Physics of the missing atoms: technetium and promethium
International Nuclear Information System (INIS)
Aspden, H.
1987-01-01
Technetium (Z = 43) and promethium (Z = 61) are by far the least abundant of all atoms below the radioactive elements (Z = 84 onwards). Their scarcity confirms theoretical predictions emerging from a theory of the photon derived from synchronous lattice electrodynamics. This theory has given precise theoretical values for the fine-structure constant and the constant of gravitation G and is now shown in this paper to indicate resonant interactions between the vacuum lattice oscillations and technetium and promethium. In the case of promethium there is strong reason for believing that this atom can assume supergravitational or antigravitational properties, accounting for its scarcity. This paper not only adds support to the earlier theoretical work on the photon and gravitation, but suggests a research route that might lead to new technology based on controlled interactions with gravity fields
10 CFR 30.19 - Self-luminous products containing tritium, krypton-85, or promethium-147.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85, or..., krypton-85, or promethium-147. (a) Except for persons who manufacture, process, produce, or initially transfer for sale or distribution self-luminous products containing tritium, krypton-85, or promethium-147...
International Nuclear Information System (INIS)
Seshadri, N.K.; Subramanian, T.K.; Ravi, S.; Mathew, K.M.; Chinnayan, C.
2001-01-01
Beta radiation emanating from promethium-147 and gaseous tritium in close proximity with zinc sulphide phosphor will provide self sustained light sources and are used for, nocturnal illumination of liquid crystal display digital watches and clocks, product advertisements, telephone numbers, exit signs etc. In this paper a procedure for activation of zinc sulphide phosphor with promethium-147 and development of gaseous tritium light sources with respect to thickness of phosphor coating and its effect on light output is described. A typical light source was constructed with promethium-147 activated zinc sulphide to find the overall efficiency of conversion of beta energy to visible light. (author)
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85 or... containing tritium, krypton-85 or promethium-147: Requirements for license to manufacture, process, produce... self-luminous products containing tritium, krypton-85, or promethium-147, or to initially transfer such...
Strontium-90 and promethium-147 recovery
International Nuclear Information System (INIS)
Hoisington, J.E.; McDonell, W.R.
1982-01-01
Strontium-90 and promethium-147 are fission product radionuclides with potential for use as heat source materials in high reliability, non-interruptible power supplies. Interest has recently been expressed in their utilization for Department of Defense (DOD) applications. This memorandum summarizes the current inventories, the annual production rates, and the possible recovery of Sr-90 and Pm-147 from nuclear materials production operations at Hanford and Savannah River. Recovery of these isotopes from LWR spend fuel utilizing the Barnwell Nuclear Fuels Plant (BNFP) is also considered. Unit recovery costs at each site are provided
A novel ion selective sensor for promethium determination
International Nuclear Information System (INIS)
Gupta, Vinod K.; Jain, Rajeev; Hamdan, A.J.; Agarwal, Shilpi; Bharti, Arvind K.
2010-01-01
This is a first promethium 145 ion-selective sensor based on the comparative study of two Schiff base ligands (X 1 and X 2 ) as neutral ionophores. Effect of various plasticizers: 2-nitrophenyloctylether (o-NPOE), dibutyl phosphonate (DBP), dioctylphthalate (DOP), tri-(2-ethylhexyl) phosphate (TEHP), dibutyl butylphosphonate (DBBP), chloronaphthalene (CN) and anion excluders: potassium tetrakis (p-chloropheny1) borate (KTpClPB), sodiumtetraphenylborate (NaTPB) and oleic acid (OA) have been studied. The membrane with a composition of ionophore (X 1 /X 2 ):KTpClPB:PVC:o-NPOE (w/w, %) in the ratio of 5:5:30:60 exhibited best performance. The best responsive membrane sensors (8 and 21) exhibited working concentration range of 4.5 x 10 -7 -1.0 x 10 -2 M and 3.5 x 10 -6 -1.0 x 10 -2 M with a detection limits of 3.2 x 10 -7 M and 2.3 x 10 -6 M and Nernstian slopes of 20.0 ± 0.5, 19.5 ± 0.5 mV decade -1 of activity, respectively. The sensor no. 8 works satisfactorily in partially non-aqueous media up to 10% (v/v) content of methanol, ethanol and acetonitrile. Analytical application of the proposed sensor has been demonstrated in determination of promethium (III) ions in spiked water samples.
International Nuclear Information System (INIS)
Atomachi, Tadaaki; Imai, Hiroshi.
1969-01-01
A method of adhering and fixing a luminous powder such as tritium-3 or promethium-147 onto a small semi-conductor element for use in nuclear batteries is disclosed in which a radio isotope such as tritium-3 or promethium-147 is coated onto the surface of a fluorescent material such as ZnS-Cu, CaS, (Ca, Sr)S, (Cd, Zn)S which is then suspended in a silver plating bath. A composite of silver and the luminous powder is electro-deposited onto the semi-conductor element. The deposited layer will not easily separate from the semi-conductor and long life is assured owing to the thickness of the layer. Small dimensions are obtainable without sacrificing capacity. (Owens, K.J.)
International Nuclear Information System (INIS)
Kassai, Z.; Kassai, A.; Bauerova, K.; Koprda, V.; Harangozo, M.; Bendova, P.; Bujnova, A.
2003-01-01
The composition and the permeation properties of the skin are dependent on age. In the animal models for permation studies, age affects the mechanical as well as the permeation properties significantly. The time dependence of permeation of 147 Pm 3+ from aqueous solution was established by the animal skin model and the age dependence of promethium permeation through the skin was examined. The aim was to find the optimum rat skin age model for radionuclide permeation studies and to assess the relative importance of the main permeation pathways: transepidermal and transfollicular permeation. The skin from 5-day-old rats (5DR) was found to represent the optimum animal model to study transepidermal permeation of ions. The skin from 9-day-old rats (9DR) was selected to study transfollicular permeation of ions. Comparison of the permeated amounts of promethium through the skin without hairs (3 DR to 6 DR) and with hairs (7DR to 12DR) showed that the additional permation mode via follicles significantly contributed to the permeation rate and extent. (author)
Directory of Open Access Journals (Sweden)
Jonathan Fitzsimmons
2015-12-01
Full Text Available Background: Radioimmunotherapy utilize a targeting antibody coupled to a therapeutic isotope to target and treat a tumor or disease. In this study we examine the synthesis and cell binding of a polymer scaffold containing a radiotherapeutic isotope and a targeting antibody. Methods: The multistep synthesis of a fluorescent or 149Promethium-labeled Trastuzumab-polyethyleneimine (PEI, Trastuzumab, or PEI is described. In vitro uptake, internalization and/or the binding affinity to the Her2/neu expressing human breast adenocarcinoma SKBr3 cells was investigated with the labeled compounds. Results: Fluorescent-labeled Trastuzumab-PEI was internalized more into cells at 2 and 18 h than fluorescent-labeled Trastuzumab or PEI. The fluorescent-labeled Trastuzumab was concentrated on the cell surface at 2 and 18 h and the labeled PEI had minimal uptake. DOTA-PEI was prepared and contained an average of 16 chelates per PEI; the compound was radio-labeled with 149Promethium and conjugated to Trastuzumab. The purified 149Pm-DOTA-PEI-Trastuzumab had a radiochemical purity of 96.7% and a specific activity of 0.118 TBq/g. The compound demonstrated a dissociation constant for the Her2/neu receptor of 20.30 ± 6.91 nM. Conclusion: The results indicate the DOTA-PEI-Trastuzumab compound has potential as a targeted therapeutic carrier, and future in vivo studies should be performed.
International Nuclear Information System (INIS)
Kassai, Z.; Koprda, V.; Harangozo, M.; Bendova, P.; Bauerova, K.
2001-01-01
In this paper: - the time dependence of permeation of 147 Pm 3+ from aqueous solution through animal skin model was studied; - the age dependence of promethium through the skin was proved; - the optimum biological model of human skin was selected, and - the relative importance of the main diffusion pathways for 147 Pm 3+ the diffusion across the intact skin and the diffusion through the hair channels was assessed. Concluding it can be said, that: -it was proved, that the 5-day-old rats (5DR) represents the optimum animal model to the human skin; - in the case of 8DR to 11DR the dominant route of 147 Pm 3+ penetration is along the follicles; - the permeation resistance of the skin depends on the thickness and mechanical properties of the skin. Comparing amounts of penetrated ions of promethium through the skin without hairs (3DR to 6DR) and through the skin with hairs, it was showed that the additional diffusion along hair's follicles pronounced with animal skin can be important also in case of human skin where hair density is many times lower than in used animal models. (authors)
An experimental study of odd mass promethium isotopes using proton stripping and pickup reactions
International Nuclear Information System (INIS)
Straume, O.
1979-11-01
Odd Pm isotopes have been studied by one proton pick-up and stripping reactions. Spin assignment and spectroscopic factors have been obtained for a number of energy levels. In the stripping reactions, the relative cross-sections have been measured with an unusually high precision by the use of a target of natural neodymium. The spectroscopic strengths have been extracted using standard distorted wave methods. The nuclear structures of these promethium isotopes fall into three categories. The spherical approach seems valid for 143 Pm and 145 Pm and the deformed regime covers 151 Pm and 153 Pm, while 147 Pm and 149 Pm remain as transitional nuclei. (Auth.)
Development of a diagnostic model for inhaled promethium-147 oxide. Animal studies
International Nuclear Information System (INIS)
Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.
1976-01-01
Rats and beagles were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare-earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in faecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (author)
Development of a diagnostic model for inhaled promethium-147 oxide: animal studies
International Nuclear Information System (INIS)
Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.
1975-01-01
Rats and beagle dogs were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in fecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (auth)
International Nuclear Information System (INIS)
Kramer, G.H.; Davies, J.M.
1981-04-01
A method has been developed for separating low-level activities of the beta-emitting isotopes strontium-90, yttrium-90, promethium-147 and cerium-144 from urine and aqueous solutions. They are subsequently estimated by planchet or liquid scintillation counting. The radionuclides are separated from each other and from interfering elements by solvent extraction with HDEHP (di-2-ethylhexyl phosphoric acid) in n-heptane. It is possible to separate the elements with a minimum of cross-contamination by selecting appropriate pH's and solvent concentrations. Percentage recoveries for the radionuclides are: 90 Sr, 100 +- 12; 90 Y, 65 +- 4; 147 Pm, 90 +- 8; 144 Ce, 87 +- 11. The limits of detection are: 90 Sr, 0.6 pCi; 90 Y, 0.7 pCi; 147 Pm, 1.0 pCi; 144 Ce, 0.8 pCi. (author)
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Security. 176.162 Section 176.162 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... Class 1 (Explosive) Materials Precautions During Loading and Unloading § 176.162 Security. A responsible...
25 CFR 162.606 - Advertisement.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement. 162.606 Section 162.606 Indians BUREAU OF... § 162.606 Advertisement. Except as otherwise provided in this part, prior to granting a lease or permit.... Advertisements will call for sealed bids and will not offer preference rights. ...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Reports. 500.162 Section 500.162 Labor Regulations Relating... AGRICULTURAL WORKER PROTECTION Enforcement Agreements with Federal and State Agencies § 500.162 Reports. The Secretary shall require such reports as he deems necessary of activities conducted pursuant to State plans...
7 CFR 956.162 - Container markings.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Container markings. 956.162 Section 956.162... WALLA VALLEY OF SOUTHEAST WASHINGTON AND NORTHEAST OREGON Rules and Regulations § 956.162 Container markings. Effective April 15, 1997, no handler shall ship any container of Walla Walla Sweet Onions except...
29 CFR 1915.162 - Ship's boilers.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Ship's boilers. 1915.162 Section 1915.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.162 Ship's boilers. (a) Before...
Nuclear spectroscopic studies in 162Yb
International Nuclear Information System (INIS)
Behrens, H.
1980-01-01
The decay of the highly excited 162 Yb nuclei formed in the reaction 150 Sm( 16 O,4n) 162 Yb to the ground state was studied using different gamma detectors and an electron spectrometer, a so called mini-orange. The isotope 162 Yb was moreover produced and spectroscoped by the beta-decay of 162 Lu. For the identification of decay cascades, which were passed after the fusion, and for the determination of the multipolarity of the contributing energy transitions a series of experiments took place: The excitation functions and the angular distributions of the emitted gamma radiation was measured, the conversion coefficients of important transitions were determined, and coincidence events between two detectors occasionally were registrated and analyzed. In the beta decay measurement an assignment of gamma transitions to 162 Yb followed due to the lifetime, under which they occured. The found states of 162 Yb upto spins of 22 h/2π and excitation energies above 5 MeV belong to five rotational bands. The yrast band shows a weak backbending. Corresponding to their spins and parities the bands can be reduced to intrinsic excitation of two quasineutrons. The analysis of the beta-decay of 162 Lu, which takes place from three states in 162 Lu, leads to the lowest levels of the gamma-vibrational band and the band head of the beta band. The microscopic interpretation of the rotational bands and the description of the backbending behaviour are as the interpretation of the states involved at the beta decay in agreement with experimental and theoretical results for neighbouring ytterbium isotopes. (orig.) [de
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 162.151 Section 162.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS STATE REGISTRATION... registered product. Pest problem means: (1) A pest infestation and its consequences, or (2) Any condition for...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Procedure. 28.162 Section 28.162 Agriculture..., TESTING, AND STANDARDS Regulations Under the United States Cotton Standards Act Adjustment of Contract... and in instituting and conducting arbitrations and appeals shall be as prescribed in the articles...
19 CFR 162.63 - Arrests and seizures.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Arrests and seizures. 162.63 Section 162.63 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Controlled Substances, Narcotics, and Marihuana § 162...
45 CFR 162.915 - Trading partner agreements.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Trading partner agreements. 162.915 Section 162... REQUIREMENTS ADMINISTRATIVE REQUIREMENTS General Provisions for Transactions § 162.915 Trading partner agreements. A covered entity must not enter into a trading partner agreement that would do any of the...
45 CFR 162.1011 - Valid code sets.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Valid code sets. 162.1011 Section 162.1011 Public... ADMINISTRATIVE REQUIREMENTS Code Sets § 162.1011 Valid code sets. Each code set is valid within the dates specified by the organization responsible for maintaining that code set. ...
26 CFR 1.162-1 - Business expenses.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Business expenses. 1.162-1 Section 1.162-1...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.162-1 Business expenses. (a) In general. Business expenses deductible from gross income include the ordinary and necessary...
19 CFR 162.22 - Seizure of conveyances.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure of conveyances. 162.22 Section 162.22... TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Seizures § 162.22 Seizure of conveyances. (a) General applicability. If it shall appear to any officer authorized to board conveyances and make seizures that there...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 16.2 Section 16.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL IMPLEMENTATION OF PRIVACY ACT OF 1974 § 16... records have the same meanings as specified in 5 U.S.C. 552a. (b) EPA means the Environmental Protection...
