any loss occasioned by such fire if the following conditions are met: (1) The property shall have been covered by fire insurance at the time the mortgage was insured. (2...
14 CFR 221.195 - Requirement for filing printed material.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Requirement for filing printed material... filing printed material. (a) Any tariff, or revision thereto, filed in paper format which accompanies... supporting paper tariff, except as authorized by the Department. (b) Any printed justifications, or other...
20 CFR 702.221 - Claims for compensation; time limitations.
2010-04-01
... which the last compensation payment was made. (b) In the case of a hearing loss claim, the time for... report which indicates the employee has sustained a hearing loss that is related to his or her employment... LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims...
221 THE ROLE OF BIRTH ORDER IN SUBSTANCE RELATED ...
African Journals Online (AJOL)
Administrator
centre. The second objective was to investigate whether psychological birth order (a .... Figure 1: A Bar graph presenting frequencies for Ordinal Birth Order. N. Mean. SD. .... children on ground of birth order or on whatever basis. By making ...
40 CFR 94.221 - Application of good engineering judgment.
2010-07-01
... judgment in making all decisions called for under this part, including but not limited to selections... was not made in good faith, or that the decision was not made with a rational basis, the Administrator... Administrator may reject any such decision by a manufacturer if it is not based on good engineering judgment or...
Directory of Open Access Journals (Sweden)
Marta Matulova
Full Text Available In this study we were interested in identification of new markers of chicken response to Salmonella Enteritidis infection. To reach this aim, gene expression in the spleens of naive chickens and those intravenously infected with S. Enteritidis with or without previous oral vaccination was determined by 454 pyrosequencing of splenic mRNA/cDNA. Forty genes with increased expression at the level of transcription were identified. The most inducible genes encoded avidin (AVD, extracellular fatty acid binding protein (EXFABP, immune responsive gene 1 (IRG1, chemokine ah221 (AH221, trappin-6-like protein (TRAP6 and serum amyloid A (SAA. Using cDNA from sorted splenic B-lymphocytes, macrophages, CD4, CD8 and γδ T-lymphocytes, we found that the above mentioned genes were preferentially expressed in macrophages. AVD, EXFABP, IRG1, AH221, TRAP6 and SAA were induced also in the cecum of chickens orally infected with S. Enteritidis on day 1 of life or day 42 of life. Unusual results were obtained for the immunoglobulin encoding transcripts. Prior to the infection, transcripts coding for the constant parts of IgM, IgY, IgA and Ig light chain were detected in B-lymphocytes. However, after the infection, immunoglobulin encoding transcripts were expressed also by T-lymphocytes and macrophages. Expression of AVD, EXFABP, IRG1, AH221, TRAP6, SAA and all immunoglobulin genes can be therefore used for the characterization of the course of S. Enteritidis infection in chickens.
Zheng, Shuangshuang; Eierhoff, Thorsten; Aigal, Sahaja; Brandel, Annette; Thuenauer, Roland; de Bentzmann, Sophie; Imberty, Anne; Römer, Winfried
2017-07-01
The human pathogen Pseudomonas aeruginosa induces phosphorylation of the adaptor protein CrkII by activating the non-receptor tyrosine kinase Abl to promote its uptake into host cells. So far, specific factors of P. aeruginosa, which induce Abl/CrkII signalling, are entirely unknown. In this research, we employed human lung epithelial cells H1299, Chinese hamster ovary cells and P. aeruginosa wild type strain PAO1 to study the invasion process of P. aeruginosa into host cells by using microbiological, biochemical and cell biological approaches such as Western Blot, immunofluorescence microscopy and flow cytometry. Here, we demonstrate that the host glycosphingolipid globotriaosylceramide, also termed Gb3, represents a signalling receptor for the P. aeruginosa lectin LecA to induce CrkII phosphorylation at tyrosine 221. Alterations in Gb3 expression and LecA function correlate with CrkII phosphorylation. Interestingly, phosphorylation of CrkII Y221 occurs independently of Abl kinase. We further show that Src family kinases transduce the signal induced by LecA binding to Gb3, leading to Crk Y221 phosphorylation. In summary, we identified LecA as a bacterial factor, which utilizes a so far unrecognized mechanism for phospho-CrkII Y221 induction by binding to the host glycosphingolipid receptor Gb3. The LecA/Gb3 interaction highlights the potential of glycolipids to mediate signalling processes across the plasma membrane and should be further elucidated to gain deeper insights into this non-canonical mechanism of activating host cell processes. Copyright © 2017 Elsevier B.V. All rights reserved.
Micro RNAs as molecular markers of glioblastoma multiform
Energy Technology Data Exchange (ETDEWEB)
Farace, M G [Department Experimental Medicine and Biochemical Sciences, University of Tor Vergata, Rome (Italy); Finocchiaro, G [Istituto Neurologico Besta, Milan (Italy); Ricci Vitiani, L [Department of Hematology, Oncology and Molecular Medicine, Istituto Superiore di Sanita, Rome (Italy)
2009-07-01
The aim of this project was to unravel the role that miR-221 and miR-222, of which we had already demonstrated the specific differential expression in glioblastoma multiforme compared to normal brain, play in the control of cell proliferation, with the ultimate goal to provide new insights in the molecular basis of cancer. The results of our research allowed to identify an important molecular target for miRNA-221 and miR-222, highly expressed in glioblastoma multiforme tissues and cell lines, and to precisely recognize the mRNA regions responsible for this regulation.
Micro RNAs as molecular markers of glioblastoma multiform
International Nuclear Information System (INIS)
Farace, M.G.; Finocchiaro, G.; Ricci Vitiani, L.
2009-01-01
The aim of this project was to unravel the role that miR-221 and miR-222, of which we had already demonstrated the specific differential expression in glioblastoma multiforme compared to normal brain, play in the control of cell proliferation, with the ultimate goal to provide new insights in the molecular basis of cancer. The results of our research allowed to identify an important molecular target for miRNA-221 and miR-222, highly expressed in glioblastoma multiforme tissues and cell lines, and to precisely recognize the mRNA regions responsible for this regulation
International Nuclear Information System (INIS)
Hansen, P.E.; Hansen, Aa.E.; Lycka, A.; Buvari-Barcza, A.
1993-01-01
One-bond deuterium isotope effects on nitrogen nuclear shielding, 1 ΔN(D) and two-bond isotope effects at 1 H nuclear shielding, 2 ΔH(D), have been investigated in a series of inclusion complexes. The hosts comprise, SC-24, [2.2.2], [2.2.1], [2.2.1] D, [2.2] DD, K5, 18-crown-6 and 18-crown-6 tetracarboxylic acid. The structure of the host [2.2.1] is discussed based on isotope effects and 1 H chemical shifts, and an interesting exchange reaction is observed between CDCl 3 and ammonium ions in the [2.2.1] complex. The counterion dependence is shown to be zero for ammonium ions fully included in cages such as SC-24 and [2.2.2] and for 18-C-6(COOH) 4 . For cryptands and podands such as [2.2.1] and K5 a weak counterion dependence of 2 ΔH(D) opposite to that found for ammonium ions in water is observed, while 1 ΔN(D) and 15 N chemical shifts depend very strongly on the counterions, as also found for ammonium ions in water solution. The anilinium ion shows effects similar to those observed for the ammonium ion. 1 ΔN(D) isotope effects correlate well with δN and 2 ΔH(D) correlate with δNH. The correlation between 1 ΔN(D) and 2 ΔH(D) is different for ammonium ions in water and ions included in crowns, cryptands or podands. This shows that different mechanisms are operating. The 2 ΔH(D) isotope effects and δNH chemical shifts depend on the distance to the nearest acceptor (oxygen or nitrogen), and they also depend on the type of acceptor. 2 ΔH(D) isotope effects are found to be a good gauge of N ... N or N ... O distances of the inclusion complexes. The 2 ΔH(D) isotope effects vary with temperature, but the dramatic changes in the 1 H NMR spectra of the host are not reflected in the isotope effects. The one-bond couplings, 1 J(N,H), correlate with 2 ΔH(D). The variations are much larger for the cryptands than found in water solutions. (au) (50 refs.)
VizieR Online Data Catalog: Massive star forming molecular clumps Tkin (Tang+, 2017)
Tang, X. D.; Henkel, C.; Menten, K. M.; Zheng, X. W.; Esimbek, J.; Zhou, J. J.; Yeh, C. C.; Konig, C.; Yuan, Y.; He, Y. X.; Li, D. L.
2016-10-01
We have selected 30 massive clumps of the Galactic disk at various stages of high-mass star formation and with strong NH3 emission from the ATLASGAL survey (see Table 1). Our observations were carried out in 2015 April, July, and October with the 15m James Clerk Maxwell Telescope telescope (JCMT) on Mauna Kea. The beam size is ~23" and the main-beam efficiency is {eta}mb=Ta*/Tmb~=0.7 at 218GHz. The para-H2CO JKAKC =303-202, 322-221, and 321-220 transitions have rest frequencies of 218.222, 218.475, and 218.760GHz, respectively, which are measured simultaneously by employing the ACSIS digital autocorrelation spectrometer with the special backend configuration RxAH2CO250x3 allowing for three windows, each with a bandwidth of 250MHz. This provides a velocity resolution of 0.084km/s for para-H2CO (303-202 and 322-221) and 0.042km/s for para-H2CO (321-220); CH3OH (422-312) at 218.440GHz is also observed together with para-H2CO (322-221). (6 data files).
ORF Alignment: NC_002488 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 96 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 155 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFV...NTAYGEFFGVDLSSGTVPEWS Sbjct: 1 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 60 ... Query: 216 SSPDVT 221 ... SSPDVT Sbjct: 121 SSPDVT 126
Risk analysis: assessing uncertainties beyond expected values and probabilities
National Research Council Canada - National Science Library
Aven, T. (Terje)
2008-01-01
... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.2 How to describe risk quantitatively . . . . . . . . . . . . . . . . . 2.2.1 Description of risk in a financial context . . . . . . . . . 2.2.2 Description...