26 CFR 1.162-6 - Professional expenses.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Professional expenses. 1.162-6 Section 1.162-6...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.162-6 Professional expenses. A professional man may claim as deductions the cost of supplies used by him in the practice of...
46 CFR 162.050-37 - Vibration test.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Vibration test. 162.050-37 Section 162.050-37 Shipping...: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Pollution Prevention Equipment § 162.050-37 Vibration test. (a... paragraph (b) of this section. The test must be performed at an independent laboratory that has the...
19 CFR 162.92 - Notice of seizure.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Notice of seizure. 162.92 Section 162.92 Customs... (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Civil Asset Forfeiture Reform Act § 162.92 Notice of seizure. (a) Generally. Customs will send written notice of seizure as provided in this section to all known interested...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 16.2 Section 16.2 Money and Finance: Treasury Office of the Secretary of the Treasury REGULATIONS IMPLEMENTING THE PROGRAM... a position for which the rate of basic pay is not less than the minimum rate of basic pay for grade...
25 CFR 162.605 - Negotiation of leases.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Negotiation of leases. 162.605 Section 162.605 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER LEASES AND PERMITS Non-Agricultural Leases § 162.605 Negotiation of leases. (a) Leases of individually owned land or tribal land may be negotiated by those owners or their...
46 CFR 162.039-2 - Classification.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 162.039-2 Section 162.039-2 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. (a) Every semiportable fire extinguisher shall be classified as to type and size as specified in...
19 CFR 162.11 - Authority to procure warrants.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority to procure warrants. 162.11 Section 162.11 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Search Warrants § 162.11 Authority to procure...
45 CFR 162.1002 - Medical data code sets.
2010-10-01
... Terminology, Fourth Edition (CPT-4), as maintained and distributed by the American Medical Association, for... 45 Public Welfare 1 2010-10-01 2010-10-01 false Medical data code sets. 162.1002 Section 162.1002... REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Code Sets § 162.1002 Medical data code sets. The Secretary adopts the...
46 CFR 162.028-2 - Classification.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 162.028-2 Section 162.028-2 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. (a) Every portable fire extinguisher shall be classified as to type and size as specified in § 76...
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 72.162 Section 72.162 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL... Test control. The licensee, applicant for a license, certificate holder, and applicant for a CoC shall...
16 CFR 1.62 - Ancillary court orders pending review.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Ancillary court orders pending review. 1.62 Section 1.62 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES Injunctive and Condemnation Proceedings § 1.62 Ancillary court orders pending review...
28 CFR 16.2 - Public reading rooms.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Public reading rooms. 16.2 Section 16.2 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION... Relations Service—in Suite 2000, 600 E Street, NW., Washington, DC; (4) Drug Enforcement Administration—in...
32 CFR Appendix to Part 162 - Reporting Procedures
2010-07-01
... ENHANCING CAPITAL INVESTMENT (PECI) Pt. 162, App. A Appendix to Part 162—Reporting Procedures A. General The.... Total Projected Life-Cycle Cost Avoidance. 4. PIA Post-Investment assessments, articles, pictures, and...
45 CFR 162.1901 - Medicaid pharmacy subrogation transaction.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Medicaid pharmacy subrogation transaction. 162... STANDARDS AND RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Medicaid Pharmacy Subrogation § 162.1901 Medicaid pharmacy subrogation transaction. The Medicaid pharmacy subrogation transaction is the...
42 CFR 423.162 - Quality improvement organization activities.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Quality improvement organization activities. 423.162 Section 423.162 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control...
International Nuclear Information System (INIS)
Angelini, P.; Adair, H.L.
1976-07-01
The promethium metal used in the determination of the melting point and phase transformation temperatures was prepared by reduction of promethium oxide with thorium metal at 1600 0 C and distilling the promethium metal into a quartz dome. The melting point and phase transformation temperatures of promethium metal were found to be 1042 +- 5 0 C and 890 +- 5 0 C, respectively. The ratio for the heat of the high-temperature transformation to the heat of fusion was determined to be 0.415
7 CFR 457.162 - Nursery crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery crop insurance provisions. 457.162 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.162 Nursery crop insurance provisions. The Nursery Crop Insurance Provisions for the 2006 and succeeding crop years are as follows: FCIC...
β-decay spectroscopy of neutron-rich 160,161,162Sm isotopes
Directory of Open Access Journals (Sweden)
Patel Z.
2016-01-01
Full Text Available Neutron-rich 160,161,162Sm isotopes have been populated at the RIBF, RIKEN via β first time. β-coincident γ rays were observed in all three isotopes including γ rays from the isomeric decay of 160Sm and 162Sm. The isomers in 160Sm and 162Sm have previously been observed but have been populated via β decay for the first time. The isomeric state in 162Sm is assigned a 4−v72+[ 633 ]⊗v12−[ 521 ]${4^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes v{{1 \\over 2}^ - }\\left[ {521} \\right]$ configuration based on the decay pattern. The level schemes of 160Sm and 162Sm are presented. The ground states in the parent nuclei 160Pm and 162Pm are both assigned a 6−v72+[633]⊗π52−[532]${6^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes \\pi {{5 \\over 2}^ - }\\left[ {532} \\right]$ configuration based on the population of states in the daughter nuclei. Blocked BCS calculations were performed to further investigate the spin-parities of the ground states in 160Pm, 161Pm, and 162Pm, and the isomeric state in 162Sm
32 CFR 162.5 - Responsibilities.
2010-07-01
... ENHANCING CAPITAL INVESTMENT (PECI) § 162.5 Responsibilities. (a) The Assistant Secretary of Defense (Force... project applicability when reasonable, applies off-the-shelf technology, and integrates capital investment...
26 CFR 1.162-5 - Expenses for education.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses for education. 1.162-5 Section 1.162-5... education. (a) General rule. Expenditures made by an individual for education (including research undertaken... the education may lead to a degree) if the education— (1) Maintains or improves skills required by the...
46 CFR 162.028-4 - Marine type label.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Marine type label. 162.028-4 Section 162.028-4 Shipping... type label. (a) In addition to all other marking, every portable extinguisher shall bear a label containing the “marine type” listing manifest issued by a recognized laboratory. This label will include the...
26 CFR 1.162-12 - Expenses of farmers.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses of farmers. 1.162-12 Section 1.162-12... farmers. (a) Farms engaged in for profit. A farmer who operates a farm for profit is entitled to deduct... 263A and the regulations thereunder. For taxable years beginning after July 12, 1972, where a farmer is...
Identification, expression and phylogenetic analysis of EgG1Y162 from Echinococcus granulosus
Zhang, Fengbo; Ma, Xiumin; Zhu, Yuejie; Wang, Hongying; Liu, Xianfei; Zhu, Min; Ma, Haimei; Wen, Hao; Fan, Haining; Ding, Jianbing
2014-01-01
Objective: This study was to clone, identify and analyze the characteristics of egG1Y162 gene from Echinococcus granulosus. Methods: Genomic DNA and total RNAs were extracted from four different developmental stages of protoscolex, germinal layer, adult and egg of Echinococcus granulosus, respectively. Fluorescent quantitative PCR was used for analyzing the expression of egG1Y162 gene. Prokaryotic expression plasmid of pET41a-EgG1Y162 was constructed to express recombinant His-EgG1Y162 antigen. Western blot analysis was performed to detect antigenicity of EgG1Y162 antigen. Gene sequence, amino acid alignment and phylogenetic tree of EgG1Y162 were analyzed by BLAST, online Spidey and MEGA4 software, respectively. Results: EgG1Y162 gene was expressed in four developmental stages of Echinococcus granulosus. And, egG1Y162 gene expression was the highest in the adult stage, with the relative value of 19.526, significantly higher than other three stages. Additionally, Western blot analysis revealed that EgG1Y162 recombinant protein had good reaction with serum samples from Echinococcus granulosus infected human and dog. Moreover, EgG1Y162 antigen was phylogenetically closest to EmY162 antigen, with the similarity over 90%. Conclusion: Our study identified EgG1Y162 antigen in Echinococcus granulosus for the first time. EgG1Y162 antigen had a high similarity with EmY162 antigen, with the genetic differences mainly existing in the intron region. And, EgG1Y162 recombinant protein showed good antigenicity. PMID:25337206
Identification, expression and phylogenetic analysis of EgG1Y162 from Echinococcus granulosus.
Zhang, Fengbo; Ma, Xiumin; Zhu, Yuejie; Wang, Hongying; Liu, Xianfei; Zhu, Min; Ma, Haimei; Wen, Hao; Fan, Haining; Ding, Jianbing
2014-01-01
This study was to clone, identify and analyze the characteristics of egG1Y162 gene from Echinococcus granulosus. Genomic DNA and total RNAs were extracted from four different developmental stages of protoscolex, germinal layer, adult and egg of Echinococcus granulosus, respectively. Fluorescent quantitative PCR was used for analyzing the expression of egG1Y162 gene. Prokaryotic expression plasmid of pET41a-EgG1Y162 was constructed to express recombinant His-EgG1Y162 antigen. Western blot analysis was performed to detect antigenicity of EgG1Y162 antigen. Gene sequence, amino acid alignment and phylogenetic tree of EgG1Y162 were analyzed by BLAST, online Spidey and MEGA4 software, respectively. EgG1Y162 gene was expressed in four developmental stages of Echinococcus granulosus. And, egG1Y162 gene expression was the highest in the adult stage, with the relative value of 19.526, significantly higher than other three stages. Additionally, Western blot analysis revealed that EgG1Y162 recombinant protein had good reaction with serum samples from Echinococcus granulosus infected human and dog. Moreover, EgG1Y162 antigen was phylogenetically closest to EmY162 antigen, with the similarity over 90%. Our study identified EgG1Y162 antigen in Echinococcus granulosus for the first time. EgG1Y162 antigen had a high similarity with EmY162 antigen, with the genetic differences mainly existing in the intron region. And, EgG1Y162 recombinant protein showed good antigenicity.
27 CFR 70.162 - Levy and distraint on salary and wages.
2010-04-01
... salary and wages. 70.162 Section 70.162 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... § 70.162 Levy and distraint on salary and wages. (a) Notice of intent to levy. Levy may be made for any... salary or wages. A levy on salary or wages is continuous from the time of the levy until the liability...
46 CFR 162.017-3 - Materials, construction, and workmanship.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Materials, construction, and workmanship. 162.017-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Valves, Pressure-Vacuum Relief, for Tank Vessels § 162.017-3 Materials, construction, and workmanship. (a) The valves shall be of...
26 CFR 1.162-7 - Compensation for personal services.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Compensation for personal services. 1.162-7 Section 1.162-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME... a flat rate. Generally speaking, if contingent compensation is paid pursuant to a free bargain...
19 CFR 162.21 - Responsibility and authority for seizures.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Responsibility and authority for seizures. 162.21 Section 162.21 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... authority for seizures. (a) Seizures by Customs officers. Property may be seized, if available, by any...
40 CFR 82.162 - Certification by owners of recovery and recycling equipment.
2010-07-01
... and recycling equipment. 82.162 Section 82.162 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PROTECTION OF STRATOSPHERIC OZONE Recycling and Emissions Reduction § 82.162 Certification by owners of recovery and recycling equipment. (a) No later than August 12...
2010-07-01
... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING PRODUCTIVITY ENHANCING CAPITAL INVESTMENT (PECI) § 162.3 Definition. (a) Capital Investment. The acquisition, installation, transportation... timeliness. (l) Productivity Enhancing Capital Investment (PECI). Equipment or facility funding that shall...
19 CFR 162.3 - Boarding and search of vessels.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Boarding and search of vessels. 162.3 Section 162.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Boarding and search of vessels. (a) General authority. A Customs officer, for the purpose of examining the...
First observation of yrast band in odd-odd 162Lu
International Nuclear Information System (INIS)
Zhang, Y.H.; Yuan, G.J.; Liu, X.A.
1996-01-01
High spin states of the odd-odd 162 Lu nucleus have been studied via 147 Sm( 19 F, 4nγ) 162 Lu reaction at 95MeV beam energy. Level scheme for yrast band based on π[h 11/2 ] υ[i 13/2 ] quasiparticle configuration was established up to I π =(23 - ) for the first time. This band shows the signature inversion in energy before backbending generally appeared in this mass region. It is stressed that the signature splitting in 162 Lu is larger than that in the 160 Tm nucleus. (orig.)
Process for producing a self luminescent material
Energy Technology Data Exchange (ETDEWEB)
Abe, E
1962-01-28
A self luminescent material is produced by a process comprising applying a hydroxide or fluoride of promethium-147 suspended in a medium of paraffinic acid to the surface of a fluorescent body. Promethium-147 decays with a half-life of 2.6 years and emits beta-rays but not alpha- and gamma-rays so that it is suitable for manufacturing self luminescent materials. A chloride of promethium-147 cannot be employed because its structure is destroyed by acids. Although fluorides and hydroxides of promethium-147 are difficult to mix with the fluorescent body material, they become mixable when paraffinic acids containing from 12 to 20 carbon atoms, (for example, steric acid, palmitic acid and margaric acid) are used as a medium. In embodiments, the self luminescent materials are prepared by either neutralization of a promethium-147 chloride solution having a specific radioactivity of 1.2 c/cc. with an ammonium hydroxide solution to form gelatinous hydroxide, or the reaction of a promethium-147 chloride solution with H/sub 2/SiF/sub 6/ by heating at 80/sup 0/C to form a fluoride of promethium-147. The products have a specific radioactivity of 8 to 12 mc/g. These products are suspended in vehicles of polystyrene and methacrylic resin to produce the self luminescent coating materials. Tests show that the initical brightness is comparatively high, the decreasing rate of brightness is small, no blackening effects by alpha-rays occur and costs are low. The brightness of the coating containing promethium-147 is 82-85 after 5 days, 100-105 after 100 days and 82-92 after 180 days. With respect to the coating containing radium the values are 31-70 after 5 days, 28-49 after 100 days and 19-31 after 180 days.
2010-01-01
... MICHIGAN, NEW YORK, PENNSYLVANIA, OREGON, UTAH, WASHINGTON, AND WISCONSIN Administrative Rules and Regulations § 930.162 Exemptions. (a) General. Tart cherries which are used for the purpose of new product... and/or new markets for tart cherry products. Any exemption for experimental work shall be limited in...
2010-07-01
... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING PRODUCTIVITY ENHANCING CAPITAL INVESTMENT (PECI) § 162.6 Procedures. The following procedures shall be followed by the DoD Components in the... documentation, pre-investment analysis, financing, and post-investment accountability of PECI projects, when DoD...
28 CFR 0.162 - Offers which may be rejected by Assistant Attorneys General.
2010-07-01
... Attorneys General. 0.162 Section 0.162 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE..., Penalties, and Forfeitures § 0.162 Offers which may be rejected by Assistant Attorneys General. Each Assistant Attorney General is authorized, with respect to matters assigned to his division or office, to...
29 CFR 1952.162 - Completion of developmental steps and certification.
2010-07-01
... occupational safety and health issues specified in the plan on or before July 20, 1976. (n) Amendment to....162 Section 1952.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH...) In accordance with the requirements of § 1952.163(b), the Iowa Occupational Safety and Health Act of...
33 CFR 162.165 - Buffalo and Rochester Harbors, New York.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Buffalo and Rochester Harbors, New York. 162.165 Section 162.165 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... and Rochester Harbors, New York. In Buffalo and Rochester Harbors, no vessel may exceed 6 miles per...
19 CFR 162.65 - Penalties for failure to manifest narcotic drugs or marihuana.
2010-04-01
... or marihuana. 162.65 Section 162.65 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Substances, Narcotics, and Marihuana § 162.65 Penalties for failure to manifest narcotic drugs or marihuana. (a) Cargo or baggage containing unmanifested narcotic drugs or marihuana. When a package of regular...
19 CFR 162.93 - Failure to issue notice of seizure.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Failure to issue notice of seizure. 162.93 Section... OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Civil Asset Forfeiture Reform Act § 162.93 Failure to issue notice of seizure. If Customs does not send notice of a seizure of property in...
33 CFR 162.125 - Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc. 162.125 Section 162.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.125 Sturgeon Bay and the Sturgeon Bay Ship...
46 CFR 162.039-3 - Requirements.
2010-10-01
...: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Extinguishers, Fire, Semiportable, Marine Type § 162.039-3... parts, except those used for inversion mechanism or similar purposes, shall be corrosion-resistant to... shall be protected by a suitable corrosion-resistant coating. (1) Corrosion-resistant materials. The...
33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...
33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...
33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...
29 CFR 4.162 - Fringe benefits under contracts exceeding $2,500.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Fringe benefits under contracts exceeding $2,500. 4.162... Compensation Standards § 4.162 Fringe benefits under contracts exceeding $2,500. (a) Pursuant to the statutory... contain a provision specifying the fringe benefits to be furnished the various classes of service...
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...
33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...
2010-10-01
... furnished to beneficiaries in teaching hospitals. 415.162 Section 415.162 Public Health CENTERS FOR MEDICARE... BY PHYSICIANS IN PROVIDERS, SUPERVISING PHYSICIANS IN TEACHING SETTINGS, AND RESIDENTS IN CERTAIN SETTINGS Physician Services in Teaching Settings § 415.162 Determining payment for physician services...
33 CFR 162.20 - Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. 162.20 Section 162.20 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.20 Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. (a...
33 CFR 165.162 - Safety Zone: New York Super Boat Race, Hudson River, New York.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: New York Super Boat Race, Hudson River, New York. 165.162 Section 165.162 Navigation and Navigable Waters COAST GUARD... § 165.162 Safety Zone: New York Super Boat Race, Hudson River, New York. (a) Regulated area. The...
40 CFR 80.162 - Additive compositional data.
2010-07-01
... detergent production quality control. EPA will respond to such requests in writing; the additional... variability is required, and provide evidence that the production detergent will perform adequately throughout... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.162 Additive compositional data...
25 CFR 1000.162 - What is included in a self-governance compact?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What is included in a self-governance compact? 1000.162...-DETERMINATION AND EDUCATION ACT Negotiation Process for Annual Funding Agreements Negotiating A Self-Governance Compact § 1000.162 What is included in a self-governance compact? A model format for self-governance...
Lifetimes of high-spin states in {sup 162}Yb
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Janssens, R.V.F.; Henry, R.G. [and others
1995-08-01
A measurement on lifetimes of high-spin states in the yrast and near-yrast rotational bands in {sup 162}Yb was carried out at ATLAS in order to determine the evolution of collectivity as a function of angular momentum using the {sup 126}Te({sup 40}Ar,4n){sup 162}Yb reaction at 170 MeV. Previous lifetime measurements in the {sup 164,166,168}Yb isotopes showed a dramatic decrease in the transition quadrupole moment Q{sub t} with increasing spin. It was suggested that this decrease in Q{sub t} is brought about by the rotationally-induced deoccupation of high-j configurations, mainly i{sub 13/2} neutrons. If this interpretation is correct, the heavier isotopes should have a larger decrease in Q{sub t} than the lighter mass nuclides due to the position of the Fermi surface in the i{sub 13/2} subshell. Indeed, {sup 160}Yb does not show a clear decrease in Q{sub t} at high spin. No high spin lifetime information exists for {sup 162}Yb, thus this experiment fills the gap of measured Q{sub t}`s in the light Yb series. The data is currently being analyzed.
33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Channel leading to San Juan Harbor, P.R.; use, administration, and navigation. 162.260 Section 162.260 Navigation and Navigable... WATERWAYS NAVIGATION REGULATIONS § 162.260 Channel leading to San Juan Harbor, P.R.; use, administration...
75 FR 27855 - Certifications Pursuant to Section 609 of Public Law 101-162
2010-05-18
... DEPARTMENT OF STATE [Public Notice 7013] Certifications Pursuant to Section 609 of Public Law 101... Law 101-162 (``Section 609''), that 13 nations have adopted programs to reduce the incidental capture... 609 of Public Law 101-162 prohibits imports of certain categories of shrimp unless the President...
A study of the structure of 162Dy through the (n,γ) and (n,e-) reactions
International Nuclear Information System (INIS)
Warner, D.D.; Shi, Z.R.; Gelletly, W.; Borner, H.G.; Hoyler, F.; Schreckenbach, K.; van Isacker, P.
1987-01-01
The level structure below 2 MeV in 162 Dy has been investigated using the 161 Dy(n,γ) 162 Dy and 161 Dy(n,e - ) 162 Dy reactions. The results for the positive parity excitations are discussed within the framework of an Interacting Boson Approximation (IBA-2) calculation. 7 refs., 1 fig., 1 tab
21 CFR 131.162 - Acidified sour cream.
2010-04-01
... HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.162.... (c) Methods of analysis. Referenced methods in paragraphs (c) (1) and (2) of this section are from “Official Methods of Analysis of the Association of Official Analytical Chemists,” 13th Ed. (1980), which is...
40 CFR 35.162 - Basis for allotment.
2010-07-01
... STATE AND LOCAL ASSISTANCE Environmental Program Grants Water Pollution Control (section 106) § 35.162... are presented in Table 1 of this section, with their associated elements, sub-elements, and supporting... made on the basis of the cumulative change in the Consumer Price Index (CPI), published by the U.S...
Inhaled /sup 147/Pm and/or total-body gamma radiation: Early mortality and morbidity in rats
Energy Technology Data Exchange (ETDEWEB)
Filipy, R.E.; Lauhala, K.E.; McGee, D.R.; Cannon, W.C.; Buschbom, R.L.; Decker, J.R.; Kuffel, E.G.; Park, J.F.; Ragan, H.A.; Yaniv, S.S.; Scott, B.R.
1989-05-01
Rats were given doses of /sup 60/Co gamma radiation and/or lung burdens of /sup 147/Pm (in fused aluminosilicate particles) within lethal ranges in an experiment to determine and compare morbidity and mortality responses for the radiation insults within 1 year after exposure. Radiation-induced morbidity was assessed by measuring changes in body weights, hematologic parameters, and pulmonary-function parameters. Acute mortality and morbidity from inhaled promethium were caused primarily by radiation pneumonitis and pulmonary fibrosis that occurred more than 53 days after exposure. Acute mortality and morbidity from total-body gamma irradiation occurred within 30 days of exposure and resulted from the bone-marrow radiation syndrome. Gamma radiation caused transient morbidity, reflected by immediately depressed blood cell levels and by reduced body weight gain in animals that survived the acute gamma radiation syndrome. Inhaled promethium caused a loss of body weight and diminished pulmonary function, but its only effect on blood cell levels was lymphocytopenia. Combined gamma irradiation and promethium lung burdens were synergistic, in that animals receiving both radiation insults had higher morbidity and mortality rates than would be predicted based on the effect of either kind of radiation alone. Promethium lung burdens enhanced the effect of gamma radiation in rats within the first 30 days of exposure, and gamma radiation enhanced the later effect of promethium lung burdens. 70 refs., 68 figs., 21 tabs.
Study of 162Er via the (p , t) and (p ,p') reactions
Kisliuk, D.; Garrett, P. E.; Finlay, A.; Bianco, L.; Bildstein, V.; Burbadge, C.; Chagnon-Lessard, S.; Diaz Varela, A.; Dunlop, M. R.; Dunlop, R.; Finlay, P.; Jamieson, D.; Jigmeddorj, B.; Maclean, A. D.; Michetti-Wilson, J.; Leach, K. G.; Radich, A. J.; Rand, E.; Svensson, C. E.; Wong, J.; Ball, G. C.; Triambak, S.; Faestermann, T.; Hertenberger, R.; Wirth, H.-F.
2015-10-01
The nature of excited states in well-deformed nuclei pose a challenge in nuclear structure. In light of this, the study of 162Er via the 164Er (p , t) and 162Er (p ,p') reactions has been initiated to shed light on the structure of these excited states. The experiments were performed at the Maier-Leibnitz Laboratory using a 22 MeV proton beam on highly-enriched targets of 162,164Er and the reaction was analyzed with the Q3D spectrograph. Strong population in the (p , t) reaction of the 02+ state, far greater than other 0+ states, has been observed. Transition matrix elements for population of low-lying states in the (p ,p') reaction have also been extracted. Initial results from these experiments will be presented.
7 CFR 905.162 - Repacking certificate of privilege.
2010-01-01
... 905.162 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE ORANGES..., address and Florida citrus fruit dealer license number of the applicant; approximate number of boxes to be...
33 CFR 162.175 - Black Rock Canal and Lock at Buffalo, New York.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Black Rock Canal and Lock at Buffalo, New York. 162.175 Section 162.175 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Black Rock Canal and Lock at Buffalo, New York. In the Black Rock Canal and Lock, no vessel may exceed 6...
27 CFR 9.162 - Sta. Rita Hills.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Sta. Rita Hills. 9.162.... Rita Hills. (a) Name. The name of the viticultural area described in this section is “Sta. Rita Hills”. For purposes of part 4 of this chapter, “Sta. Rita Hills” is a term of viticultural significance. (b...
Preparation of 147Pm ceramic source core
International Nuclear Information System (INIS)
Mielcarski, M.
1989-01-01
Preparation of ceramic pellets containing fixed promethium-147 is described. Incorporation rate of 147 Pm into the ceramic material was determined. The leachability and vaporization of promethium from the obtained ceramics was investigated. The ceramic pellets prepared by the described procedure, mounted in special holders, can be applied as point sources in beta backscatter thickness gauges. (author)
25 CFR 162.212 - When will the BIA advertise Indian land for agricultural leases?
2010-04-01
... laws and leasing policies that have been made applicable to the land under §§ 162.109 and 162.203 of..., unless a preference in favor of individual Indians is required by a superseding tribal law or leasing policy. (c) Advertisements will require sealed bids, and they may also provide for further competitive...
25 CFR 162.229 - How long can the term of an agricultural lease run?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false How long can the term of an agricultural lease run? 162... AND PERMITS Agricultural Leases Lease Requirements § 162.229 How long can the term of an agricultural lease run? (a) An agricultural lease must provide for a definite lease term, specifying the commencement...
26 CFR 1.162-10 - Certain employee benefits.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Certain employee benefits. 1.162-10 Section 1... employee benefits. (a) In general. Amounts paid or accrued by a taxpayer on account of injuries received by...) for the benefit of employees, their families, and dependents, at least medical or hospital care, and...
2010-07-01
... technology (BCT). [Reserved] 429.162 Section 429.162 Protection of Environment ENVIRONMENTAL PROTECTION... Wood Furniture and Fixture Production Without Water Wash Spray Booth(s) or Without Laundry Facilities... application of the best conventional pollutant control technology (BCT). [Reserved] ...
Activity in mice of recombinant BCG-EgG1Y162 vaccine for Echinococcus granulosus infection.
Ma, Xiumin; Zhao, Hui; Zhang, Fengbo; Zhu, Yuejie; Peng, Shanshan; Ma, Haimei; Cao, Chunbao; Xin, Yan; Yimiti, Delixiati; Wen, Hao; Ding, Jianbing
2016-01-01
Cystic hydatid disease is a zoonotic parasitic disease caused by Echinococcus granulosus which is distributed worldwide. The disease is difficult to treat with surgery removal is the only cure treatment. In the high endemic areas, vaccination of humans is believed a way to protect communities from the disease. In this study we vaccinated BALB/c mice with rBCG-EgG1Y162, and then detected the level of IgG and IgE specifically against the recombinant protein by ELISA, rBCG-EgG1Y162 induced strong and specific cellular and humoral immune responses. In vitro study showed that rBCG-EgG1Y162 vaccine not only promote splenocytes proliferation but also active T cell. In addition, the rBCG-EgG1Y162 induced a protection in the mice against secondary infection of Echinococcus granulosus.
International Nuclear Information System (INIS)
Pozsgai, Eva; Gomori, Eva; Szigeti, Andras; Boronkai, Arpad; Gallyas, Ferenc Jr; Sumegi, Balazs; Bellyei, Szabolcs
2007-01-01
Small heat shock proteins are molecular chaperones that protect proteins against stress-induced aggregation. They have also been found to have anti-apoptotic activity and to play a part in the development of tumors. Recently, we identified a new small heat shock protein, Hsp16.2 which displayed increased expression in neuroectodermal tumors. Our aim was to investigate the expression of Hsp16.2 in different types of brain tumors and to correlate its expression with the histological grade of the tumor. Immunohistochemistry with a polyclonal antibody to Hsp16.2 was carried out on formalin-fixed, paraffin-wax-embedded sections using the streptavidin-biotin method. 91 samples were examined and their histological grade was defined. According to the intensity of Hsp16.2 immunoreactivity, low (+), moderate (++), high (+++) or none (-) scores were given. Immunoblotting was carried out on 30 samples of brain tumors using SDS-polyacrylamide gel electrophoresis and Western-blotting. Low grade (grades 1–2) brain tumors displayed low cytoplasmic Hsp16.2 immunoreactivity, grade 3 tumors showed moderate cytoplasmic staining, while high grade (grade 4) tumors exhibited intensive cytoplasmic Hsp16.2 staining. Immunoblotting supported the above mentioned results. Normal brain tissue acted as a negative control for the experiment, since the cytoplasm did not stain for Hsp16.2. There was a positive correlation between the level of Hsp16.2 expression and the level of anaplasia in different malignant tissue samples. Hsp16.2 expression was directly correlated with the histological grade of brain tumors, therefore Hsp16.2 may have relevance as becoming a possible tumor marker
Directory of Open Access Journals (Sweden)
Gallyas Ferenc
2007-12-01
Full Text Available Abstract Background Small heat shock proteins are molecular chaperones that protect proteins against stress-induced aggregation. They have also been found to have anti-apoptotic activity and to play a part in the development of tumors. Recently, we identified a new small heat shock protein, Hsp16.2 which displayed increased expression in neuroectodermal tumors. Our aim was to investigate the expression of Hsp16.2 in different types of brain tumors and to correlate its expression with the histological grade of the tumor. Methods Immunohistochemistry with a polyclonal antibody to Hsp16.2 was carried out on formalin-fixed, paraffin-wax-embedded sections using the streptavidin-biotin method. 91 samples were examined and their histological grade was defined. According to the intensity of Hsp16.2 immunoreactivity, low (+, moderate (++, high (+++ or none (- scores were given. Immunoblotting was carried out on 30 samples of brain tumors using SDS-polyacrylamide gel electrophoresis and Western-blotting. Results Low grade (grades 1–2 brain tumors displayed low cytoplasmic Hsp16.2 immunoreactivity, grade 3 tumors showed moderate cytoplasmic staining, while high grade (grade 4 tumors exhibited intensive cytoplasmic Hsp16.2 staining. Immunoblotting supported the above mentioned results. Normal brain tissue acted as a negative control for the experiment, since the cytoplasm did not stain for Hsp16.2. There was a positive correlation between the level of Hsp16.2 expression and the level of anaplasia in different malignant tissue samples. Conclusion Hsp16.2 expression was directly correlated with the histological grade of brain tumors, therefore Hsp16.2 may have relevance as becoming a possible tumor marker.