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available as ... axonopodis pv. citri str. 306] ... Length = 221 ... Query: 40 ... VLATDAHGYLENQQLPDSVQLVPPPPQ...DGSAALANDEAVAKAMLALRGTPRWELAAQDAV 99 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAAL...ANDEAVAKAMLALRGTPRWELAAQDAV Sbjct: 3 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAALANDEAVAKAMLALRGTPRWELAAQDAV 62 ... Quer
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available retrotransposon Tca5 polyprotein [Candida albicans SC5314] ... Length = 221 ... Query: 556 QLHDSLGHTSTQQ...VSNVMKRFNVTTDNIGTDCETCRLGKAITQIPKISTHTISSHCLELL 615 ... QLHDSLGHTSTQQVSNVMKRFNVTTDNIGTDCETCRLGKAITQIP...KISTHTISSHCLELL Sbjct: 1 ... QLHDSLGHTSTQQVSNVMKRFNVTTDNIGTDCETCRLGKAITQIPKISTHTISS
Analysis of burnup of Angra 2 PWR nuclear with addition of thorium dioxide fuel using ORIGEN-ARP
Energy Technology Data Exchange (ETDEWEB)
Goncalves, Isadora C.; Wichrowski, Caio C.; Oliveira, Claudio L. de; Vellozo, Sergio O.; Baptista, Camila O., E-mail: isadora.goncalves@ime.eb.br, E-mail: wichrowski@ime.eb.br, E-mail: d7luiz@yahoo.com.br, E-mail: vellozo@ime.eb.br, E-mail: camila.oliv.baptista@gmail.com [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Secao de Engenharia Nuclear
2017-11-01
It is known that isotope {sup 232}thorium is a fertile nuclide with the ability to convert into {sup 233}uranium, a potentially fissile isotope, after absorbing a neutron. As there is a large stock of available thorium in the world, this element shows great promise in mitigate the world energy crisis, more particularly in the problem of uranium scarcity, besides being an alternative nuclear fuel for those currently used in reactors, and yet presenting advantages as an option for the non-proliferation movement, among others. In this study, the analysis of the remaining nuclides of burnup was carried out for the core configuration of a PWR (pressurized water reactor) reactor, specifically the Angra 2 reactor, using only uranium dioxide, its current configuration, and in different configurations including a mixed oxide of uranium and thorium in three concentrations, allowing a preliminary assessment of the feasibility of the modification of the fuel, the resulting production of {sup 233}uranium, the emergence of {sup 231}protactinium (an isotope that only occurs as a fission product of {sup 232}Th) resulting from burning. The study was carried out using data obtained from FSAR (Final Safety Analysis Report) of Angra 2, using the SCALE 6.1, a modeling and simulation nuclear code, especially its ORIGEN-ARP module, which analyzes the depletion of isotopes presents in a reactor. (author)
Fuel processing for molten-salt reactors
International Nuclear Information System (INIS)
Hightower, J.R. Jr.
1976-01-01
Research devoted to development of processes for the isolation of protactinium and for the removal of fission products from molten-salt breeder reactors is reported. During this report period, engineering development progressed on continuous fluorinators for uranium removal, the metal transfer process for rare-earth removal, the fuel reconstitution step, and molten salt--bismuth contactors to be used in reductive extraction processes. The metal transfer experiment MTE-3B was started. In this experiment all parts of the metal transfer process for rare-earth removal are demonstrated using salt flow rates which are about 1 percent of those required to process the fuel salt in a 1000-MW(e) MSBR. During this report period the salt and bismuth phases were transferred to the experimental vessels, and two runs with agitator speeds of 5 rps were made to measure the rate of transfer of neodymium from the fluoride salt to the Bi--Li stripper solution. The uranium removed from the fuel salt by fluorination must be returned to the processed salt in the fuel reconstitution step before the fuel salt is returned to the reactor. An engineering experiment to demonstrate the fuel reconstitution step is being installed. In this experiment gold-lined equipment will be used to avoid introducing products of corrosion by UF 6 and UF 5 . Alternative methods for providing the gold lining include electroplating and mechanical fabrication
Oral intake of radionuclides in the population
International Nuclear Information System (INIS)
Johansson, L.
1982-10-01
Dose factors of some radionuclides have been reviewed with respect to a chronic oral intake by means of the public. The radionuclides taken into account are Pu-239, Np-237, Ra-226, Th-230, Pa-231, Tc-99 and I-129, all of which might be of potential hazard at a long term storage disposal. The parameter that have the major influence on the dose factor, for most of the radionuclides studied, is the uptake from the gut. In order to assess the dose factor it is therefore essential to make a good estimate of the gastrointestinal uptake of the radionuclides under the actual conditions. The 'annual limit of intake' (ALI) given in ICRP 30, is intended to be applicable on a population of workers, and for a single intake. Since the gut uptake in the ICRP-publication are based mainly on uptake values recieved in experimental animals, given single relatively large oral doses of the isotope studied. From a review of current literature, gut absorbtion factors and dose factors, to be used for members of the public at a chronic oral intake, are suggested. Compared with those for workers in ICRP 30, the dose factors increase for plutonium and protactinium, and decrease for neptunium. An attempt to predict possible future changes of the ALI for members of the general public is also made. (Author)
Analysis of burnup of Angra 2 PWR nuclear with addition of thorium dioxide fuel using ORIGEN-ARP
International Nuclear Information System (INIS)
Goncalves, Isadora C.; Wichrowski, Caio C.; Oliveira, Claudio L. de; Vellozo, Sergio O.; Baptista, Camila O.
2017-01-01
It is known that isotope "2"3"2thorium is a fertile nuclide with the ability to convert into "2"3"3uranium, a potentially fissile isotope, after absorbing a neutron. As there is a large stock of available thorium in the world, this element shows great promise in mitigate the world energy crisis, more particularly in the problem of uranium scarcity, besides being an alternative nuclear fuel for those currently used in reactors, and yet presenting advantages as an option for the non-proliferation movement, among others. In this study, the analysis of the remaining nuclides of burnup was carried out for the core configuration of a PWR (pressurized water reactor) reactor, specifically the Angra 2 reactor, using only uranium dioxide, its current configuration, and in different configurations including a mixed oxide of uranium and thorium in three concentrations, allowing a preliminary assessment of the feasibility of the modification of the fuel, the resulting production of "2"3"3uranium, the emergence of "2"3"1protactinium (an isotope that only occurs as a fission product of "2"3"2Th) resulting from burning. The study was carried out using data obtained from FSAR (Final Safety Analysis Report) of Angra 2, using the SCALE 6.1, a modeling and simulation nuclear code, especially its ORIGEN-ARP module, which analyzes the depletion of isotopes presents in a reactor. (author)
Wang, Tuo; Cady, Sarah D.; Hong, Mei
2012-01-01
The M2 protein of the influenza A virus acts both as a drug-sensitive proton channel and mediates virus budding through membrane scission. The segment responsible for causing membrane curvature is an amphipathic helix in the cytoplasmic domain of the protein. Here, we use 31P and 13C solid-state NMR to examine M2-induced membrane curvature. M2(22–46), which includes only the transmembrane (TM) helix, and M2(21–61), which contains an additional amphipathic helix, are studied. 31P chemical shift lineshapes indicate that M2(21–61) causes a high-curvature isotropic phase to both cholesterol-rich virus-mimetic membranes and 1,2-dimyristoyl-sn-glycero-3-phosphocholine bilayers, whereas M2(22–46) has minimal effect. The lamellar and isotropic domains have distinct 31P isotropic chemical shifts, indicating perturbation of the lipid headgroup conformation by the amphipathic helix. 31P- and 13C-detected 1H T2 relaxation and two-dimensional peptide-lipid correlation spectra show that M2(21–61) preferentially binds to the high-curvature domain. 31P linewidths indicate that the isotropic vesicles induced by M2(21–61) are 10–35 nm in diameter, and the virus-mimetic vesicles are smaller than the 1,2-dimyristoyl-sn-glycero-3-phosphocholine vesicles. A strong correlation is found between high membrane curvature and weak drug-binding ability of the TM helix. Thus, the M2 amphipathic helix causes membrane curvature, which in turn perturbs the TM helix conformation, abolishing drug binding. These NMR experiments are applicable to other curvature-inducing membrane proteins such as fusion proteins and antimicrobial peptides. PMID:22385849
Tavian, Daniela; Missaglia, Sara; Redaelli, Chiara; Pennisi, Elena M; Invernici, Gloria; Wessalowski, Ruediger; Maiwald, Robert; Arca, Marcello; Coleman, Rosalind A
2012-12-15
The lack of adipose triglyceride lipase (ATGL), a patatin-like phospholipase domain-containing enzyme that hydrolyzes fatty acids from triacylglycerol (TAG) stored in multiple tissues, causes the autosomal recessive disorder neutral lipid storage disease with myopathy (NLSD-M). In two families of Lebanese and Italian origin presenting with NLSD-M, we identified two new missense mutations in highly conserved regions of ATGL (p.Arg221Pro and p.Asn172Lys) and a novel nonsense mutation (p.Trp8X). The Lebanese patients harbor homozygous p.Arg221Pro, whereas the Italian patients are heterozygotes for p.Asn172Lys and the p.Trp8X mutation. The p.Trp8X mutation results in a complete absence of ATGL protein, while the p.Arg221Pro and p.Asn172Lys mutations result in proteins with minimal lipolytic activity. Although these mutations did not affect putative catalytic residues or the lipid droplet (LD)-binding domain of ATGL, cytosolic LDs accumulated in cultured skin fibroblasts from the patients. The missense mutations might destabilize a random coil (p.Asn172Lys) or a helix (p.Arg221Pro) structure within or proximal to the patatin domain of the lipase, thereby interfering with the enzyme activity, while leaving intact the residues required to localize the protein to LDs. Overexpressing wild-type ATGL in one patient's fibroblasts corrected the metabolic defect and effectively reduced the number and area of cellular LDs. Despite the poor lipase activity in vitro, the Lebanese siblings have a mild myopathy and not clinically evident myocardial dysfunction. The patients of Italian origin show a late-onset and slowly progressive skeletal myopathy. These findings suggest that a small amount of correctly localized lipase activity preserves cardiac function in NLSD-M.
Munang'andu, Hetron M; Fredriksen, Børge N; Mutoloki, Stephen; Brudeseth, Bjørn; Kuo, Tsun-Yung; Marjara, Inderjit S; Dalmo, Roy A; Evensen, Øystein
2012-06-08
Two strains of IPNV made by reverse genetics on the Norwegian Sp strain NVI-015 (GenBank AY379740) backbone encoding the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs were used to prepare inactivated whole virus (IWV), nanoparticle vaccines with whole virus, Escherichia coli subunit encoding truncated VP2-TA and VP2-PT, VP2-TA and VP2-PT fusion antigens with putative translocating domains of Pseudomonas aeruginosa exotoxin, and plasmid DNA encoding segment A of the TA strain. Post challenge survival percentages (PCSP) showed that IWV vaccines conferred highest protection (PCSP=42-53) while nanoparticle, sub-unit recombinant and DNA vaccines fell short of the IWV vaccines in Atlantic salmon (Salmo salar L.) postsmolts challenged with the highly virulent Sp strain NVI-015 (TA strain) of IPNV after 560 degree days post vaccination. Antibody levels induced by these vaccines did not show antigenic differences between the virulent and avirulent motifs for vaccines made with the same antigen dose and delivery system after 8 weeks post vaccination. Our findings show that fish vaccinated with less potent vaccines comprising of nanoparticle, DNA and recombinant vaccines got infected much earlier and yielded to higher infection rates than fish vaccinated with IWV vaccines that were highly potent. Ability of the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs to limit establishment of infection showed equal protection for vaccines made of the same antigen dose and delivery systems. Prevention of tissue damage linked to viral infection was eminent in the more potent vaccines than the less protective ones. Hence, there still remains the challenge of developing highly efficacious vaccines with the ability to eliminate the post challenge carrier state in IPNV vaccinology. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Christa E Flück
Full Text Available CONTEXT: Steroidogenic acute regulatory protein (StAR is crucial for transport of cholesterol to mitochondria where biosynthesis of steroids is initiated. Loss of StAR function causes lipoid congenital adrenal hyperplasia (LCAH. OBJECTIVE: StAR gene mutations causing partial loss of function manifest atypical and may be mistaken as familial glucocorticoid deficiency. Only a few mutations have been reported. DESIGN: To report clinical, biochemical, genetic, protein structure and functional data on two novel StAR mutations, and to compare them with published literature. SETTING: Collaboration between the University Children's Hospital Bern, Switzerland, and the CIBERER, Hospital Vall d'Hebron, Autonomous University, Barcelona, Spain. PATIENTS: Two subjects of a non-consanguineous Caucasian family were studied. The 46,XX phenotypic normal female was diagnosed with adrenal insufficiency at the age of 10 months, had normal pubertal development and still has no signs of hypergonodatropic hypogonadism at 32 years of age. Her 46,XY brother was born with normal male external genitalia and was diagnosed with adrenal insufficiency at 14 months. Puberty was normal and no signs of hypergonadotropic hypogonadism are present at 29 years of age. RESULTS: StAR gene analysis revealed two novel compound heterozygote mutations T44HfsX3 and G221S. T44HfsX3 is a loss-of-function StAR mutation. G221S retains partial activity (∼30% and is therefore responsible for a milder, non-classic phenotype. G221S is located in the cholesterol binding pocket and seems to alter binding/release of cholesterol. CONCLUSIONS: StAR mutations located in the cholesterol binding pocket (V187M, R188C, R192C, G221D/S seem to cause non-classic lipoid CAH. Accuracy of genotype-phenotype prediction by in vitro testing may vary with the assays employed.
14 CFR 221.150 - Method of giving power of attorney.
2010-01-01
... accordance with a form acceptable to the Office of International Aviation shall be used by a carrier to give... the word “Agent”. When such a designee is replaced the Department shall be immediately notified in...
14 CFR 221.180 - Requirements for electronic filing of tariffs.
2010-01-01
... Departmental headquarters, during normal business hours. (4) The access required at Departmental headquarters... name of the contact person at the telephone company who has the responsibility for dealing with the...
Measuring patchy reionization with kSZ2-21 cm correlations
Ma, Q.; Helgason, K.; Komatsu, E.; Ciardi, B.; Ferrara, A.
2018-05-01
We study cross-correlations of the kinetic Sunyaev-Zel'dovich effect (kSZ) and 21 cm signals during the epoch of reionization (EoR) to measure the effects of patchy reionisation. Since the kSZ effect is proportional to the line-of-sight velocity, the kSZ-21 cm cross correlation suffers from cancellation at small angular scales. We thus focus on the correlation between the kSZ-squared field (kSZ2) and 21 cm signals. When the global ionization fraction is low (xe ≲ 0.7), the kSZ2 fluctuation is dominated by rare ionized bubbles, which leads to an anticorrelation with the 21 cm signal. When 0.8 ≲ xe primary cosmic microwave background (CMB) anisotropy. The expected signal-to-noise ratios for a ˜10-h integration of upcoming Square Kilometre Array data cross-correlated with maps from the current generation of CMB observatories with 3.4μK arcmin noise and 1.7 arcmin beam over 100 deg2 are 51, 60, and 37 for xe = 0.2, 0.5, and 0.9, respectively.
77 FR 30351 - Sec. 221 Public Private Partnerships Public Meeting
2012-05-22
... statute requires that such a program be based on public- private partnership (PPP) principles and maximize... implement a PPP equipage incentives program. FOR FURTHER INFORMATION CONTACT: Ann Tedford, Office of Finance...
Measurements of octupole collectivity in Rn and Ra nuclei using Coulomb excitation
We propose to exploit the unique capability of HIE-ISOLDE to provide post-accelerated $^{221,222}$Rn and $^{222,226,228}$Ra ion beams for the study of octupole collectivity in these nuclei. We will measure E3 transition moments in $^{222}$Rn and $^{222,226,228}$Ra in order to fully map out the variation in E3 strength in the octupole mass region with Z$\\thicksim$88 and N$\\thicksim$134. This will validate model calculations that predict different behaviour as a function of N. We will also locate the position of the parity doublet partner of the ground state in $^{221}$Rn, in order to test the suitability of odd-A radon isotopes for EDM searches.
Composition of the volatile oil of Achillea conferta DC. from Iran
Directory of Open Access Journals (Sweden)
Soodabeh Saeidnia
2005-01-01
Full Text Available Top flowered aerial parts of Achillea conferta DC. (Compositae, which is found in the central and western regions of Iran were collected from Taleghan area and the volatile oil was isolateds by hydrodistillation. The oil (0.2 % V/W was analyzed by GC and GC/MS using DB-5 column. Forty-eight components, representing 91.4% of the oil were identified. The main components were camphor (22.1% and 1,8-cineole (10.0%. The percentage of oxygenated compounds was 79.0% of the total oil. The oil o was rich in monoterpenes with two typical major components of Achillea species, camphor (22.1% and 1, 8- cineole (10.0%.
Antibiotic Use Practices by Pharmacy Staff: A Cross-Sectional Study in Saint-Petersburg, Russia
Czech Academy of Sciences Publication Activity Database
Belkina, T.V.; Duvanová, N.; Korolkova, A.; Duintjer Tebbens, Jurjen; Vlček, J.
2016-01-01
Roč. 25, Suppl S3 (2016), s. 221-222 ISSN 1053-8569 Institutional support: RVO:67985807 Keywords : antibiotic use * pharmacists * antimicrobial resistance Subject RIV: FR - Pharmacology ; Medidal Chemistry
2293-IJBCS-Article-Prof Germain J Sawadogo
African Journals Online (AJOL)
hp
*Auteur correspondant, E-mail: swadogo@refer.sn ; Tel. (221) 33 865 10 08 ; Fax ... appartiennent aux habitudes alimentaires de nombreuses ..... Bacterial contaminations of informally marketed raw ... Escherichia coli, Listeria monocytogenes,.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Author Affiliations. T V Ramakrishnan1. Department of Physics, Banaras Hindu University, Varanasi 221 005, India and Centre for Condensed Matter Theory, Indian Institue of Science, Bengaluru 560 012, India.
Setkání bulharistů - Třetí mezinárodní kongres bulharistiky
Czech Academy of Sciences Publication Activity Database
Havlíková, Lubomíra
2014-01-01
Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History
Nucleophilic addition of nitriles to secondary terpene alcohols
International Nuclear Information System (INIS)
Kozlov, N.G.; Popova, L.A.; Nesterov, G.V.
1987-01-01
The addition of nitriles of varying nucleophilicity to isocamphanol and exo-1,5,5-trimethyl-bicyclo[2.2.1]heptan-2-ol (isofenchol) was investigated. The authors examined the effect of the reaction conditions on the yield and structure of the target products of the reaction: N-substituted amides. As a result of the study, it was shown that in the reaction with chloroacetonitrile, propionitrile, methoxypropionitrile, isovaleronitrile, and phenylacetonitrile under the conditions of the Ritter reaction, isocamphanol is transformed into the corresponding substituted exo-N-acyl-1,7,7-trimethylbicyclo[2.2.1]hept-2-ylamines, as in the reaction with aceto- and benzonitriles, due to 2,6-hydride displacement accompanied by Wagner-Meerwein rearrangement. The structures of these amides were demonstrated by PMR spectroscopy
Role of micro RNAs in development and hematopoietic/mesenchymal/neural neoplasias
International Nuclear Information System (INIS)
Peschle, C.; Croce, C.M.