45 CFR 162.925 - Additional requirements for health plans.
2010-10-01
... clearinghouse to receive, process, or transmit a standard transaction may not charge fees or costs in excess of... RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS General Provisions for Transactions § 162.925 Additional... transaction as a standard transaction, the health plan must do so. (2) A health plan may not delay or reject a...
45 CFR 162.1902 - Standard for Medicaid pharmacy subrogation transaction.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Standard for Medicaid pharmacy subrogation... DATA STANDARDS AND RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Medicaid Pharmacy Subrogation § 162.1902 Standard for Medicaid pharmacy subrogation transaction. The Secretary adopts the Batch Standard...
Microscopic analysis of wobbling excitations in 156Dy and 162Yb
International Nuclear Information System (INIS)
Nazmitdinov, R. G.; Kvasil, J.
2007-01-01
In the cranked Nilsson-plus-random-phase approximation, we study low-lying quadrupole excitations of positive parity and negative signature in 156 Dy and 162 Yb at high spins. Special attention is paid to a consistent description of wobbling excitations and their identification among excited states. A good agreement between the available experimental data and the results of calculations is obtained. We find that the lowest odd-spin γ-vibrational states in 156 Dy transform into wobbling excitations after the backbending associated with the transition from an axially symmetric shape to a nonaxial shape. Similar results are predicted for 162 Yb. The analysis of electromagnetic transitions uniquely determines the sign of the γ deformation in both nuclei after the transition point
26 CFR 1.162-18 - Illegal bribes and kickbacks.
2010-04-01
... bribe (whether or not illegal) made on or after December 10, 1971, by any provider of services, supplier... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Illegal bribes and kickbacks. 1.162-18 Section 1... bribes and kickbacks. (a) Illegal payments to government officials or employees—(1) In general. No...
2010-04-01
... identify holistic management objectives; and (5) Identify actions to be taken to reach established... tribe's agricultural resource management plan? 162.201 Section 162.201 Indians BUREAU OF INDIAN AFFAIRS... Must agricultural land be managed in accordance with a tribe's agricultural resource management plan...
Measurements of np scattering at 96 and 162 MeV
International Nuclear Information System (INIS)
Olsson, N.; Rahm, J.; Blomgren, J.; Conde, H.; Dangtip, S.; Elmgren, K.; Roennqvist, T.; Zorro, R.; Ringbom, A.; Tibell, G.
1998-01-01
This paper presents new, precise measurements of differential cross sections for np scattering at 96 and 162 MeV. The data are steeper at backward angles than most previous data, and point to the classical value for the charged πNN coupling constant. (orig.)
Ocular Toxicity Profile of ST-162 and ST-168 as Novel Bifunctional MEK/PI3K Inhibitors.
Smith, Andrew; Pawar, Mercy; Van Dort, Marcian E; Galbán, Stefanie; Welton, Amanda R; Thurber, Greg M; Ross, Brian D; Besirli, Cagri G
2018-04-30
ST-162 and ST-168 are small-molecule bifunctional inhibitors of MEK and PI3K signaling pathways that are being developed as novel antitumor agents. Previous small-molecule and biologic MEK inhibitors demonstrated ocular toxicity events that were dose limiting in clinical studies. We evaluated in vitro and in vivo ocular toxicity profiles of ST-162 and ST-168. Photoreceptor cell line 661W and adult retinal pigment epithelium cell line ARPE-19 were treated with increasing concentrations of bifunctional inhibitors. Western blots, cell viability, and caspase activity assays were performed to evaluate MEK and PI3K inhibition and dose-dependent in vitro toxicity, and compared with monotherapy. In vivo toxicity profile was assessed by intravitreal injection of ST-162 and ST-168 in Dutch-Belted rabbits, followed by ocular examination and histological analysis of enucleated eyes. Retinal cell lines treated with ST-162 or ST-168 exhibited dose-dependent inhibition of MEK and PI3K signaling. Compared with inhibition by monotherapies and their combinations, bifunctional inhibitors demonstrated reduced cell death and caspase activity. In vivo, both bifunctional inhibitors exhibited a more favorable toxicity profile when compared with MEK inhibitor PD0325901. Novel MEK and PI3K bifunctional inhibitors ST-162 and ST-168 demonstrate favorable in vitro and in vivo ocular toxicity profiles, supporting their further development as potential therapeutic agents targeting multiple aggressive tumors.
47 CFR 1.62 - Operation pending action on renewal application.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Operation pending action on renewal application... General Rules of Practice and Procedure General Application Procedures § 1.62 Operation pending action on renewal application. (a)(1) Where there is pending before the Commission at the time of expiration of...
Directory of Open Access Journals (Sweden)
Kai Wu
Full Text Available Bacillus amyloliquefaciens is a plant-beneficial Gram-positive bacterium involved in suppressing soil-borne pathogens through the secretion of secondary metabolites and high rhizosphere competence. Biofilm formation is regarded as a prerequisite for high rhizosphere competence. In this work, we show that plant extracts affect the chemotaxis and biofilm formation of B. amyloliquefaciens SQY 162 (SQY 162. All carbohydrates tested induced the chemotaxis and biofilm formation of the SQY 162 strain; however, the bacterial growth rate was not influenced by the addition of carbohydrates. A strong chemotactic response and biofilm formation of SQY 162 were both induced by pectin through stimulation of surfactin synthesis and transcriptional expression of biofilm formation related matrix genes. These results suggested that pectin might serve as an environmental factor in the stimulation of the biofilm formation of SQY 162. Furthermore, in pot experiments the surfactin production and the population of SQY 162 in the rhizosphere significantly increased with the addition of sucrose or pectin, whereas the abundance of the bacterial pathogen Ralstonia decreased. With increased production of secondary metabolites in the rhizosphere of tobacco by SQY 162 and improved colonization density of SQY 162 in the pectin treatment, the disease incidences of bacterial wilt were efficiently suppressed. The present study revealed that certain plant extracts might serve as energy sources or environmental cues for SQY 162 to enhance the population density on tobacco root and bio-control efficacy of tobacco bacterial wilt.
2010-04-01
... or wine for experimental purposes and in manufacture of nonbeverage products. 1.62 Section 1.62... experimental purposes and in manufacture of nonbeverage products. The use of distilled spirits or wine for experimental purposes and in the manufacture of (a) medicinal, pharmaceutical, or antiseptic products...
Moments of inertia in 162Yb at very high spins
International Nuclear Information System (INIS)
Simon, R.S.; Banaschik, M.V.; Colombani, P.; Soroka, D.P.; Stephens, F.S.; Diamond, R.M.
1976-01-01
Two methods have been used to obtain values of the effective moment of inertia of very-high-spin (20h-bar--50h-bar) states populated in heavy-ion compound-nucleus reactions. The 162 Yb nucleus studied has effective moments of inertia smaller than, but approaching, the rigid-body estimate
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Yazoo Diversion Canal, Vicksburg, Miss., from its mouth at Kleinston Landing to Fisher Street; navigation. 162.85 Section 162.85... mouth at Kleinston Landing to Fisher Street; navigation. (a) Speed. Excessive speeding is prohibited. A...
Identification of 162Gd and a new type of identical bands
International Nuclear Information System (INIS)
Jones, E. F.; Gore, P. M.; Hamilton, J. H.; Ramayya, A. V.; Dodder, R. S.; Beyer, C. J.; Hwang, J. K.; Zhang, X. Q.; Kormicki, J.; Zhu, S. J.; Lima, A. P. de; Cole, J. D.; Aryaeinejad, R.; Ma, W. C.; Ter-Akopian, G. M.; Daniel, A. V.; Oganessian, Yu. Ts.; Rasmussen, J. O.; Asztalos, S. J.; Lee, I. Y.
1998-01-01
From γ-γ-γ coincidence measurements in spontaneous fission of 252 Cf, level energies were established to spins 14 + to 20 + in many neutron-rich nuclei. New isotope 162 Gd was identified. Yrast bands of 152,154,156 Nd, 156,158,160 Sm, and 160,162 Gd exhibit near-identical transition energies and moments of inertia (MOI) shifted by the same constant amounts for every spin state from 2 + to 12 + or 14 + for nuclei differing by 2n, 4n, 2p, 4p, α, α+2p, and α+2n. These shifted identical bands (SIB) are a new phenomenon. Analysis of all known even-even proton- to neutron-rich nuclei from Ba(Z=56) to Os(Z=76) reveal no SIB for proton-rich nuclei and few cases of SIB for the most neutron-rich pairs around N=98-102 separated by 2n and 2p
40 CFR 81.162 - Northeast Plateau Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Plateau Intrastate Air... Air Quality Control Regions § 81.162 Northeast Plateau Intrastate Air Quality Control Region. The Northeast Plateau Intrastate Air Quality Control Region (California) consists of the territorial area...
46 CFR 162.050-20 - Separator and bilge alarm test fluids.
2010-10-01
... residual fuel oil in accordance with ISO 8217 (incorporated by reference, see § 162.050-4), type RMG 380... water; (ii) 25.0 g of Test Fluid A; (iii) 25.0 g of Test Fluid B; (iv) 0.5 g of surfactant (sodium salt...
Internal motions in H II regions. XII S162 and NGC 7635
Energy Technology Data Exchange (ETDEWEB)
Pismis, P; Moreno, M A; Hasse, I [Universidad Nacional Autonoma de Mexico, Mexico City
1983-01-01
The apparent structure of S162 and of the bubble nebula (NGC 7635) associated with it is discussed using a number of direct images taken through narrow band (10 A/sup 0/) interference filters in H..cap alpha.., (N II) and in the continuum at lambda6607. The results are discussed together with the radial velocity field of S162 and in particular of the bubble nebula as obtained from photographic Fabry-Perot interferometry. The bubble nebula is shown to be composed of distinct and amorphous very regularly curving arcs, all inscribed on a tenuous slightly ellipsoidal shell of gas expanding at velocity of about 4 km s/sup -1/. The arcs are probably genetically related to the globules which form the caracteristic comet like feature within the bubble nebula. The ionization source of S162 is BD + 60/sup 0/2522 and 071Isub(b)f star classified from our high dispersion spectrum. Our very tentative suggestion is that the brightest globule may be an offshoot fo this star and that the globule has generated the next globule which in turn may have generated the third one. The configuration of NGC 7635 suggests that magnetic fields are likely to be operative in the region. Polarimetry in the optical and in the radio range as well as high resolution infrared studies, high resolution velocity fields are desirable to find a satisfactory model for this nebula.
Takabatake, Reona; Masubuchi, Tomoko; Futo, Satoshi; Minegishi, Yasutaka; Noguchi, Akio; Kondo, Kazunari; Teshima, Reiko; Kurashima, Takeyo; Mano, Junichi; Kitta, Kazumi
2014-01-01
A novel real-time PCR-based analytical method was developed for the event-specific quantification of a genetically modified (GM) maize event, MIR162. We first prepared a standard plasmid for MIR162 quantification. The conversion factor (Cf) required to calculate the genetically modified organism (GMO) amount was empirically determined for two real-time PCR instruments, the Applied Biosystems 7900HT (ABI7900) and the Applied Biosystems 7500 (ABI7500) for which the determined Cf values were 0.697 and 0.635, respectively. To validate the developed method, a blind test was carried out in an interlaboratory study. The trueness and precision were evaluated as the bias and reproducibility of relative standard deviation (RSDr). The determined biases were less than 25% and the RSDr values were less than 20% at all evaluated concentrations. These results suggested that the limit of quantitation of the method was 0.5%, and that the developed method would thus be suitable for practical analyses for the detection and quantification of MIR162.
RAF V Sweatman (162/2014) [2015] ZASCA 22 (20 march 2015) A ...
African Journals Online (AJOL)
RAF V Sweatman (162/2014) [2015] ZASCA 22 (20 march 2015) A simple illustration of the SCA's statutory ... Log in or Register to get access to full text downloads. ... The effect is that one of the primary purposes of the Amendment Act is ...
Raman spectra of Pm2O3, PmF3, PmCl3, PmBr3 and PmI3
International Nuclear Information System (INIS)
Wilmarth, W.R.; Peterson, J.R.
1988-01-01
Raman spectral data are presented for the sesquioxide and the trihalides (F, Cl, Br and I) of promethium. The Raman spectra of these lanthanide compounds are reported for the first time and are compared with those of the homologous lanthanide compounds. Tentative symmetry assignments have been made for the observed Raman-active bands based on factor group analysis of their respective crystal structures and comparisons with the assigned Raman spectra of other lanthanide compounds. The characteristic band patterns of the Raman phonon spectra have been found to be very useful in determining the crystal structure of the respective promethium compounds. (author)
International Nuclear Information System (INIS)
Kopyrin, A.A.; Murashov, V.D.; Shvedov, V.P.
1980-01-01
The effect of DTPA, cerium and europium nitrates concentration in the range from 10 -1 -10 -6 M on extraction and separation of americium (3), cerium (3), prometium and europium 0.2 M with the solution of tri-n-octylamine nitrate in n-xylol of concentrated lithium nitrate solutions, is investigated. The method of Box-Wilson is used to determine the optimum conditions of separation of the above elements. The maximum values of separation factors are obtained for the following pairs: cerium(3)-americium(3) - 100, americium (3)-europium - 12, promethium-americium(3) - 35, cerium(3)-promethium - 30, cerium(3)-europium - 890 [ru
Yrast bands and signature inversion in double odd 162,164Lu
International Nuclear Information System (INIS)
Cardona, M.A.; Hojman, D.; Kreiner, A.J.; Somacal, H.; Davidson, J.; Davidson, M.; Acuna, D. de; Napoli, D.R.; Rico, J.; Burch, R.; Bazzacco, D.; Lenzi, S.M.; Rossi Alvarez, C.; Blasi, N.; Lo Bianco, G.