2009-01-01
Micro RNAs (miRNAs or miRs) are small noncoding RNAs that regulate gene expression primarily through translational repression. In erythropoietic (E) culture of cord blood CD34+ progenitor cells, the level of miR 221 and 222 is gradually and sharply down-modulated. Hypothetically, this decline could promote erythropoiesis by unblocking expression of key functional proteins. Indeed: 1.) bioinformatic analysis suggested that miR 221 and 222 target the 3' UTR of kit mRNA; 2.) the luciferase assay confirmed that both miRNAs directly interact with the kit mRNA target site; and 3.) in E culture undergoing exponential cell growth, miRNA down-modulation is inversely related to increasing kit protein expression, whereas the kit mRNA level is relatively stable
291-B-1 stack monitoring and sampling system annual system assessment report
International Nuclear Information System (INIS)
Ridge, T.M.
1994-01-01
The B Plant 291-B-1 main stack exhausts gaseous effluents to the atmosphere from the 221-B Building canyon and cells, the No. 1 Vessel Ventilation System (VVS1), the 212-B Cask Station cell ventilation system, and, to a limited capacity, the 224-B Building. VVS1 collects offgases from various process tanks in 221-B Building, while the 224-B system maintains a negative pressure in out-of-service, sealed process tanks. B Plant Administration Manual, WHC-CM-7-5, Section 5.30 requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with Stack 291-B-1 (System Number B977A) at B Plant. The system is functional and performing satisfactorily
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2010-01-01
Results 221 - 230 of 1368 ... Comparative report on innovation systems and inequality in the BRICS : annex 5; BRICS project. Published date. January 1, 2010. Papers. SCIENCE AND TECHNOLOGY NATIONAL INNOVATION SYSTEM ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Commentary: Understanding Anopheles and Plasmodium interactions: lessons ... Volume 37 Issue 2 June 2012 pp 221-226 Brief communication. Molecular typing of fecal eukaryotic microbiota of human infants and their respective mothers.
Hor - A Sedentarisation Success for Tibetan Pastoralists in Qinghai?
Czech Academy of Sciences Publication Activity Database
Ptáčková, Jarmila
2015-01-01
Roč. 19, č. 2 (2015), s. 221-240 ISSN 0822-7942 Institutional support: RVO:68378009 Keywords : Sedentarisation, resettlement, Tibetan pastoralists, grassland development, vocational training Subject RIV: AC - Archeology, Anthropology, Ethnology
Book Review: Restorative justice and victimology: Euro-Africa ...
African Journals Online (AJOL)
Abstract. Title: Restorative Justice and Victimology: Euro-Africa Perspectives, Author: Dr Don John O. Omale, Publisher: Wolf Publishers, Price: R354, Pages: 221, Availability: Published, ISBN: 978-90-5850-861-4 ...
O przyczynach braku wyobrażeń miłości fizycznej w literaturze górnołużyckiej i kaszubskiej
Czech Academy of Sciences Publication Activity Database
Derlatka, Tomasz
2015-01-01
Roč. 161, č. 1 (2015), s. 221-229 ISSN 0137-1150 Institutional support: RVO:68378017 Keywords : Cassubian literature * Upper Lusatian literature * sexuality in literature Subject RIV: AJ - Letters, Mass-media, Audiovision
24 CFR 245.10 - Applicability of part.
2010-04-01
... program or the Section 202 Supportive Housing for the Elderly program; or (7) The project receives.... Section 221(d)(3) BMIR Program means the below-market interest rate mortgage insurance program under...
2010-06-04
... Manufacturers of motor vehicle parts and accessories. 221 Electric, gas, and sanitary services. 622 Health...)) vacating and remanding CAA section 112(d) MACT standards for the Brick and Structural Clay Ceramics source...
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 369 ... Networks for Development : Caribbean Information and Communication Technologies Research Programme ... was a pioneer in the discipline of economic development theory and its policy implications for the region.
U Plant Aggregate Area Management study technical baseline report
International Nuclear Information System (INIS)
DeFord, D.H.; Carpenter, R.W.
1995-05-01
This document was prepared in support of an Aggregate Area Management Study of U Plant. It provides a technical baseline of the aggregate area and results from an environmental investigation that was undertaken by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (WHC), which is currently the Waste Site and Facility Research Office, Natural Resources, Bechtel Hanford, Inc. (BHI). It is based upon review and evaluation of numerous Hanford Site current and historical reports, drawings and photographs, supplemented with site inspections and employee interviews. U Plant refers to the 221-U Process Canyon Building, a chemical separation facility constructed during World War II. It also includes the Uranium Oxide (UO 3 ) Plant constructed at the same time as 221-U as an adjunct to the original plutonium separation process but which, like 221-U, was converted for other missions. Waste sites are associated primarily with U Plant's 1952 through 1958 Uranium Metal Recovery Program mission and the U0 3 Plant's ongoing U0 3 mission. Waste sites include cribs, reverse wells, french drains, septic tanks and drain fields, trenches, catch tanks, settling tanks, diversion boxes, a waste vault, and the lines and encasements that connect them. It also includes the U Pond and its feed ditches and an underground tank farm designed for high-level liquid wastes
relay coordination in the protection of radially-connected power
African Journals Online (AJOL)
... PROTECTION OF. RADIALLY-CONNECTED POWER SYSTEM NETWORK ... Protective relays detect intolerable or unwanted conditions within an assigned area, and then trip or open one ... time, and current transformer ratio errors. 2.2.1.
78 FR 8175 - Final Flood Hazard Determinations
2013-02-05
..., Crested Butte, CO 81224. Town of Marble Blackstock Government Center, 221 North Wisconsin Street, Gunnison... Building, 462 Pine Drive, Pine Lake, GA 30072. City of Stone Mountain City Hall, 922 Main Street, Stone...
Species and genetic diversity in the genus Drosophila inhabiting the ...
Indian Academy of Sciences (India)
BASHISTH N. SINGH∗. Genetics Laboratory, Department of Zoology, Banaras Hindu University, Varanasi 221 005, India .... resource of food which they get from urban refuse. Similarly, ... Drosophila Information Service (USA). On the basis of.
Meeting Report: Minutes from EMBO: Ten Years of Comparative Genomics of Eukaryotic Microorganisms
Czech Academy of Sciences Publication Activity Database
Lukeš, Julius; López-García, P.; Louis, E.; Boekhout, T.
2016-01-01
Roč. 167, č. 3 (2016), s. 217-221 ISSN 1434-4610 Institutional support: RVO:60077344 Keywords : protist * eukaryotic microorganisms * genomics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.794, year: 2016
Looking a gift horse in the mouth: Evaluation of wide-field asteroid photometric surveys
Czech Academy of Sciences Publication Activity Database
Harris, A. W.; Pravec, Petr; Warner, B. D.
2012-01-01
Roč. 221, č. 1 (2012), s. 226-235 ISSN 0019-1035 Institutional support: RVO:67985815 Keywords : asteroids * rotation * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.161, year: 2012
Directory of Open Access Journals (Sweden)
E. Rodríguez
2000-01-01
Full Text Available Para estimar los parámetros genéticos y heredabilidad en caracteres de calidad fisiológica de semilla de jitomate, se generó un dialélico completo con 10 líneas experimentales; con la semilla obtenida se realizaron: prueba de germinación estándar a 25 oC y 24 horas de luz en germinadora, y prueba de emergencia en almácigo bajo invernadero. Los componentes de varianza se obtuvieron considerando endogamia de 7/8 en las líneas. Los efectos genéticos fueron principalmente dominantes, excepto en germinación inicial y semillas muertas donde fueron aditivos y dominantes. Los valores de heredabilidad en sentido estrecho fueron bajos. Además se presentaron efectos maternos en germinación total y semillas muertas; y efectos recíprocos en velocidad de emergencia y en todas las variables de germinación, excepto plántulas anormales. Las mejores líneas por aptitud combinatoria general fueron CPJL-1-2-1 y CPJL-24-5-4; y por sus efectos maternos fueron CPJL-1-2-1, CPJL-3-2-1, CPJL-7-8-4 y CPJL-25-8-4. Por su aptitud combinatoria específica, en germinación los mejores híbridos fueron CPJL-7-8-4 X CPJL-22-4-4, y CPJL-1-2-1 X CPJL-2-2-1; y en emergencia CPJL-2-2-1 X CPJL-21-1-4 y CPJL-2-2-1X CPJL-22-4-4. Por los efectos recíprocos en germinación, las mejores cruzas fueron CPJL-25-8-4 X CPJL-10-1-4 y CPJL-22-4-4 X CPJL-7-8-4; y en emergencia CPJL- 24-5-4 X CPJL-10-1-4 y CPJL-10-1-4 X CPJL-2-2-1.
Recurrent respiratory papillomatosis: HPV genotypes and risk of high-grade laryngeal neoplasia.
Directory of Open Access Journals (Sweden)
Turid Omland
Full Text Available Patients with recurrent respiratory papillomatosis (RRP in Norway treated between 1987 and 2009 were recruited to this cohort study. They were followed from disease onset and data recorded until January 2012. Here, we describe the distribution of human papillomavirus (HPV genotypes, the prevalence of multiple HPV infections, and the risk of high-grade laryngeal neoplasia and respiratory tract invasive carcinoma in a large cohort of patients with RRP. We also examined whether HPV genotype, gender, age or clinical course are risk factors for this development. Clinical records and histological specimens were reviewed. Using formalin-fixed paraffin-embedded biopsies, HPV genotyping were performed by quantitative polymerase chain reaction assays identifying 15 HPV types. HPV-negative specimens were analyzed by metagenomic sequencing. Paraffin blocks were available in 224/238 patients. The DNA quality was approved in 221/224 cases. HPV DNA was detected in 207/221 patients and all were HPV 6 or HPV 11 positive, comprising HPV 6 in 133/207, HPV 11 in 40/207 cases and HPV 6/11 in 15/207 cases. Co-infection with one or two high-risk HPV types together with HPV 6 or HPV 11 was present in 19/207 patients. Metagenomic sequencing of 14 HPV-negative specimens revealed HPV 8 in one case. In total, 39/221 patients developed high-grade laryngeal neoplasia. 8/221 patients developed carcinoma of the respiratory tract (six patients with laryngeal carcinoma and two patients with lung carcinoma. High-grade laryngeal neoplasias were found more frequently in HPV-negative versus HPV-positive patients, (RR = 2.35, 95% CI 1.1, 4.99, as well as respiratory tract carcinomas (RR = 48, 95% CI 10.72, 214.91. In summary, the majority of RRP were associated with HPV 6 and/or 11. HPV-negative RRP biopsies occurred more frequently in adult-onset patients, and were associated with an increased risk of laryngeal neoplasia and carcinoma in the respiratory tract.
International Nuclear Information System (INIS)
Holmer, G.; Ronneberg, R.
1986-01-01
Two groups of rats were fed diets containing 20% by weight of either partially hydrogenated marine oil supplemented with sunflower seed oil (PHMO) or palm oil (PO) for 8 wk. Using a liver perfusion system, the effect of dietary long chain monoenoic fatty acids on the uptake and metabolism of [14- 14 C]erucic acid was studied. The perfusion times were 15 and 60 min, respectively. The two groups showed equal ability for erucic acid uptake in the liver but differed in the channeling of the fatty acids into various metabolic pathways. A higher metabolic turnover of 22:1 in the PHMO livers relative to the PO livers was demonstrated by an increased recovery of total [ 14 C]labeling in the triglyceride (TG) and phospholipid (PL) fractions, already evident after 15 min of perfusion. The chain-shortening capacity was highest in the PHMO group, reflected by a higher [ 14 C]18:1 incorporation in both TG and PL, and increasing from 15 to 60 min of perfusion. The amount of [ 14 C]18:1 found in PL and TG after 60 min of perfusion of livers from rats fed PO corresponded to that shown for the PHMO group after 15 min. The PL demonstrated a discrimination against 22:1 compared to TG, and, when available, 18:1 was highly preferred for PL-synthesis. The total fatty acid distribution in the TG, as determined by gas liquid chromatography (GLC), reflected the composition of the dietary fats. In the total liver PL, 22:1 and 20:1 were present in negligible amounts, although the PHMO diet contained 12-13% of both 22:1 and 20:1. In the free fatty acid fraction (FFA), the major part of the radioactivity (approximately 80%) was [14- 14 C]erucic acid, and only small amounts of [ 14 C]18:1 (less than 2%) were present, even after 60 min of perfusion. The shortened-chain 18:1 was readily removed from the FFA pool and preferentially used for lipid esterification
International Nuclear Information System (INIS)
Abrao, A.; Franca, J.M. Jr.; Ikuta, A.; Pueschel, C.R.; Federgruen, L.; Lordello, A.R.; Tomida, E.K.; Moraes, S.; Brito, J. de; Gomes, R.P.; Araujo, J.A.; Floh, B.; Matsuda, H.T.
1977-01-01
This paper summarizes the main activities dealing with the fabrication of nuclear grade uranium and thorium compounds at the Instituto de Energia Atomica, Sao Paulo. Identification of problems and their resolutions, the experience gained in plant operation, the performance characteristics of an ion-exchange facility and a solvent extraction unit (a demonstration plant based on pulsed columns for purification of uranium and production of ammonium diuranate) are described. A moving-bed facility for UF 4 preparation and its operation is discussed. A pilot plant for uranium and thorium oxide microsphere preparation based on internal gelation for HTGR fuel type is also described. A solvent extraction pilot plant for thorium purification based on a compound extraction-scrubbing column and a mixer-settler battery and the involved technology for thorium purification are commented. The main products, namely ammonium diuranate, uranyl amonium tricarbonate, uranium trioxide, uranium tetrafluoride, thorium nitrate and thorium oxalate and their quality are commented. The development of necessary analytical procedures for the quality control of the mentioned nuclear grade products is summarized. A great majority of such procedures was particularly suitable for analyzing traces impurities. Designed for installation are the units for denitration of uranyl nitrate solutions and pilot plants for elemental fluorine and UF 6 . The installation of a laboratory-scale plant designed for reprocessing irradiated uranium and an experimental unit for the recovery of protactinium from irradiated thorium is in progress
Energy Technology Data Exchange (ETDEWEB)
Petit, T. [CEA Centre d`Etudes Nucleaires de Grenoble, 38 (France)]|[CEA Centre d`Etudes de Grenoble, 38 (France). Dept. de Thermohydraulique et de Physique
1996-09-28
Uranium dioxide is the standard nuclear fuel used in French h power plants. During irradiation, fission products such as krypton and xenon are created inside fuel pellets. So, gas release could become, at very high burnup, a limiting factor in the reactor exploitation. To study this subject, we have realised calculations using the Density Functional Theory (DFT) into the Local Density Approximation (LDA) and the Atomic Sphere Approximation (ASA). First, we have validated our approach by calculating cohesive properties of thorium, protactinium and uranium metals. The good agreement between our results and experimental values implies that 5f electrons are itinerant. Calculated lattice parameter, cohesive energy and bulk modulus for uranium and thorium dioxides are in very good agreement with experiment. We show that binding between uranium and oxygen atoms is not completely ionic but partially covalent. The question of the electrical conductivity still remains an open problem. We have been able to calculate punctual defect formation energies in uranium dioxide. Accordingly to experimental observations, we find that it is easier to create a defect in the oxygen sublattice than in the uranium sublattice. Finally, we have been able to predict a probable site of krypton atoms in nuclear fuel: the Schottky trio. Experiences of Extended X-ray Absorption Fine structure Spectroscopy (EXAFS) and X-ray Photoelectron Spectroscopy (XPS) on uranium dioxide doped by ionic implantation will help us in the comprehension of the studied phenomena and the interpretation of our calculations. (author). 256 refs.
International Nuclear Information System (INIS)
1992-09-01
An aerial radiological survey was conducted from July 11--20, 1990, over an 83-square-kilometer (32-square-mile) area surrounding the Portsmouth Gaseous Diffusion Plant located near Portsmouth, Ohio. The survey was conducted at a nominal altitude of 91 meters (300 feet) with line spacings of 122 meters (400 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level (AGL) was prepared and overlaid on an aerial photograph and a set of United States Geological Survey (USGS) topographic maps of the area. The terrestrial exposure rates varied from about 7 to 14 microroentgens per hour (μR/h) at 1 meter above the ground. Analysis of the data for man-made sources and for the uranium decay product, protactinium-234m ( 234m Pa), showed five sites within the boundaries of the Portsmouth Gaseous Diffusion Plant with elevated readings. Spectra obtained in the vicinity of the buildings at the Portsmouth Gaseous Diffusion Plant showed the presence of 234m Pa, a uranium-238 ( 238 U) decay product. In addition, spectral analysis of the data obtained over the processing plant facility showed gamma activity indicative of uranium-235 ( 234 U). No other man-made gamma ray emitting radioactive material was detected, either on or off the Portsmouth Gaseous Diffusion Plant property. Soil samples and pressurized ion chamber measurements were obtained at five different locations within the survey boundlaries to support the aerial data
International Nuclear Information System (INIS)
Petit, T.; CEA Centre d'Etudes de Grenoble, 38
1996-01-01
Uranium dioxide is the standard nuclear fuel used in French h power plants. During irradiation, fission products such as krypton and xenon are created inside fuel pellets. So, gas release could become, at very high burnup, a limiting factor in the reactor exploitation. To study this subject, we have realised calculations using the Density Functional Theory (DFT) into the Local Density Approximation (LDA) and the Atomic Sphere Approximation (ASA). First, we have validated our approach by calculating cohesive properties of thorium, protactinium and uranium metals. The good agreement between our results and experimental values implies that 5f electrons are itinerant. Calculated lattice parameter, cohesive energy and bulk modulus for uranium and thorium dioxides are in very good agreement with experiment. We show that binding between uranium and oxygen atoms is not completely ionic but partially covalent. The question of the electrical conductivity still remains an open problem. We have been able to calculate punctual defect formation energies in uranium dioxide. Accordingly to experimental observations, we find that it is easier to create a defect in the oxygen sublattice than in the uranium sublattice. Finally, we have been able to predict a probable site of krypton atoms in nuclear fuel: the Schottky trio. Experiences of Extended X-ray Absorption Fine structure Spectroscopy (EXAFS) and X-ray Photoelectron Spectroscopy (XPS) on uranium dioxide doped by ionic implantation will help us in the comprehension of the studied phenomena and the interpretation of our calculations. (author)
Biosphere reserves – learning sites of sustainable development?
Czech Academy of Sciences Publication Activity Database
Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael
2008-01-01
Roč. 14, č. 3 (2008), s. 221-234 ISSN 1211-7420 Institutional research plan: CEZ:AV0Z60870520 Keywords : nature protection * learning sites * biosphere reserves * sustainable development Subject RIV: DO - Wilderness Conservation
National Research Council Canada - National Science Library
Gutreuter, Steve
1997-01-01
The Long Term Resource Monitoring Program (LTRMP) completed 2,221 collections of fishes from stratified random and permanently fixed sampling locations in six study reaches of the Upper Mississippi River System during I 992...
Associateship | Indian Academy of Sciences
Indian Academy of Sciences (India)
Kayastha, Dr A M . Date of birth: 1 August 1960. Specialization: Enzyme Biochemistry Address during Associateship: School of Biotechnology, Faculty of Science, Banaras Hindu University, Varanasi 221 005. YouTube; Twitter; Facebook; Blog ...
Incidence vrozených srdečních vad v České republice - aktuální data
Czech Academy of Sciences Publication Activity Database
Šípek, A.; Gregor, V.; Šípek jr., A.; Hudáková, J.; Horáček, J.; Klaschka, Jan; Skibová, J.; Langhammer, P.; Petržílková, L.; Klímová, B.; Peřinová, B.; Wiesnerová, J.