1996-01-01
High spin rotational bands in 162 Lu and 164 Lu have been studied by means of the 139 La( 28 Si,5n) and 139 La( 29(30) Si,4(5)n) reactions respectively. For both nuclei the yrast sequence which is associated with the πh 11/2 x νi 13/2 configuration shows the signature inversion feature. (orig.)
Brain abscess: surgical experiences of 162 cases
Directory of Open Access Journals (Sweden)
Forhad Hossain Chowdhury
2015-01-01
Full Text Available Aim: Brain abscess still poses a public health challenge in spite of the advent of modern neurosurgical techniques and antibiotics. Here, we present our surgical experiences and ultimate outcome in the management of brain abscess. Methods: Totally, 162 patients with proved brain abscess who underwent surgical treatment were included in this study. The prospectively recorded data of surgical management of brain abscess and the ultimate outcome (by Glasgow outcome scale were studied retrospectively. Results: Total number of cases was 162, of which 113 were acute pyogenic abscess while 49 were chronic abscess. Among the chronic abscess, 29 were chronic pyogenic abscess, 14 were tubercular, 3 aspergillus, and 3 abscesses were in malignant brain metastases. In acute cases, common clinical features were headache, fever, vomiting, focal deficit and seizure. In chronic abscesses, common clinical features were mild to moderate headache and progressive focal deficit. Seventy-three (45.06% patients had adjacent localized sinus, middle ear or cranial infection. The common predisposing factors included postneurosurgery, postpenetrating injury to brain, chronic suppurative otitis media, and congenital heart disease, infective endocarditis, sinusitis and sub optimum immuno-status. Frontal lobe involved in 30.2% cases, temporal lobe is next to involved. Single time burr hole aspiration in 111 (68.5% cases, two or more times burr hole aspiration were done in 34 (21% cases. Pus culture was negative in 129 (79.62% cases. Total number of death was 22 (13.58% cases. Complete resolution of abscess with complete recovery of preoperative neuro-deficit was seen in 80.86% cases and recovery with major neuro-deficit was observed in 5.55% cases. There is a significant association between Glasgow coma scale (GCS on admission and mortality in brain abscess. Conclusion: In most of the cases, pus culture did not yield growth of any causative organism. Mortality was not
25 CFR 162.101 - What key terms do I need to know?
2010-04-01
... Agricultural Resources Management Act of December 3, 1993 (107 Stat. 2011, 25 U.S.C. 3701 et seq.), as amended... tribe acting on behalf of BIA under § 162.109 of this part. Bond means security for the performance of... uncertain in duration, including a life estate. Lease means a written agreement between Indian landowners...
26 CFR 1.162-22 - Treble damage payments under the antitrust laws.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Treble damage payments under the antitrust laws... Corporations § 1.162-22 Treble damage payments under the antitrust laws. (a) In general. In the case of a... Federal antitrust laws or enters a plea of guilty or nolo contendere to an indictment or information...
2010-10-01
... ENGINEERING EQUIPMENT Pollution Prevention Equipment § 162.050-4 Incorporation by reference: Where can I get a....org): (1) International Standard ISO 8217 Third edition 2005-11-01, Petroleum products—Fuels (class F)—Specifications of marine fuels (“ISO 8217”), incorporation by reference approved for § 162.050-20. (2...
26 CFR 1.162-25 - Deductions with respect to noncash fringe benefits.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deductions with respect to noncash fringe... Corporations § 1.162-25 Deductions with respect to noncash fringe benefits. (a) [Reserved] (b) Employee. If an employer provides the use of a vehicle (as defined in § 1.61-21(e)(2)) to an employee as a noncash fringe...
The unpaired spectroscopy of sup 161,162 Er at spins up to 50 Dirac h
Energy Technology Data Exchange (ETDEWEB)
Riley, M.A.; Roberts, J.W.; Alderson, A.; Ali, I.; Cullen, D.M.; Fallon, P.; Forsyth, P.D.; Sharpey-Schafer, J.F. (Liverpool Univ. (UK). Oliver Lodge Lab.); Simpson, J.; Bentley, M.A.; Bruce, A.M. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Chapman, R.; Lisle, J.C.; Mo, J.N. (Manchester Univ. (UK). Schuster Lab.)
1990-12-24
High spin states in {sup 161}Er and {sup 162}Er have been populated using the {sup 130}Te+{sup 36}S reaction at a bombarding energy of 170 MeV. In {sup 161}Er, three rotational bands were extended from I {approx equal} 35{Dirac h} to I {approx equal} 50{Dirac h}. In {sup 162}Er the positive parity yrast band was observed to I=44{Dirac h}. These rotational sequences are compared to a simple unpaired model which was successful in predicting the behaviour of similar high spin data on {sup 159,160}Er. These studies of the light Er isotopes constitute the highest spins observed in normal deformed nuclei and yield direct and specific information on the single-neutron spectrum of states. (orig.).
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What disparity standard must a State meet in order to be certified and how are disparities in current expenditures or revenues per pupil measured? 222.162... of the Act § 222.162 What disparity standard must a State meet in order to be certified and how are...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type C respirators, continuous-flow class and Type CE supplied-air respirators; test requirements. 84.162 Section 84.162 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL...
International Nuclear Information System (INIS)
Kawase, Y.; Okano, K.; Aoki, K.
1987-01-01
By using a high-temperature thermal ion source coupled to a He-jet system, neutron-rich isotopes of rare-earth elements such as cerium, praseodymium, neodymium and promethium produced by the thermal-neutron fission of /sup 235/U were ionized and successfully separated. The temperature dependence of the ionization efficiency has been measured and found to be explained qualitatively by the vapour pressure of the relevant elements. The characteristic temperature dependence of the ionization efficiency has been utilized for Z-identification of several isobars of rare-earth elements. The heaviest isotopes of neodymium and promethium, /sup 155/Nd and /sup 156/Pm, have recently been identified
26 CFR 1.162-14 - Expenditures for advertising or promotion of good will.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenditures for advertising or promotion of... and Corporations § 1.162-14 Expenditures for advertising or promotion of good will. A corporation... expenditures for advertising or the promotion of good will which it seeks to deduct in the taxable year may not...
2010-07-01
... the river as appropriate such temporary speed regulations as he may deem necessary to protect the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Columbia and Willamette Rivers... NAVIGATION REGULATIONS § 162.225 Columbia and Willamette Rivers, Washington and Oregon; administration and...
26 CFR 1.162-17 - Reporting and substantiation of certain business expenses of employees.
2010-04-01
... Individuals and Corporations § 1.162-17 Reporting and substantiation of certain business expenses of employees.... The term “ordinary and necessary business expenses” means only those expenses which are ordinary and..., reimbursements, or otherwise, exceeds the ordinary and necessary business expenses paid or incurred by the...
19 CFR 162.96 - Remission of forfeitures and payment of fees, costs or interest.
2010-04-01
... Asset Forfeiture Reform Act § 162.96 Remission of forfeitures and payment of fees, costs or interest... for purposes of collection of any fees, costs or interest from the Government. ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Remission of forfeitures and payment of fees...
Gurung, Pallavi; Banskota, Suhrid; Katila, Nikita; Gautam, Jaya; Kadayat, Tara Man; Choi, Dong-Young; Lee, Eung Seok; Jeong, Tae Cheon; Kim, Jung-Ae
2018-05-15
The pathogenesis of inflammatory bowel disease (IBD) is associated with production of immense pro-inflammatory cytokines including TNF-α. Once generated, TNF-α stimulates production of various pro-inflammatory cytokines and disrupts mucosal barrier by inducing inflamed mucosal epithelial cell death. In the present study, we investigated inhibitory effects of TI-1-162, a hydroxyindenone derivative, against TNF-α-induced and TNBS-induced colon inflammation. TI-1-162 showed inhibitory effect on the TNF-α-induced adhesion of U937 monocytic cells to HT-29 colonic epithelial cells (IC 50 = 0.83 ± 0.12 μM), which is an in vitro model representing the initial step of colitis. In addition, TI-1-162 suppressed TNF-α-stimulated caspase-3 activation and HT-29 cell apoptosis. These in vitro inhibitory activities of TI-1-162 correlated to recovery changes in in vivo colon tissues, such as downregulation of adhesion molecules (ICAM-1, VCAM-1) and chemokines (CCL11, CXCL1, CXCL2, CXCL3, CX3CL1) revealed by gene expression array and Western blot analyses. Such molecular recovery of colon epithelium from TNBS-treated rats corresponded to the recovery in body weight, colon weight/length, and myeloperoxidase level by TI-1-162 (10 and 30 mg/kg/day, orally). In relation to action mechanism, TI-1-162 did not disturb TNF-α binding to its receptor, but suppressed phosphorylation of RIP-1, ASK-1, JNK and p38, and nuclear translocation of NF-kB and AP-1, which corresponded to down regulation of inflammatory cytokines in TNF-α-treated cells (HT-29 and U937) and TNBS-treated rat colon tissues. Taken together, the results indicate that the protective effects of TI-1-162 against colon inflammation and epithelial cell death are associated with its inhibitory action in RIP/ASK-1/MAPK signaling pathway downstream to TNF receptor 1. Copyright © 2018 Elsevier B.V. All rights reserved.
19 CFR 162.66 - Penalties for unlading narcotic drugs or marihuana without a permit.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Penalties for unlading narcotic drugs or marihuana... Substances, Narcotics, and Marihuana § 162.66 Penalties for unlading narcotic drugs or marihuana without a permit. In every case where a narcotic drug or marihuana is unladen without a permit, the penalties...
26 CFR 1.162-25T - Deductions with respect to noncash fringe benefits (temporary).
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deductions with respect to noncash fringe... Individuals and Corporations § 1.162-25T Deductions with respect to noncash fringe benefits (temporary). (a) Employer. If an employer includes the value of a noncash fringe benefit in an employee's gross income, the...
41 CFR 301-10.162 - When may I use other than coach-class train accommodations?
2010-07-01
... 10-TRANSPORTATION EXPENSES Common Carrier Transportation Train § 301-10.162 When may I use other than... require other than coach-class rail accommodations. Exceptional security circumstances are determined by... accommodations on an authorized/approved foreign rail carrier do not provide adequate sanitation or health...
2010-07-01
... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417.162 Effluent limitations guidelines... available (BPT): (a) For normal liquid detergent operations the following values pertain: Effluent...
Persamaan Unsur Pokok Pada Suatu Merek Terkenal (Analisis Putusan MA Nomor 162 K/Pdt.Sus-HKI/2014
Directory of Open Access Journals (Sweden)
Dandi Pahusa
2016-04-01
Full Text Available Abstract: Equation Basic Element In A Famous Brand (Analysis of the Decision of the Supreme Court Number 162 K / Pdt.Sus-IPR / 2014. Criteria for determining the equation of the constituents in a well-known brand that is the similarity of images, sounds, names, words, letters, numbers, color composition or a combination of these elements, either for goods or services that are similar or dissimilar based on general knowledge of the public, the brand earned a reputation as a massive campaign, and with evidence of the trademark registration in several countries. The impact of the decision of the Supreme Court Number 162 K / Pdt.Sus-IPR / 2014 for brand owners who have registered and well-known to always protect its brand, namely by taking into account the bad faith of the owner of the other brands. If there are other brands that have been registered in the Directorate General of Intellectual Property and published in General News Brands, the owner of the mark that has been registered in advance immediately appealed and the cancellation of the trademark. Abstrak: Persamaan Unsur Pokok Pada Suatu Merek Terkenal (Analisis atas Putusan MA Nomor 162 K/Pdt.Sus-HKI/2014. Kriteria penentuan persamaan unsur pokok pada suatu merek terkenal yaitu adanya kemiripan gambar, bunyi, nama, kata, huruf-huruf, angka-angka, susunan warna atau kombinasi dari unsur-unsur tersebut, baik terhadap barang atau jasa yang sejenis maupun tidak sejenis yang didasarkan pada pengetahuan umum masyarakat, reputasi merek yang diperoleh karena promosi besar-besaran, dan disertai bukti pendaftaran merek tersebut di beberapa negara. Dampak dari putusan Mahkamah Agung Nomor 162 K/Pdt.Sus-HKI/2014 bagi pemilik merek yang telah terdaftar dan terkenal agar selalu melindungi mereknya yaitu dengan memperhatikan adanya itikad tidak baik dari pemilik merek lain. Apabila terdapat merek lain yang telah terdaftar di Dirjen HKI dan diumumkan dalam Berita Umum Merek, maka pemilik merek yang telah
Directory of Open Access Journals (Sweden)
Oliver Puk
Full Text Available Fibroblast growth factor (Fgf signalling plays a crucial role in many developmental processes. Among the Fgf pathway ligands, Fgf9 (UniProt: P54130 has been demonstrated to participate in maturation of various organs and tissues including skeleton, testes, lung, heart, and eye. Here we establish a novel Fgf9 allele, discovered in a dominant N-ethyl-N-nitrosourea (ENU screen for eye-size abnormalities using the optical low coherence interferometry technique. The underlying mouse mutant line Aca12 was originally identified because of its significantly reduced lens thickness. Linkage studies located Aca12 to chromosome 14 within a 3.6 Mb spanning interval containing the positional candidate genes Fgf9 (MGI: 104723, Gja3 (MGI: 95714, and Ift88 (MGI: 98715. While no sequence differences were found in Gja3 and Ift88, we identified an A→G missense mutation at cDNA position 770 of the Fgf9 gene leading to an Y162C amino acid exchange. In contrast to previously described Fgf9 mutants, Fgf9(Y162C carriers were fully viable and did not reveal reduced body-size, male-to-female sexual reversal or skeletal malformations. The histological analysis of the retina as well as its basic functional characterization by electroretinography (ERG did not show any abnormality. However, the analysis of head-tracking response of the Fgf9(Y162C mutants in a virtual drum indicated a gene-dosage dependent vision loss of almost 50%. The smaller lenses in Fgf9(Y162C suggested a role of Fgf9 during lens development. Histological investigations showed that lens growth retardation starts during embryogenesis and continues after birth. Young Fgf9(Y162C lenses remained transparent but developed age-related cataracts. Taken together, Fgf9(Y162C is a novel neomorphic allele that initiates microphakia and reduced vision without effects on organs and tissues outside the eye. Our data point to a role of Fgf9 signalling in primary and secondary lens fiber cell growth. The results
Directory of Open Access Journals (Sweden)
Hassan Brim
2017-11-01
Full Text Available Increasing evidence suggests a role of the gut microbiota in colorectal carcinogenesis (CRC. To detect bacterial markers of colorectal cancer in African Americans a metabolomic analysis was performed on fecal water extracts. DNA from stool samples of adenoma and healthy subjects and from colon cancer and matched normal tissues was analyzed to determine the microbiota composition (using 16S rDNA and genomic content (metagenomics. Metagenomic functions with discriminative power between healthy and neoplastic specimens were established. Quantitative Polymerase Chain Reaction (q-PCR using primers and probes specific to Streptococcus sp. VT_162 were used to validate this bacterium association with neoplastic transformation in stool samples from two independent cohorts of African Americans and Chinese patients with colorectal lesions. The metabolomic analysis of adenomas revealed low amino acids content. The microbiota in both cancer vs. normal tissues and adenoma vs. normal stool samples were different at the 16S rRNA gene level. Cross-mapping of metagenomic data led to 9 markers with significant discriminative power between normal and diseased specimens. These markers identified with Streptococcus sp. VT_162. Q-PCR data showed a statistically significant presence of this bacterium in advanced adenoma and cancer samples in an independent cohort of CRC patients. We defined metagenomic functions from Streptococcus sp. VT_162 with discriminative power among cancers vs. matched normal and adenomas vs. healthy subjects’ stools. Streptococcus sp. VT_162 specific 16S rDNA was validated in an independent cohort. These findings might facilitate non-invasive screening for colorectal cancer.