2010-01-01
Roč. 75, č. 3 (2010), s. 221-242 ISSN 1210-7832 Institutional research plan: CEZ:AV0Z10300504 Keywords : congenital heart defect * incidence * prenatal diagnostics * Czech Republic Subject RIV: FK - Gynaecology, Childbirth
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 8494 ... GrOW briefs: From research to policy ... this research and offer actionable recommendations for decision-maker. ... Economic growth and gender equality ... Although women's labour force participation has increased ...
Systematics, zoogeography, and ecology of the Priapulida
Land, van der J.
1970-01-01
CONTENTS 1 Introduction.................. 4 1.1 Plan .................. 4 1.2 Material and methods.............. 5 1.3 Acknowledgements............... 6 2 Systematics.................. 8 2.1 Historical introduction.............. 8 2.2 Phylum Priapulida............... 9 2.2.1
Czech Academy of Sciences Publication Activity Database
Žigić, Krešimir
2012-01-01
Roč. 106, č. 3 (2012), s. 221-232 ISSN 0931-8658 Institutional support: PRVOUK-P23 Keywords : Stackelberg leadership * product differentiation * endogenous entry Subject RIV: AH - Economics Impact factor: 0.512, year: 2012
Adhesion of Two Lactobacillus gasseri Probiotic Strains on Caco-2 Cells
Directory of Open Access Journals (Sweden)
Mojca Narat
2003-01-01
Full Text Available Previous in vitro and in vivo studies showed that two human isolates of Lactobacillus gasseri, LF221 and K7 are able to survive the passage through the gastrointestinal tract and to colonise intestines of pigs at least temporarily. The aim of this study was to examine the adhesion ability of LF221 and K7 strains to Caco-2 cells. Adhesion of lactobacilli from early stationary growth phase was examined at two pH values of DMEM buffer (4.5 and 7. Lactobacillus rhamnosus GG, a widely used strain with clinical evidences of its efficiency, served as a positive control. The number of lactobacilli added to each well was found to be crucial in the adhesion assay. When added, lactobacilli were in range of 2.5 · 106 to 2.5 · 108 cfu/well, the linear correlation between the number of adhered cells (log cfu and the number of added cells (log cfu was found for all three strains (R2 > 0.99 at both pH values (4.5 and 7. At the highest concentration of added K7 and GG cells tested (app. 109 cfu/well, the efficiency of adhesion was reduced. pH value of the medium strongly affected the adhesion, which was promoted in acidic conditions (pH=4.5. The adhesion of K7 strain was slightly weaker compared to GG strain at both pH values, while at pH=4.5 the adhesion of LF221 strain was even better than GG adhesion, at least at lower concentration of lactobacilli. The direct comparison of these strains was possible by regression analysis. At lower concentration of lactobacilli (2.5 · 106, the best efficiency of adhesion (% of adhered bacteria was observed for the strain LF221, reaching the values of 7.8 and 1.9 % at pH=4.5 and 7, respectively, while at higher lactobacilli concentration the ration of adhesion was higher for GG strain (3.3 % at pH=4.5. In conclusion, strains LF221 and K7 were demonstrated to be adhesive, especially in acidic conditions. The level of adhesion of K7 and GG strains positively correlates with the number of added lactobacilli only up to the
Directory of Open Access Journals (Sweden)
Chen Xiaoyong
2017-01-01
Full Text Available A total of 57 strains of lactic acid bacteria (LAB were isolated and purified from traditional fermented Yak Yogurt in Hongyuan-Sichuan and Yangbajing-Tibet. The strains with high acid-produced were screened by soluble calcium circle and titratable acidity determination. The five strains, 7-1, 22-1, 28-1, 34-1 and 62-1, possessed the high acid-producing and the value of titratable acidity is 196.2, 191.1, 192.2, 194.8 and 200.2 T respectively. Based on 16S rDNA sequence analysis, 22-1 was identified as Lactococcus lactis subsp. lactis, 28-1 as Lactobacillus casei, 34-1 as Lactobacillus fermentium, 7-1 and 62-1 as Enterococcus durans. This study could provide the evidence for researching fermentation strains to improve yogurt quality.
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 439 ... Palestinian refugees remain the largest single national group of refugees whose ... Enabling Sex Workers to Document Violence (India and Cambodia) ... Could integrated garden and nutrition programs at schools help ...
Serum Kreatinin Seviyelerinin Perkutan Nefrolitotripside Kanama Uzerine Etkisi
Directory of Open Access Journals (Sweden)
Nevzat Can sener
2015-06-01
Sonuc: Calismamizda kreatinin degerlerinin PNL sonrasi kanama icin bir risk faktoru oldugu, serum kreatinin degerlerinin yuksekligi olan hastalarda, olmayanlara oranla hematokrit dususunun daha fazla oldugu gorulmektedir. [Cukurova Med J 2015; 40(2.000: 221-225
Research Article Special Issue
African Journals Online (AJOL)
pc
Malaysia. Published online: 05 October 2017 water microbial quality is ... coli is the most common risk associated with microbial contamination in water [2]. ..... International Journal of Food Science and Technology, 2017, 52(1):214-221.
Czech Academy of Sciences Publication Activity Database
Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.
2012-01-01
Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012
Czech Academy of Sciences Publication Activity Database
Smrčka, Ludvík
2016-01-01
Roč. 77, Mar (2016), s. 108-113 ISSN 1386-9477 Institutional support: RVO:68378271 Keywords : lateral superlattices * commensurability oscillations * in-plane magnetic field Subject RIV: BE - Theoretical Physics Impact factor: 2.221, year: 2016
African Journals Online (AJOL)
Items 51 - 100 of 221 ... Vol 2 (2017), Consumers' knowledge about and attitudes towards ... in adult consumers' decision-making styles in Tshwane, South Africa, Abstract PDF ... clothing design process between apprentice designers and expert ...
Associateship | Indian Academy of Sciences
Indian Academy of Sciences (India)
Associate Profile. Period: 1985–1988. Arora, Dr D K . Date of birth: 29 June 1952. Specialization: Mycology and Microbiology Address during Associateship: Department of Botany, Institute of Science, Banaras Hindu University, Varanasi 221 005.
50 CFR 221.2 - What terms are used in this part?
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS PRESCRIPTIONS IN FERC HYDROPOWER LICENSES General... presenting its case. Ex parte communication means an oral or written communication to the ALJ that is made...
12 CFR 221.113 - Loan which is secured indirectly by stock.
2010-01-01
... of the securities which comprise the portfolio of Fund X. The agreement includes the following terms... in the ordinary sense, since the portfolio of Fund X is not pledged to secure the credit from Bank Y... analysis of the technical circumstances under which a loan is made * * * . Where security is involved...
12 CFR 221.101 - Determination and effect of purpose of loan.
2010-01-01
... lender “acting in good faith.” The requirement of “good faith” is of vital importance here. Its... would probably be subject to this part. It could not accept in good faith a statement to the contrary...
P2-21: Searching for Multiple Targets Using the iPad
Directory of Open Access Journals (Sweden)
Ian Thornton
2012-10-01
Full Text Available Search for multiple targets is constrained by both retrospective (i.e., where you've been and prospective (i.e., where you're planning to go components of performance. Previous studies using the Multi-Item Localisation (MILO task have demonstrated that participants accurately remember and discount locations they have already visited and that they plan future actions up to 2 or 3 items ahead (Thornton & Horowitz, 2004 Perception & Psychophysics 66 38–50. A prominent feature of the MILO serial-reaction time (SRT function is a highly elevated, that is slowed, response, to T1 compared to T2 and all the other items. This “prospective gap” is typically between 600 ms and 1000 ms. Here we present three experiments that use the MILO iPad app to explore this “prospective gap”. In Experiment 1, we “shuffled” the position of future targets each time a response was made. This blocks planning and thus slows all responses to the level of first target, effectively eliminating the gap. In Experiment 2, participants responded to eight identical targets, removing the need to plan a specific sequence of actions. In this situation, absolute response time is greatly reduced and the T1–T2 gap shrinks to around 350 ms. In Experiment 3, participants repeated their search through the same array 10 times. Under these circumstances, the gap systematically reduced from 1300 ms on trial 1 to 300 ms on trial 10. Together, these results suggest that the previously observed prospective gap is a combination of set-up time for registering a new visual layout, response preparation, and sequence planning.
People and things. CERN Courier, January-February 1982, v. 22(1)
International Nuclear Information System (INIS)
Anon.
1982-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The project to build a large electron- positron storage ring, LEP, at CERN already had the backing of the twelve CERN Member States, but three votes remained subject to conditions. At a CERN Council meeting in December this 'ad referendum' was lifted by the Netherlands, Norway and Sweden. The LEP project thus has the unconditional support of all Member States.New members of the IUPAP International Commission on Particles and Fields have been elected. The International Committee for Future Accelerators (ICFA) held its sixth meeting at Protvino, USSR, on the occasion of the ICFA Workshop on very high field (10 Tesla) superconducting magnets
26 CFR 1.381(c)(22)-1 - Successor life insurance company.
2010-04-01
... take into account as income its remaining policyholders surplus account to the extent the fair market.... If the transferor is an old target within the meaning of § 1.338(h)(10)-1(d)(2), any transfer by the...: Example 1. P buys the stock of insurance company target, T, from S for $16, and P and S make a section 338...
: tous les projets | Page 221 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ce projet de recherche sur les liens entre la culture du tabac et les problèmes de santé touchant les hommes, les femmes et les enfants au Bangladesh étudiera les répercussions sanitaires et socioéconomiques de la culture du tabac. Date de début : 5 mars 2012. End Date: 28 février 2015. Sujet: EPIDEMIOLOGY ...
7 CFR 2.21 - Under Secretary for Research, Education, and Economics.
2010-01-01
... with agricultural research efforts to identify compounds in vegetables and fruits that prevent these... caused by Fusarium graminearum and related fungi or Tilletia indica and related fungi (7 U.S.C. 7628... participants in the food programs administered by the Department; and (C) Research on the factors affecting...