33 CFR 162.220 - Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoover Dam, Lake Mead, and Lake... REGULATIONS § 162.220 Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev. (a) Lake Mead and... the axis of Hoover Dam and that portion of Lake Mohave (Colorado River) extending 4,500 feet...
X-ray diffraction studies of 145MeV proton-irradiated AlBeMet 162
Directory of Open Access Journals (Sweden)
Mohamed Elbakhshwan
2016-08-01
Full Text Available AlBeMet 162 (Materion Co., formerly Brush Wellman has been irradiated with 145MeV protons up to 1.2×1020cm−2 fluence, with irradiation temperatures in the range of 100–220°C. Macroscopic post-irradiation evaluation on the evolution of mechanical and thermal properties was integrated with a comprehensive X-ray- diffraction study using high-energy monochromatic and polychromatic X-ray beams, which offered a microscopic view of the irradiation damage effects on AlBeMet. The study confirmed the stability of the metal–matrix composite, its resistance to proton damage, and the continuing separation of the two distinct phases, fcc aluminum and hcp beryllium, following irradiation. Furthermore, based on the absence of inter-planar distance change during proton irradiation, it was confirmed that the stacking faults and clusters on the Al (111 planes are stable, and thus can migrate from the cascade region and be absorbed at various sinks. XRD analysis of the unirradiated AlBeMet 162 showed clear change in the texture of the fcc phase with orientation especially in the Al (111 reflection which exhibits a “non-perfect” six-fold symmetry, implying lack of isotropy in the composite.
Report of AAPM Task Group 162: Software for planar image quality metrology.
Samei, Ehsan; Ikejimba, Lynda C; Harrawood, Brian P; Rong, John; Cunningham, Ian A; Flynn, Michael J
2018-02-01
The AAPM Task Group 162 aimed to provide a standardized approach for the assessment of image quality in planar imaging systems. This report offers a description of the approach as well as the details of the resultant software bundle to measure detective quantum efficiency (DQE) as well as its basis components and derivatives. The methodology and the associated software include the characterization of the noise power spectrum (NPS) from planar images acquired under specific acquisition conditions, modulation transfer function (MTF) using an edge test object, the DQE, and effective DQE (eDQE). First, a methodological framework is provided to highlight the theoretical basis of the work. Then, a step-by-step guide is included to assist in proper execution of each component of the code. Lastly, an evaluation of the method is included to validate its accuracy against model-based and experimental data. The code was built using a Macintosh OSX operating system. The software package contains all the source codes to permit an experienced user to build the suite on a Linux or other *nix type system. The package further includes manuals and sample images and scripts to demonstrate use of the software for new users. The results of the code are in close alignment with theoretical expectations and published results of experimental data. The methodology and the software package offered in AAPM TG162 can be used as baseline for characterization of inherent image quality attributes of planar imaging systems. © 2017 American Association of Physicists in Medicine.
The πNN coupling from high precision np charge exchange at 162 MeV
International Nuclear Information System (INIS)
Nilsson, J.; Blomgren, J.; Conde, H.; Elmgren, K.; Olsson, N.; Ericson, T.E.O.; Uppsala Univ.; Jonsson, O.; Nilsson, L.; Loiseau, B.; Ringbom, A.
1995-02-01
Differential cross sections for unpolarized neutrons of 162 MeV have been measured to high precision with particular attention to the absolute normalisation. These data can be extrapolated precisely and model-independently to the pion pole and give a πNN coupling constant g 2 =14.6±0.3 or f 2 =0.0808±0.0017. This is higher than recently suggested values. (author) 24 refs.; 3 figs.; 1 tab
Mechanical analysis of a $\\beta=0.09 $ 162.5MHz taper HWR cavity
Fan, Peiliang; Zhu, Feng; Zhong, Hutianxiang; Quan, Shengwen; Liu, Kexin
2015-01-01
One superconducting taper-type half-wave resonator (HWR) with frequency of 162.5MHz, \\b{eta} of 0.09 has been developed at Peking University, which is used to accelerate high current proton ($\\sim$ 100mA) and $D^{+}$($\\sim$ 50mA). The radio frequency (RF) design of the cavity has been accomplished. Herein, we present the mechanical analysis of the cavity which is also an important aspect in superconducting cavity design. The frequency shift caused by bath helium pressure and Lorenz force, and...
Gill, Harindarpal S; Dutcher, Lauren; Boron, Walter F; Patel, Samir; Guay-Woodford, Lisa M
2013-07-01
NBCe1-A membrane-embedded macromolecules that cotransport sodium and bicarbonate ions across the bilayer serve to maintain acid-base homeostasis throughout the body. Defects result in a number of renal and eye disorders, including type-II renal tubular acidosis and cataracts. Here, crystals of a human truncated mutant of the cytoplasmic N-terminal domain of NBCe1 (Δ1-62NtNBCe1-A) are reported that diffract X-rays to 2.4 Å resolution. The crystal symmetry of Δ1-62NtNBCe1-A is of space group P31 with pseudo-P3121 symmetry and it has a hemihedral twin fraction of 33.0%. The crystals may provide insight into the pathogenic processes observed in a subset of patients with truncating and point mutations in the gene encoding NBCe1.
International Nuclear Information System (INIS)
Gupta, S.L.; Pancholi, S.C.; Juneja, P.; Mehta, D.; Kumar, A.; Bhowmik, R.K.; Muralithar, S.; Rodrigues, G.; Singh, R.P.
1997-01-01
An experimental investigation of the odd-odd 162 Lu nucleus, following the 148 Sm( 19 F,5n) reaction at beam energy E lab =112MeV, has been performed through in-beam gamma-ray spectroscopy. It revealed three signature-split bands. The yrast band based on πh 11/2 circle-times νi 13/2 configuration exhibits anomalous signature splitting (the unfavored signature Routhian lying lower than the favored one) whose magnitude Δe ' ∼25keV, is considerably reduced in contrast to sizable normal signature splitting Δe ' ∼125 and 60 keV observed in the yrast πh 11/2 bands of the neighboring odd-A 161,163 Lu nuclei, respectively. The signature inversion in this band occurs at spin ∼20ℎ (frequency=0.37MeV). The second signature-split band, observed above the band crossing associated with the alignment of a pair of i 13/2 quasineutrons, is a band based on the four-quasiparticle [πh 11/2 [523]7/2 - times νh 9/2 [521]3/2 - times(νi 13/2 ) 2 ], i.e., EABA p (B p ), configuration. The third signature-split band is also likely to be a four-quasiparticle band with configuration similar to the second band but involving F quasineutron, i.e., FABA p (B p ). The experimental results are discussed in comparison with the existing data in the neighboring nuclei and in the framework of the cranking shell model. copyright 1997 The American Physical Society
Public health implications of radioluminous materials
International Nuclear Information System (INIS)
Moghissi, A.A.; Carter, M.W.
1975-07-01
The safety, efficacy, and relative merits of radium, tritium, and promethium in radioluminous materials, particularly as used in the dial paint of timepieces and instruments, were evaluated. The reduced use of radium in recent years is reflected in estimates of the population dose for 1973--3600 person-rem from 24 million tritium watches versus 2500 person-rem from 8.4 million radium clocks. Had radium still been used in watches, the dose could have been significantly higher. No reliable data are available on the activity of promethium used for this purpose. Assuming a minimum dose of 6100 person-rem from all these radionuclides, an average of 0.03 mrem/year is estimated for the U.S. population. Because of the unavoidable radiation hazard, it is recommended that radium no longer be used in radioluminous materials. Furthermore, the 'frivolous' use of other radionuclides for this purpose should be discouraged
2010-04-01
... entered into under the Indian Self-Determination and Education Assistance Act (25 U.S.C. § 450f et seq.). ... 25 Indians 1 2010-04-01 2010-04-01 false Can these regulations be administered by tribes, on the... INTERIOR LAND AND WATER LEASES AND PERMITS General Provisions § 162.110 Can these regulations be...
Observation of enhanced nuclear stability near the 162 neutron shell
Energy Technology Data Exchange (ETDEWEB)
Lougheed, R.W.; Moody, K.J.; Wild, J.F.; Hulet, E.K.; McQuaid, J.H. [Lawrence Livermore National Lab., CA (United States); Lazarev, Yu.A.; Lobanov, Yu.V.; Oganessian, Yu.Ts.; Utyonkov, V.K.; Abdullin, F.Sh.; Buklanov, G.V.; Gikal, B.N.; Iliev, S.; Mezentsev, A.N.; Polyakov, A.N.; Sedykh, I.M.; Shirokovsky, I.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Yu.S.; Zhuchko, V.E. [Joint Inst. for Nuclear Research, Dubna (Russian Federation)
1993-09-22
In bombardments of {sup 248}Cm with {sup 22}Ne the authors discovered two new isotopes, {sup 265}106 and {sup 266}106, by establishing genetic links between {alpha} decays of the 106 nuclides and SF or {alpha} decays of the daughter (grand-daughter) nuclides. For {sup 266}106 they measured E{sub {alpha}}=8.62{+-}0.06 MeV followed by the SF decay of {sup 262}104 for which they measured a half-life value of 1.2{sup +1.0}{sub {minus}0.5} s. For {sup 265}106 they measured E{sub {alpha}}=8.82{+-}0.06 MeV. They estimated {alpha} half-lives of 10-30 s for {sup 266}106 and 2-30 s for {sup 265}106 with SF branches of {approximately}50% or less. The decay properties of {sup 266}106 indicate a large enhancement in the SF stability of this N=160 nuclide and confirm the existence of the predicted neutron-deformed shell N=162.
Three band crossings in the yrast structure of 162Hf
International Nuclear Information System (INIS)
Bingham, C.R.; Riedinger, L.L.; Courtney, L.H.
1988-01-01
The yrast sequence of 162 Hf has been observed up to a level tentatively assigned as 38 + and reveals a continuing rotational character up to that spin. Sharp backbends at rotational frequencies of 0.27 and 0.42 MeV/ℎ are attributed to isub(13/2) neutron and hsub(11/2) proton alignments, respectively. A gradual increase in the aligned angular momentum of the yrast levels between these two sharp backbends is attributed to the rotational alignment of a pair of negative parity quasineutrons (mostly hsub(9/2) in character). The interpretation of this effect is supported by the failure of the negative parity bands, which already contain this aligned hsub(9/2) neutron, to gain alignment in the same rotational frequency range. While the alignment of the hsub(9/2) quasineutrons has been predicted in the cranked shell model to occur in the rare-earth region with a large interaction strength, this represents the first clear observation of such a band crossing. (author)
2011-06-24
... Certain Employee Remuneration in Excess of $1,000,000 Under Internal Revenue Code Section 162(m) AGENCY... remuneration in excess of $1,000,000 under the Internal Revenue Code (Code). The proposed regulations clarify... stock options, it is intended that the directors may retain discretion as to the exact number of options...
International Nuclear Information System (INIS)
Sharma, B.K.; Subramanian, R.; Balasubramanian, R.; Mathur, P.K.
1994-01-01
The selection of resin plays an important role in the process of separation of boron isotopes by ion exchange chromatography. The determination of (i) ion exchange capacity of Duolite-162 resin for hydroxyl - chloride exchange, (ii) hydroxyl - borate exchange, (iii) isotopic exchange separation factor by batch method and (iv) effect of concentration of boric acid on isotopic exchange separation factor to test the suitability of the above resin for this process are discussed in this report. (author)
Davutoğlu, Ebru Alici; Ozel, Aysegul; Yılmaz, Nevin; Madazli, Riza
2017-12-01
To evaluate the distribution and the obstetric outcomes of pregnancies with different types of rheumatic diseases managed in our unit. Pregnancies of 162 women with rheumatic diseases, seen for their antenatal care at our department for the period between 2013 and 2017 were included in this retrospective clinical study. Obstetric and perinatal outcomes were main outcome measures. The most encountered rheumatic diseases were SLE (37.7%) followed by Behcet's disease (20.4%) and rheumatoid arthritis (17.3%) in our series. The mean maternal age was 30.6 ± 5.3 and the rate of nulliparity was 38.3% in the overall group. Disease activation occurred in 14.1% of patients. Mean gestational age at delivery was 37.4 ± 3.1 and mean birth weight was 3004 ± 762 g. Stillbirth, neonatal death, fetal growth restriction, preeclampsia and preterm delivery rates were 1.2, 2.4, 17.3, 7.4 and 17.9%, respectively. Antiphospholipid syndrome had the highest incidences for fetal growth restriction (42.9%), preeclampsia (28.6%) and delivery ≤ 34 gestational weeks (42.9%). Pathologic uterine artery Doppler velocimetry was identified in 15 cases (15/162, 9.3%) in which 10 (66.7%) developed preeclampsia and/or fetal growth restriction during follow-up. A majority of women with rheumatic diseases have successful pregnancies and deliver healthy babies, with the close and appropriate rheumatological, obstetric and neonatal monitoring.
Vries Robbé, E. de; Cornelissens, A.; Ferwerda, H.
2008-01-01
Dit is een onderzoek naar de werking van de aangifteplicht bij ambtscriminaliteit (art 162 Sv). Het gaat dan bijvoorbeeld om het aannemen van steekpenningen en misdrijven waarbij ambtenaren een bijzondere ambtsplicht schenden. De aangifteplicht raakt de klokkenluidersregeling en maakt onderdeel uit
2010-04-01
...-dwelling structures assisted under the IHBG program meet the requirements of 1000.160? 1000.162 Section... that non-dwelling structures assisted under the IHBG program meet the requirements of 1000.160? (a) The... non-dwelling structure meets the limitation requirements of § 1000.160. If the recipient develops...
International Nuclear Information System (INIS)
Luo, Junhua; Feng, Zhifu; An, Li; Jiang, Li; He, Long
2016-01-01
Activation cross-sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb reactions have been measured by means of the activation technique and a coaxial HPGe γ-ray detector at 13.5 and 14.8 MeV. The fast neutrons were produced via the 3 H(d,n) 4 He reaction on Pd-300 neutron generator. The natural high-purity Dy 2 O 3 powder was used as target material. Theoretical excitation functions were calculated using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were also discussed and compared with some corresponding values found in the literature, with the comprehensive evaluation data in ENDF/B-VII.1 and JENDF-4.0 libraries, and with the estimates obtained from a published empirical formula based on the statistical model with Q-value dependence and odd–even effects taken into consideration. - Highlights: • The cross sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb have been measured. • 93 Nb(n,2n) 92m Nb was used as a monitor for neutron fluence. • Codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • The results were compared with previous data. • Inconsistency with previous data and with model calculations are noted.
Study of elastic pion scattering from 9Be, 28Si, 58Ni, and 208Pb at 162 MeV
International Nuclear Information System (INIS)
Devereux, M.J.
1979-05-01
Elastic pion scattering from 9 Be, 28 Si, 58 Ni, and 208 Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references
CAUGHT IN THE ACT: THE ASSEMBLY OF MASSIVE CLUSTER GALAXIES AT z = 1.62
International Nuclear Information System (INIS)
Lotz, Jennifer M.; Ferguson, Henry C.; Grogin, Norman; Koekemoer, Anton M.; Papovich, Casey; Tran, Kim-Vy; Faber, S. M.; Guo Yicheng; Kocevski, Dale; Lee, Kyoung-Soo; McIntosh, Daniel; Momcheva, Ivelina; Rudnick, Gregory; Saintonge, Amelie; Van der Wel, Arjen; Willmer, Christopher
2013-01-01
We present the recent merger history of massive galaxies in a spectroscopically confirmed proto-cluster at z = 1.62. Using Hubble Space Telescope WFC3 near-infrared imaging from the Cosmic Assembly Near-infrared Deep Extragalactic Legacy Survey, we select cluster and z ∼ 1.6 field galaxies with M star ≥ 3 × 10 10 M ☉ , to determine the frequency of double nuclei or close companions within projected separations less than 20 kpc co-moving. We find that four out of five spectroscopically confirmed massive proto-cluster galaxies have double nuclei, and 57 +13 -14 % of all M star ≥ 3 × 10 10 M ☉ cluster candidates are observed in either close pair systems or have double nuclei. In contrast, only 11% ± 3% of the field galaxies are observed in close pair/double nuclei systems. After correcting for the contribution from random projections, the implied merger rate per massive galaxy in the proto-cluster is ∼3-10 times higher than the merger rate of massive field galaxies at z ∼ 1.6. Close pairs in the cluster have minor merger stellar mass ratios (M primary : M satellite ≥ 4), while the field pairs consist of both major and minor mergers. At least half of the cluster mergers are gas-poor, as indicated by their red colors and low 24 μm fluxes. Two of the double-nucleated cluster members have X-ray detected active galactic nuclei with L x > 10 43 erg s –1 , and are strong candidates for dual or offset super-massive black holes. We conclude that the massive z = 1.62 proto-cluster galaxies are undergoing accelerated assembly via minor mergers, and discuss the implications for galaxy evolution in proto-cluster environments
State of the art of cardiac pacemaker technology
International Nuclear Information System (INIS)
Lambeck, R.
1978-01-01
The development of cardiac pacemakers from fixed-frequency to demand pacemakers is reviewed. The latter is described in more detail with regard to its energy sources and its design. The use of radioactive energy sources is illustrated by the example of 238 Pu and 147 promethium and a comparison of the two radiation sources. (AJ) 891 AJ [de
Nuclear structure from radioactive decay
International Nuclear Information System (INIS)
Wood, J.L.
1991-01-01
This report discusses nuclear structure from radioactive decay of the following: Neutron-Deficient Iridium Isotopes; Neutron-Deficient Platinum Isotopes; Neutron-Deficient Gold Isotopes; Neutron-Deficient Mercury Isotopes; Neutron-Deficient Thallium Isotopes; Neutron-Deficient Lead Isotopes; Neutron-Deficient Samarium Isotopes; Neutron-Deficient Promethium Isotopes; Neutron-Deficient Neodymium Isotopes; and Neutron-Deficient Praseodymium Isotopes. Also discussed are Nuclear Systematics and Models
10 CFR 32.55 - Same: Quality assurance; prohibition of transfer.
2010-01-01
...; prohibition of transfer. (a) Each person licensed under § 32.53 shall visually inspect each device and shall... promethium-147. (b) Each person licensed under § 32.53 shall take a random sample of the size required by the... subject each unit in the sample to the following tests: (1) Each device shall be immersed in 30 inches of...
Epidemiology and mortality of 162 major burns in Kuwait.
Bang, R L; Ghoneim, I E
1996-09-01
The burns intensive care unit at IBN Sina Hospital reopened in July 1991, following the Iraqi occupation of Kuwait and the Gulf War. Epidemiology and mortality of 162 burn patients with 30 per cent and over total body surface area (TBSA) burns, treated from July 1991 to December 1994, is presented. There were 91 males and 71 females with a ratio of 1.3 to 1. The median age was 30 years (range 4 months to 93 years) and 44 per cent of the patients were 15-40 years of age. 124 (76.5 per cent) accidents occurred at home and the flame burn was the commonest involving 131 (80.9 per cent) patients. The median burn surface area was 45.5 per cent and the majority of them sustained deep burns. The hospital stay of the surviving patients ranged from 11 to 174 days (median 38 days), while the day of the death was from 1 to 134 days. Forty-six deaths represent an overall mortality rate of 28.4 per cent amongst our patients. All the patients whose Baux score was 130 and above died. Burn shock was responsible for 10 deaths, and out of them eight were not actively resuscitated due to high Baux score. Sixteen deaths occurred within 48 h postburn. Septicaemia and its related effects were responsible for the majority of the deaths.
2010-04-01
... of employee benefits under the Tax Reform Act of 1984; certain limits on amounts deductible... and Corporations § 1.162-10T Questions and answers relating to the deduction of employee benefits... amendment of section 404(b) by the Tax Reform Act of 1984 affect the deduction of employee benefits under...
np scattering measurements at 162 MeV and the πNN coupling constant
International Nuclear Information System (INIS)
Rahm, J.; Blomgren, J.; Conde, H.; Dangtip, S.; Elmgren, K.; Olsson, N.; Roennqvist, T.; Zorro, R.; Ringbom, A.; Tibell, G.; Jonsson, O.; Nilsson, L.; Renberg, P.U.; Ericson, T.E.O.; Loiseau, B.
1999-01-01
The differential np scattering cross sections has been measured at 162 MeV in the angular range θ c.m. = 72 angle - 180 angle, using the neutron beam facility at the Svedberg Laboratory in Uppsala. Special attention was paid to the absolute normalization of the data. In the angular range 150 angle - 180 angle, the data are steeper then those of most previous measurements and predictions from energy-dependent partial-wave analyses, or nucleon-nucleon potentials. Moreover, a value of the charged πNN coupling constant, g π± 2 = 14.52 ± 0.26 (f π± 2 = 0.0803 ± 0.0014), is deduced from the data, using a novel extrapolation method. This is in good agreement with the classical text book value, but higher than those determined in recent partial-wave analyses of the nucleon-nucleon data base. (authors)
International Nuclear Information System (INIS)
Guo Xiangjiang; Zhang Jiwei
2010-01-01
Objective: To investigate the angiographic manifestations of lower extremity atherosclerotic occlusion in patients with diabetes mellitus. Methods: The angiographic findings of lower extremity in 162 patients with diabetes mellitus were retrospectively analyzed. (1) The arteries of lower extremity were divided into the following four segments: iliac, femoral, popliteal and crural artery. The involvements of these arteries were documented. (2) Based on the lesion's number, location, nature (stricture or occlusion) and length ( 5 cm), the diabetic arterial diseases were categorized. Results: (1) Of 162 diabetic lower limbs, multiple segmental lesions were seen in 131, superficial femoral arterial lesions in 130, and crural arterial lesions in 139, of which 130 arterial lesions had at least two below-the-knee arteries being involved. (2) Based on segmental angiographic classification, a total of 660 vascular lesions were detected, including stricture lesions (33.8%) and occlusive lesions (66.2%). Of the 437 occlusions, 70.5% were located in below-the-knee arteries, and most of which were longer than 10 cm and located in anterior and posterior tibial arteries, while only a few peroneal arteries were involved (P < 0.0001). One hundred and fifty-two lesions were detected in superficial femoral arteries, of which 49 (31.2%) were located at the origin of the superficial femoral artery and 56 (35.7) were in the adductor canal hiatus. Conclusion: The main feature of peripheral arterial disease of lower extremity caused by diabetes mellitus is multi-level atherosclerotic occlusion, the superficial femoral and the crural arteries are most likely to be involved. The lesions of superficial femoral artery are often located at the arterial origin and in the adductor canal hiatus, while the deep femoral artery and the femoral artery are less involved. Long occlusive lesions are more prevalent in crural arteries, especially in anterior and posterior tibial arteries. (J Intervent
Directory of Open Access Journals (Sweden)
Rani Deepa
2012-08-01
Full Text Available Abstract Background Troponin I (TNNI3 is the inhibitory subunit of the thin filament regulatory complex Troponin, which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Mutations (2-7% in this gene had been reported in hypertrophic cardiomyopathy patients (HCM. However, the frequencies of mutations and associated clinical presentation have not been established in cardiomyopathy patients of Indian origin, hence we have undertaken this study. Methods We have sequenced all the exons, including the exon-intron boundaries of TNNI3 gene in 101 hypertrophic cardiomyopathy patients (HCM, along with 160 healthy controls, inhabited in the same geographical region of southern India. Results Our study revealed a total of 16 mutations. Interestingly, we have observed Arginine to Glutamine (R to Q mutation at 3 positions 98, 141 and 162, exclusively in HCM patients with family history of sudden cardiac death. The novel R98Q was observed in a severe hypertrophic obstructive cardiomyopathy patient (HOCM. The R141Q mutation was observed in two familial cases of severe asymmetric septal hypertrophy (ASH++. The R162Q mutation was observed in a ASH++ patient with mean septal thickness of 29 mm, and have also consists of allelic heterogeneity by means of having one more synonymous (E179E mutation at g.4797: G → A: in the same exon 7, which replaces a very frequent codon (GAG: 85% with a rare codon (GAA: 14%. Screening for R162Q mutation in all the available family members revealed its presence in 9 individuals, including 7 with allelic heterogeneity (R162Q and E179E of which 4 were severely affected. We also found 2 novel SNPs, (g.2653; G → A and g.4003 C → T exclusively in HCM, and in silico analysis of these SNPs have predicted to cause defect in recognition/binding sites for proteins responsible for proper splicing. Conclusion Our study has provided valuable information regarding the prevalence of TNNI3 mutations in
Decay properties of nuclei close to Z = 108 and N = 162
International Nuclear Information System (INIS)
Dvorak, Jan
2007-01-01
The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear
DEFF Research Database (Denmark)
Nielsen, Eva-Maria D; Hansen, Lars; Echwald, Søren Morgenthaler
2003-01-01
The aim of the study was to investigate whether genetic variation in the peroxisome proliferator-activated receptor-alpha (PPARalpha) is associated with type 2 diabetes and altered lipid or carbohydrate metabolism in glucose tolerant subjects. Mutation analyses of PPARalpha were performed in 56...... type 2 diabetic patients. Six variants were identified: IVS3 + 76T>C, IVS3-19C>T, IVS4 + 35C>T, Leu162Val, Arg178Gly and Ala268Val. In a case-control study comprising 738 type 2 diabetic patients and 524 glucose tolerant subjects, the three exon variants did not show any significant differences...... in allele frequencies between type 2 diabetic patients and control subjects. The functional Leu162Val polymorphism was further investigated in genotype-phenotype studies involving 340 young, healthy subjects and 502 middle-aged glucose tolerant subjects. The young, healthy subjects who were heterozygous...
19 CFR 162.23 - Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)).
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure under section 596(c), Tariff Act of 1930... SEIZURE Seizures § 162.23 Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)). (a) Mandatory seizures. The following, if introduced or attempted to be introduced into the United...
Hidajat, Rachmat; Kuate, Seraphin; Venzon, David; Kalyanaraman, Vaniambadi; Kalisz, Irene; Treece, James; Lian, Ying; Barnett, Susan W; Robert-Guroff, Marjorie
2010-05-21
An HIV Env immunogen capable of eliciting broad immunity is critical for a successful vaccine. We constructed and characterized adenovirus 5 host range mutant (Ad5hr) recombinants encoding HIV(SF162) gp160 (subtype B) and HIV(TV1) gp160 (subtype C). Immunization of mice with one or both induced cellular immunity to subtype B and C peptides by ELISpot, and antibody responses with high binding titers to HIV Env of subtypes A, B, C, and E. Notably, Ad5hr-HIV(TV1) gp160 induced better cellular immunity than Ad5hr-HIV(SF162) gp160, either alone or following co-administration. Thus, the TV1 Env recombinant alone may be sufficient for eliciting immune responses against both subtype B and C envelopes. Further studies of Ad5hr-HIV(TV1) gp160 in rhesus macaques will evaluate the suitability of this insert for a future phase I clinical trial using a replication-competent Ad4 vector. Published by Elsevier Ltd.
On the relation between the statistical γ-decay and the level density in 162Dy
International Nuclear Information System (INIS)
Henden, L.; Bergholt, L.; Guttormsen, M.; Rekstad, J.; Tveter, T.S.
1994-12-01
The level density of low-spin states (0-10ℎ) in 162 Dy has been determined from the ground state up to approximately 6 MeV of excitation energy. Levels in the excitation region up to 8 MeV were populated by means of the 163 Dy( 3 He, α) reaction, and the first-generation γ-rays in the decay of these states has been isolated. The energy distribution of the first-generation γ-rays provides a new source of information about the nuclear level density over a wide energy region. A broad peak is observed in the first-generation spectra, and the authors suggest an interpretation in terms of enhanced M1 transitions between different high-j Nilsson orbitals. 30 refs., 9 figs., 2 tabs
Kinetics of promethium-147 in a simulated pond
International Nuclear Information System (INIS)
Shang Zhaorong
1995-03-01
The dynamic behaviour of 147 Pm in a simulated aquatic ecosystem which consists of water, soil and aquatic lives. The results are as follows: The accumulation of 147 Pm in the ecosystem can be expressed by an exponential function; the aquatic plants have the highest capacity of concentration of 147 Pm, they can be used as bio-monitors and cleaning agents of contamination of 147 Pm in water; the absorption of 147 Pm by cardio is few, and the most of it accumulates in bone; 147 Pm in soil has little penetrability, and about 80% of it accumulates within 1 cm of top soil. (10 refs., 1 fig., 5 tabs.)