Publications | Page 23 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 7327 ... ... and offer free training materials to guide researchers and institutions. ... Improving citizen awareness and democratic elections in Peru ... Africa has achieved impressive economic growth in the past 15 years; from ...
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 8533 ... ... Institute for Mathematical Sciences (3) Apply African Institute for ... Journal articles ... Research Awards offer recipients a one-year program at IDRC ... Heartfile has developed an innovative model of health financing ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
ac.in/article/fulltext/jgen/092/02/0273-0280 ... Department of Genetics and Plant Breeding, Institute of Agricultural Sciences, Banaras Hindu University, Varanas 221 005, India; Department of Mycology and Plant Pathology, Institute of Agricultural ...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON
Anticorrosion properties of inorganic pigments surface-modified with a polyaniline phosphate layer
Czech Academy of Sciences Publication Activity Database
Kalendová, A.; Veselý, D.; Stejskal, Jaroslav; Trchová, Miroslava
2008-01-01
Roč. 63, č. 2 (2008), s. 209-221 ISSN 0300-9440 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * coating Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.375, year: 2008
Measuring human remains in the field: Grid technique, total station, or MicroScribe?
Czech Academy of Sciences Publication Activity Database
Sládek, Vladimír; Galeta, P.; Sosna, D.
2012-01-01
Roč. 221, 1-3 (2012), s. 16-22 ISSN 0379-0738 Institutional support: RVO:68081766 Keywords : Excavation * Field anthropology * Human skeleton * Measuring error Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.307, year: 2012
Comparison of three methods to evaluate wild boar diet
Czech Academy of Sciences Publication Activity Database
Zeman, J.; Hrbek, J.; Drimaj, J.; Kudláček, T.; Kamler, J.; Plhal, R.; Heroldová, Marta
2016-01-01
Roč. 65, č. 3 (2016), s. 221-224 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : Sus scrofa * food composition * diet analysis * stomach * faeces Subject RIV: EH - Ecology, Behaviour Impact factor: 0.739, year: 2016
Remote sensing: A green illusion
Soudani, Kamel; François, Christophe
2014-02-01
An analysis reveals that satellite-observed increases in canopy greenness during dry seasons, which were previously interpreted as positive responses of Amazon forests to more sunlight, are in fact an optical artefact. See Letter p.221
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 374 ... Ecology of Access to Educational Material in Developing World Universities ... of and engagement with international research for development. ... was a pioneer in the discipline of economic development theory and its ...
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 8531 ... Unpacking the disruptive potential of blockchain technology for human development. ... Heartfile has developed an innovative model of health financing ... Rose, an astute and driven business woman runs a “table ...
Energy Technology Data Exchange (ETDEWEB)
Stetter, H.; Urban, B.; Bauer, H.
1999-12-01
For experimental investigations on shock-induced flutter in a linear transonic turbine cascade an elastic suspension system has been developed so that only aerodynamic coupling occurs in the system. The test facility uses super-heated steam as working fluid and enables Mach and Reynolds numbers to vary independently. The investigated cascade consists of seven prismatic blades. The profiles are taken from the tip section of a transonic low pressure steam turbine blade. Each blade is suspended by an elastic spring system which allows the respective blade to vibrate in a mode similar to the real blade's first bending mode. The examination mainly deals with the oscillatory behavior of the blades with respect to a variation in the isentropic outlet Mach number. In addition, the complex shock-boundary-layer interactions on the blades' suction sides are described. Flow computations are run by a finite volume Navier-Stokes solver that accounts for moving boundaries. A volume grid generator is integrated into the flow solver producing combined O- and H-type grids. Turbulence is modeled by a k-{epsilon} turbulence model using wall functions because of performance reasons. Some acceleration techniques for unsteady flow computations are investigated. Shock oscillations which occur on a DCA profile are simulated. For the simulation of the experimental setup the blade motions are prescribed. (orig.) [German] Fuer ein Spitzenschnittprofil einer ND-Endstufenschaufel sowie eine Gasturbinenschaufel wurden lineare Gitter bestehend aus jeweils sieben elastisch aufgehaengten Schaufeln entwickelt. Die Konstruktion der Aufhaengung gewaehrleistet, dass die Schaufeln lediglich durch aerodynamische Effekte zu freien Schwingungen angeregt werden koennen und in ihrem Schwingungsverhalten der ersten Biegeschwingung ihrer Originalschaufeln entsprechen. Ein gestimmtes und ungestimmtes ebenes Gitter wurde in einem Dampfversuchsstand mit Heissdampf durchstroemt, wobei das Flatterverhalten der Schaufeln von Dehnungsmessstreifen auf den Schaufeltraegern und die auftretenden Stossoszillationen mit Hilfe einer Hoch-Geschwindigkeits-Schlierenoptik, einer Laserschranke, applizierten Foliensensoren und instationaeren Drucksensoren erfasst wurde. Im transsonischen Bereich tritt beim ND-Spitzenschnittprofil ein hohes Anregungspotential durch Stossbewegungen auf. Beim Gasturbinengitter sind die Schwingungsamplituden auf Grund einer hohen Daempfung der elastischen Schaufelhalter geringer. Ein Rechenprogramm zur Simulation der transsonischen, reibungsbehafteten Stroemung durch axiale Turbomaschinen wurde auf die Behandlung bewegter Profile angepasst und fuer instationaere Stroemungssimulationen beschleunigt. Ein k-{epsilon}-Turbulenzmodell mit Wandfunktionen wurde implementiert und ein elliptisches 3D-Gittergenerierungsverfahren in den Stroemungsloeser integriert. An einem Doppelkreisbogenprofil wurden Stossoszillationen nachgerechnet. Die experimentell ermittelten Messdaten dienen als Validierungsgrundlage fuer die numerische Simulation der instationaeren Stroemung durch Schaufelreihen mit schwingenden Profilen. (orig.)
Czech Academy of Sciences Publication Activity Database
Salmina, K.; Huna, A.; Inashkina, I.; Belyayev, Alexander; Krigerts, J.; Paštová, Ladislava; Vazquez-Martin, A.; Erenpreisa, J.
2017-01-01
Roč. 8, č. 2 (2017), s. 205-221 ISSN 1949-1034 Institutional support: RVO:67985939 Keywords : aggresome * ALU retrotransposition * autophagy Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 2.387, year: 2016
Provenance and tectonic setting of the Triassic Yidun Group, the Yidun Terrane, Tibet
Directory of Open Access Journals (Sweden)
Bai-Qiu Wang
2013-11-01
Prominently high Zr/Sc ratio or Hf concentration and Paleoproterozoic Nd modal ages (1.94–2.21 Ga point to input of recycling components derived from old sedimentary source in a relatively stable tectonic setting.
African Journals Online: Nigeria
African Journals Online (AJOL)
Items 101 - 150 of 221 ... Other websites related to this journal: http://www.bioline.org.br/pc ..... publishes articles on medical and medically related topics for the .... health, physiology, nutrition, feeds and feedstuff, breeding and genetics, ...
The O-type eclipsing contact binary LY Aurigae - member of a quadruple system
Czech Academy of Sciences Publication Activity Database
Mayer, P.; Drechsel, H.; Harmanec, P.; Yang, S.; Šlechta, Miroslav
2013-01-01
Roč. 559, November (2013), A22/1-A22/8 ISSN 0004-6361 Institutional support: RVO:67985815 Keywords : early-type stars * binaries * eclipsing Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.479, year: 2013
Czech Academy of Sciences Publication Activity Database
Collinsová, Michaela; Garrow, T. A.; Castro, C.; Dive, V.; Yiotakis, A.; Jiráček, Jiří
2002-01-01
Roč. 8, - (2002), s. S221 ISSN 1075-2617. [European Peptide Symposium /27./. 31.08.2002-06.09.2002, Sorrento] Institutional research plan: CEZ:AV0Z4055905 Keywords : homocysteine S-methyltransferase Subject RIV: CE - Biochemistry
Occurrence of wagnerite in Mg–Al granulites of Sonapahar ...
Indian Academy of Sciences (India)
S B Dwivedi
2017-06-07
Jun 7, 2017 ... Department of Civil Engineering, Indian Institute of Technology (BHU), Varanasi 221 005, India. .... inclusion of spinel and coexisting with phlogopite, and (c) ..... of India, New. Delhi (ESS/15/304/2005) for financial support for.
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 8491 ... Filter by type .... Scholars from Asia and Africa exchange knowledge at CPR South Conference in Myanmar ... In much of the developing world, women unnecessarily suffer higher rates of maternal mortality and ...
Pleiotropic consequences of misexpression of the developmentally ...
Indian Academy of Sciences (India)
Author Affiliations. Moushami Mallik1 2 Subhash C Lakhotia1. Cytogenetics Laboratory, Department of Zoology, Banaras Hindu University, Varanasi 221 005, India; Molecular Neurogenetics Laboratory, Max-Planck Institute for Molecular Biomedicine, Roentgenstrasse 20, 48149 Muenster, Germany ...
Czech Academy of Sciences Publication Activity Database
Macák, J. M.; Patil, D. S.; Fraenkl, M.; Zima, Vítězslav; Shimakawa, K.; Wágner, T.
2014-01-01
Roč. 61, č. 1 (2014), s. 217-221 ISSN 1938-5862. [ECS Meeting /225./. Orlando, 11.05.2014-15.05.2014] Institutional support: RVO:61389013 Keywords : impedance * random-walk approach * conductivity Subject RIV: CA - Inorganic Chemistry
Czech Academy of Sciences Publication Activity Database
Doležal, J.; Šrůtek, Miroslav
2003-01-01
Roč. 158, - (2003), s. 201-221 ISSN 1385-0237 R&D Projects: GA AV ČR KSK6005114 Keywords : floristic calssification * gradient analysis * tree spatial pattern Subject RIV: EF - Botanics Impact factor: 1.000, year: 2003
Czech Academy of Sciences Publication Activity Database
Witter, K.; Egerbacher, M.; Matulová, Petra; Páral, V.
2004-01-01
Roč. 91, č. 8 (2004), s. 214-221 ISSN 0043-535X Institutional research plan: CEZ:AV0Z5045916 Keywords : articulatio costochondralis * collagen * horse Subject RIV: EA - Cell Biology Impact factor: 0.398, year: 2004
Czech Academy of Sciences Publication Activity Database
Žigić, Krešimir
2012-01-01
Roč. 106, č. 3 (2012), s. 221-232 ISSN 0931-8658 Institutional research plan: CEZ:AV0Z70850503 Keywords : Stackelberg leadership * product differentiation * endogenous entry Subject RIV: AH - Economics Impact factor: 0.512, year: 2012
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 650 ... They are also vulnerable to the effects of sea level rise, with its accompanying flooding. ... Educational Research Network for West and Central Africa ... culminating in the disputed general elections of December 2007.
Uranium age determination - Separation and analysis of 230Th and 231Pa
International Nuclear Information System (INIS)
Morgenstern, A.; Apostolidis, C.; Mayer, K.; Wallenius, M.
2002-01-01
uranium must be of high chemical recovery and must afford large decontamination factors. In general, the age obtained from parent/daughter ratios refers to the last separation of the parent nuclide from its daughters, i.e. the last purification of the material. The accuracy of the obtained age therefore depends on the quality of the purification process and assumes that the material subsequently has not been contaminated. Obviously the availability of two analytical methods relying on both, independent parent/daughter pairs will therefore significantly increase the confidence in the experimental results. In this work we demonstrate analytical methods for the age determination of uranium samples using the parent/daughter relations 234 U/ 230 Th and 235 U/ 231 Pa. Thorium is separated from bulk uranium using extraction chromatography and subsequently quantified using □-spectrometry, thermal ionisation mass spectrometry (TIMS) and inductively coupled mass spectrometry (ICP-MS). Protactinium is separated by highly selective sorption of protactinium to silica gel followed by □-spectrometric quantification. The methods were tested and validated using uranium reference materials of different uranium enrichment and of known ages. The experimental results obtained with both methods were found to agree with the assumed ages of the reference materials within the combined uncertainty of the measurement. The analysis exploiting the parent/daughter pair 235 U/ 231 Pa exhibits a slightly larger combined uncertainty and bias than the thorium method but is found valuable in validating the experimental results by means of a second, independent analysis. (author)
Directory of Open Access Journals (Sweden)
Giovanna Medeiros Rataichesck FIATES
2001-01-01
Full Text Available Este trabalho buscou identificar, em mulheres universitárias, aquelas que apresentavam fatores de risco para o desenvolvimento de distúrbios alimentares. Aplicou-se o questionário Eating Attitudes Test em 221 mulheres (114 estudantes de nutrição e 107 estudantes de outras áreas não relacionadas à saúde. Os resultados indicaram que 22,17% das estudantes apresentaram fatores de risco para o desenvolvimento de distúrbio alimentar, sendo que no grupo de alunas da nutrição o percentual foi maior (25,43% do que no grupo de estudantes de outros cursos (18,69%. Embora a diferença não tenha sido significativa, as futuras nutricionistas podem estar inseridas em um ambiente mais favorável ao desenvolvimento de distúrbios alimentares.This work studied a group of 221 college women, to identify those who presented risk factors compatible with the development of eating disorders. The Eating Attitudes Test was applied to 221 women (114 nutrition students and 107 students from other areas, unrelated to the health field. Results indicated that 22.17% of the group presented risk factors in the development of an eating disorder. Nutrition students presented a higher percentage (25.43% than the other students (18.69%, but this difference was not significant. However, women who study nutrition may be exposed to an environment more propitious to the development of eating disorders.
Bulletin of Animal Health and Production in Africa - Vol 59, No 2 (2011)
African Journals Online (AJOL)
Study on grosstesticular abnormalities of rams and bucks at Luna export abattoir, Modjo, Ethiopia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Hailemariam, Z Nigussie, T Tolosa, F Regasa, 216-221 ...
Czech Academy of Sciences Publication Activity Database
Reifová, R.; Majerová, V.; Reif, J.; Ahola, M.; Lindholm, A.; Procházka, Petr
2016-01-01
Roč. 16, č. 130 (2016), s. 130 ISSN 1471-2148 Institutional support: RVO:68081766 Keywords : Adaptive radiation * Speciation * Gene flow * Parallel adaptive evolution * Z chromosome * Acrocephalus warblers Subject RIV: EG - Zoology Impact factor: 3.221, year: 2016
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 768 ... The Ministry of Environment and Forests'' initiative to set up an ... Electricity Act 2003 which include the promotion of competition. ... Global water governance and the rise of the constitutional regulatory state in Colombia.
pI-Control in comparative fluorescence gel electrophoresis (CoFGE) using amphoteric azo dyes
Czech Academy of Sciences Publication Activity Database
Hanneken, M.; Šlais, Karel; König, S.
2015-01-01
Roč. 3, JUN (2015), s. 221-228 ISSN 2352-3409 Institutional support: RVO:68081715 Keywords : 2D-PAGE * CoFGE * Gel electrophoresis Subject RIV: CB - Analytical Chemistry, Separation http://www.sciencedirect.com/science/article/pii/S2352340915000414
Genetic analysis to identify good combiners for ToLCV resistance ...
Indian Academy of Sciences (India)
2014-11-10
Nov 10, 2014 ... 2Department of Botany, Udai Pratap Autonomous College, Varanasi 221 002, India. 3AIP-USAID ... there is a possibility of getting hybrid seeds in some com- binations. .... plant growth and resistance to ToLCV disease.
Directory of Open Access Journals (Sweden)
Timothy Noblet
2017-10-01
Registration: PROSPERO CRD42015017212. [Noblet T, Marriott J, Graham-Clarke E, Rushton A (2017 Barriers to and facilitators of independent non-medical prescribing in clinical practice: a mixed-methods systematic review. Journal of Physiotherapy 63: 221–234
Czech Academy of Sciences Publication Activity Database
Loureiro, J.; Pinto, G.; Lopes, T.; Doležel, Jaroslav; Santos, C.
2005-01-01
Roč. 221, - (2005), s. 815-822 ISSN 0032-0935 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * ploidy stability * nuclear DNA content Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.108, year: 2005
International Nuclear Information System (INIS)
Chou, Chi-Ta; Tang, Wei-Li; Tai, Yian; Lin, Chien-Hung; Liu, Chin-Hsin J.; Chen, Li-Chyong; Chen, Kuei-Hsien
2012-01-01
This study investigates the effect of substrate temperature (T s ) on the boron subphthalocyanine chloride (SubPc) thin film and its power conversion efficiency in SubPc/C 60 heterojunction photovoltaic cells. The orientations of SubPc molecules in thin films determined by X-ray diffraction is strongly correlated with the electronic properties of the organic thin films, and can be controlled by the substrate temperature during the vapor deposition. An optimal substrate temperature of 120 °C has been concluded to induced (221) molecular orientation over the (122) orientation and significantly improve the carrier transport of the SubPc thin film. A SubPc/C 60 heterojunction photovoltaic cells thus fabricated shows higher open-circuit voltage and up to 1.55% conversion efficiency has been achieved, which is attributed to preferential (221) orientation of the SubPc deposited at the elevated temperature.
Indian Academy of Sciences (India)
2012-12-16
Dec 16, 2012 ... and improved cognitive performance under stressful condi- tions (Liu et al. 2000; Weaver ..... (Orlando: Academic Press) pp 195–221. Heim C and ... campus in major depression: a primer on neuron death. Biol. Psychiatry 48 ...
Photo- and electrochemical bonding of DNA to single crystalline CVD diamond
Czech Academy of Sciences Publication Activity Database
Shin, D.; Rezek, Bohuslav; Tokuda, N.; Takeuchi, D.; Watanabe, H.; Nakamura, T.; Yamamoto, T.; Nebel, C.E.
2006-01-01
Roč. 203, č. 13 (2006), s. 3245-3272 ISSN 0031-8965 Institutional research plan: CEZ:AV0Z10100521 Keywords : polymers * nucleic acids * electrodes * bioelectrochemistry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.221, year: 2006
WORKABILITY OF THE NORMS OF TRANSPARENCY AND ...
African Journals Online (AJOL)
2012-06-21
Jun 21, 2012 ... Nigeria in Focus' (June 2012) 3:11 International Journal of Business and Social Science 221 at 222, 223 ..... Build Integrity to Curb Corruption' (Ethics in Multilateral and ... charged with the duty of handling fraud-related cases.
A critical look of the report of Colombia at the Committee on the Rights of People with Disabilities
Directory of Open Access Journals (Sweden)
Gina Cabeza Monroy
2017-12-01
Full Text Available Cabeza, G. et al. (2017: “Una mirada crítica del informe de Colombia al Comité sobre los Derechos de las Personas con Discapacidad”. Revista Española de Discapacidad, 5 (2:221-226.
Western Indian Ocean Journal of Marine Science - Vol 5, No 2 (2006)
African Journals Online (AJOL)
Dinophyceae) in Central Coastal Areas of Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Lugomela, 213-221. http://dx.doi.org/10.4314/wiojms.v5i2.28512 ...
Kim, Woochul; Park, Jiyoon; Kim, Hyeonghun; Pak, Yusin; Lee, Heon; Jung, Gun Young
2017-01-01
Organic-inorganic hybrid perovskite solar cells (PSCs) have reached a power conversion efficiency of 22.1% in a short period (∼7 years), which has been obtainable in silicon-based solar cells for decades. The high power conversion efficiency
Ohlasy filozofie Georga Wilhelma Friedricha Hegela v hudebněteoretickém díle Moritze Hauptmanna
Czech Academy of Sciences Publication Activity Database
Myslivcová, Eva
2015-01-01
Roč. 52, č. 2 (2015), s. 221-229 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Georg Wilhelm Friedrich Hegel * Moritz Hauptmann * Die Natur der Harmonik und der Metrik * music theory Subject RIV: AL - Art, Architecture, Cultural Heritage