Energy Technology Data Exchange (ETDEWEB)
Fradin, J; Hayoun, C [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Fradin, J.; Hayoun, C. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)
Decay properties of nuclei close to Z = 108 and N = 162
Energy Technology Data Exchange (ETDEWEB)
Dvorak, Jan
2007-07-12
The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The
Time-resolved photodissociation of oxygen at 162 nm
International Nuclear Information System (INIS)
Trushin, Sergei A; Schmid, Wolfram E; Fuss, Werner
2011-01-01
Oxygen was excited by 10 fs pulses in the Schumann-Runge continuum at 162 nm, which is by 0.57 eV above the dissociation limit. It was probed by high-intensity ionization at 810 nm with 10 14 W cm -2 , measuring the ion yields. The O 2 + signal decays in 4.3 fs, which is much shorter than the expected time for dissociation. It is ascribed to a rapid decay of the ionization probability. In a similar time, the ion in the second excited state (with excess energy taken over from the neutral) reaches the dissociation limit, whereas this time would be much longer from the two lower ion states. In fact, the O + signal rises to a (first) maximum at 6 fs. The preference for the higher ion state is rationalized by an intermediate resonance in the neutral molecule for which the polarization dependence also provides evidence. But the shape of the O + signal is very odd: it exhibits three maxima (at 6, 29 and 53 fs) of increasing intensity, before decaying rapidly (≤3.5 fs) to a pedestal. In contrast to the first maximum, the others appear at times when there is practically no interatomic force left in the excited state. We postulate a highly repulsive doubly excited state as a resonance for interpreting the second maximum, and for the third an ion-pair state lying further outside. Comparison is made with enhanced ionization, which has often been found at large interatomic distances on multiple ionization in strong laser fields. Consistent with this mechanism is the absence of similar observations at negative delay times, where five fundamental photons act as a pump and the fifth harmonic as a probe.
Identification of Radiation Sources in a Peacetime Environment
1998-04-01
Radionuclides in Medicine, Research, and Industry (continued) Isotope Symbol Polonium - 210 Po- 210 Promethium-147 Pr-147 Radium-226 Ra-226 Selenium-75 Se...equip- ment seen in a nuclear medicine department or nuclear pharmacy, radia- tion therapy sources, industrial food irradiation facilities, and small... Food Irradiator 28 Commercial Irradiator Facility 28 Appendix 1. Commonly Used Radionuclides in Medicine, Research, and Industry 29 General
International Nuclear Information System (INIS)
Bolotin, Yu.L.; Gonchar, V.Yu.; Chekanov, N.A.
1985-01-01
Coulomb excitation of rotational states induced in heavyion collisions is treated in the framework of the generalized semiclassical approximation. The Hamiltonian of the system under consideration involves not only Coulomb forces (monopole, quadrupole, and hexadecapole) but as well a real nuclear potential in the form of the deformed Woods-Saxon potential. Strong dependence of the excitation probability on the interference between the Coulomb and nuclear interactions is shown. Calculations are carried out for the reaction 40 Ar+ 162 Dy at E=148.6 MeV. The calculated Coulomb excitation probabilities agree satisfactory with the corresponding experimental values
International Nuclear Information System (INIS)
El Zaiki, M.I.; Nafie, H.O.; Abd El Mageed, K.E.
1992-01-01
Two methods of calculations have been used to fit the previously presented data on rotationally aligned quasiparticle bands in sup(160,162,164,166)Yb. Backbendings of moment of inertia of the Yrast states can be reproduced reasonably well. The energy levels and the effective moment of inertia for both gs and s-band are calculated and compared with the experimental data. Band crossing interpretations are discussed for each nucleus. The interaction strength calculations are presented. (author). 17 refs., 7 figs., 4 tabs
DEFF Research Database (Denmark)
Sparsø, Thomas; Hussain, Meena S; Andersen, Gitte
2007-01-01
Peroxisome proliferator-activated receptor-alpha (PPARalpha) is a nuclear receptor capable of regulating the expression of genes involved in peroxisomal and mitochondrial beta-oxidation pathways. The common Leu162Val polymorphism in the gene encoding PPARalpha has inconsistently shown association...
PPARα L162V underlies variation in serum triglycerides and subcutaneous fat volume in young males
Directory of Open Access Journals (Sweden)
Clarkson Priscilla M
2007-08-01
Full Text Available Abstract Background Of the five sub-phenotypes defining metabolic syndrome, all are known to have strong genetic components (typically 50–80% of population variation. Studies defining genetic predispositions have typically focused on older populations with metabolic syndrome and/or type 2 diabetes. We hypothesized that the study of younger populations would mitigate many confounding variables, and allow us to better define genetic predisposition loci for metabolic syndrome. Methods We studied 610 young adult volunteers (average age 24 yrs for metabolic syndrome markers, and volumetric MRI of upper arm muscle, bone, and fat pre- and post-unilateral resistance training. Results We found the PPARα L162V polymorphism to be a strong determinant of serum triglyceride levels in young White males, where carriers of the V allele showed 78% increase in triglycerides relative to L homozygotes (LL = 116 ± 11 mg/dL, LV = 208 ± 30 mg/dL; p = 0.004. Men with the V allele showed lower HDL (LL = 42 ± 1 mg/dL, LV = 34 ± 2 mg/dL; p = 0.001, but women did not. Subcutaneous fat volume was higher in males carrying the V allele, however, exercise training increased fat volume of the untrained arm in V carriers, while LL genotypes significantly decreased in fat volume (LL = -1,707 ± 21 mm3, LV = 17,617 ± 58 mm3 ; p = 0.002, indicating a systemic effect of the V allele on adiposity after unilateral training. Our study suggests that the primary effect of PPARα L162V is on serum triglycerides, with downstream effects on adiposity and response to training. Conclusion Our results on association of PPARα and triglycerides in males showed a much larger effect of the V allele than previously reported in older and less healthy populations. Specifically, we showed the V allele to increase triglycerides by 78% (p = 0.004, and this single polymorphism accounted for 3.8% of all variation in serum triglycerides in males (p = 0.0037.
Directory of Open Access Journals (Sweden)
Sinem eAtak
2015-12-01
Full Text Available Ligand-binding of Cys-loop receptors is determined by N-terminal extracellular loop structures from the plus as well as from the minus side of two adjacent subunits in the pentameric receptor complex. An aromatic residue in loop B of the glycine receptor (GlyR undergoes direct interaction with the incoming ligand via cation-π interactions. Recently we showed that mutated residues in loop B identified from human patients suffering from hyperekplexia disturb ligand-binding. Here, we exchanged the affected human residues by amino acids found in related members of the Cys-loop receptor family to determine the effects of side chain volume for ion channel properties. GlyR variants were characterized in vitro following transfection into cell lines in order to analyze protein expression, trafficking, degradation and ion channel function. GlyR α1 G160 mutations significantly decrease glycine potency arguing for a positional effect on neighboring aromatic residues and consequently glycine-binding within the ligand-binding pocket. Disturbed glycinergic inhibition due to T162 α1 mutations is an additive effect of affected biogenesis and structural changes within the ligand-binding site. Protein trafficking from the ER towards ER-Golgi intermediate compartment, the secretory Golgi pathways and finally the cell surface is largely diminished, but still sufficient to deliver ion channels that are functional at least at high glycine concentrations. The majority of T162 mutant protein accumulates in the ER and is conducted to ER-associated proteasomal degradation. Hence, G160 is an important determinant during glycine binding. In contrast, T162 assigns primarily receptor biogenesis whereas exchanges in functionality are secondary effects thereof.
162.5 MHz digital low-level radio frequency control monitoring system design and implementation
International Nuclear Information System (INIS)
Zhang Ruifeng; Wang Xianwu; Xu Zhe; Yi Xiaoping
2014-01-01
162.5 MHz high-frequency low-level control system self-developed by Institute of Modern Physics for ADS project took digital technology. All parameters' reading and writing, including loop parameter setting, open and close-loop operation, and condition monitoring, were achieved through the monitoring system. The system used lightweight client-server working mode that client running in the PC sent command data, server running on high-frequency digital low level system responded instructions to complete parameter monitoring and control. The system consisted of three parts. Firstly, server hardware system was constructed based on Atera Stratix Ⅲ family of field-programmable gate array (FPGA) development board. Secondly, the server software system was designed based on Micro C/OS Ⅱ real-time operating systems and lightweight TCP/IP protocol stack, and finally a client PC program was designed based on MFC. After a long test, it was indicated that the monitoring system works properly and stably. TCP sends and receives throughput reached 11.931038 Mbps and 8.117624 Mbps. (authors)
International Nuclear Information System (INIS)
Rudnick, Gregory H.; Tran, Kim-Vy; Papovich, Casey; Momcheva, Ivelina; Willmer, Christopher
2012-01-01
We study the red sequence in a cluster of galaxies at z = 1.62 and follow its evolution over the intervening 9.5 Gyr to the present day. Using deep YJK s imaging with the HAWK-I instrument on the Very Large Telescope, we identify a tight red sequence and construct its rest-frame i-band luminosity function (LF). There is a marked deficit of faint red galaxies in the cluster that causes a turnover in the LF. We compare the red-sequence LF to that for clusters at z 0.6. In this model the cluster accretes blue galaxies from the field whose star formation is quenched and who are subsequently allowed to merge. We find that three to four mergers among cluster galaxies during the 4 Gyr between z = 1.62 and z = 0.6 match the observed LF evolution between the two redshifts. The inferred merger rate is consistent with other studies of this cluster. Our result supports the picture that galaxy merging during the major growth phase of massive clusters is an important process in shaping the red-sequence population at all luminosities.
International Nuclear Information System (INIS)
Miyano, M.H.
1990-01-01
Solid state compounds involving Ln and DMBP, where Ln trivalent lanthanides (except promethium) and yttrium; DMBP 4-dimethyl amino benzylidene pyruvate, were prepared by addition of ligand to the corresponding metal ions chlorides, both in aqueous solution. The precipitates were washed with distilled water and dried at 40 0 C in a forced circulation oven. Complexometry with EDTA, thermogravimetry (TG), differential thermal analysis (DTA), infra-red absorption and X-ray diffraction have been used in the study of these compounds. (author)
Sorption and chromatographic techniques for processing liquid waste of nuclear fuel cycle
International Nuclear Information System (INIS)
Gelis, V.M.; Milyutin, V.V.; Chuveleva, E.A.; Maslova, G.B.; Kudryavtseva, S.P.; Firsova, L.A.; Kozlitin, E.A.
2000-01-01
In the spent nuclear fuel processing procedures the significant quantity of high level liquid waste containing long-lived high toxic radionuclides of cesium, strontium, promethium, americium, curium, etc. is generated. Separation of those radionuclides from the waste not merely simplifies the further safe waste handling but also reduces the waste processing operation costs due to the market value of certain individual radionuclide preparations. Recovery and separation of high grade pure long-lived radionuclide preparations is frequently performed by means of chromatographic techniques. (authors)
Casualty Estimation for Nuclear and Radiological Weapons
2016-06-01
rate 2.69 d β Metal Polonium - 210 210Po Static eliminators 138 d α Metal foil Radium-226 226Ra Brachytherapy - low dose rate 1600 y α Salt...Promethium-147 153Gd Gadolinium-153 169Yb Ytterbium-169 170Tm Thulium-170 192Ir Iridium-192 210Po Polonium - 210 226Ra Radium-226 238Pu Plutonium-238...Brussels: NATO, in development). iv present in a large food irradiator facility, and constitutes about 34.5 kg of 137Cs. To illustrate alternative
Directory of Open Access Journals (Sweden)
Nathalie Dereuddre-Bosquet
Full Text Available In complement to an effective vaccine, development of potent anti-HIV microbicides remains an important priority. We have previously shown that the miniCD4 M48U1, a functional mimetic of sCD4 presented on a 27 amino-acid stable scaffold, inhibits a broad range of HIV-1 isolates at sub-nanomolar concentrations in cellular models. Here, we report that M48U1 inhibits efficiently HIV-1(Ba-L in human mucosal explants of cervical and colorectal tissues. In vivo efficacy of M48U1 was evaluated in nonhuman primate (NHP model of mucosal challenge with SHIV(162P3 after assessing pharmacokinetics and pharmacodynamics of a miniCD4 gel formulation in sexually matured female cynomolgus macaques. Among 12 females, half were treated with hydroxyethylcellulose-based gel (control, the other half received the same gel containing 3 mg/g of M48U1, one hour before vaginal route challenge with 10 AID(50 of SHIV(162P3. All control animals were infected with a peak plasma viral load of 10(5-10(6 viral RNA (vRNA copies per mL. In animals treated with miniCD4, 5 out of 6 were fully protected from acquisition of infection, as assessed by qRT-PCR for vRNA detection in plasma, qPCR for viral DNA detection in PBMC and lymph node cells. The only infected animal in this group had a delayed peak of viremia of one week. These results demonstrate that M48U1 miniCD4 acts in vivo as a potent entry inhibitor, which may be considered in microbicide developments.
Surface-ionization ion source designed for in-beam operation with the BEMS-2 isotope separator
International Nuclear Information System (INIS)
Bogdanov, D.D.; Voboril, J.; Demyanov, A.V.; Karnaukhov, V.A.; Petrov, L.A.
1976-01-01
A surface-ionization ion source designed to operate in combination with the BEMS-2 isotope separator in a heavy ion beam is described. The ion source is adjusted for the separation of rare-earth elements. The separation efficiency for 150 Dy is determined to be equal to about 20% at the ionizer temperature of 2600 deg K. The hold-up times for praseodymium, promethium and dysprosium in the ion source range from 5 to 10 sec at the ionizer temperature of 2500-2700 deg K
Religiousness as a Predictor of Suicide: An Analysis of 162 European Regions.
Stack, Steven; Laubepin, Frederique
2018-01-25
Research on religion as a protective factor has been marked by four recurrent limitations: (1) an overemphasis on the United States, a nation where religiosity is relatively high; (2) a neglect of highly secularized zones of the world, where religiousness may be too weak to affect suicide; (3) restriction of religiousness to religious affiliation, a construct which may miss capturing other dimensions of religiousness such as the importance of religion in one's life; and (4) an overwhelming use of the nation as a unit of analysis, which masks variation in religiousness within nations. The present article addresses these limitations by performing a cross-national test of the following hypothesis: The greater the strength of subjective religiousness, the lower the suicide rate, using small units of analysis for a secularized area of the world. All data refer to 162 regions within 22 European nations. Data were extracted from two large databases, EUROSTAT and the European Social Surveys (ESS Round 4), and merged using NUTS-2 (Nomenclature of Statistical Territorial Units) regions as the unit of analysis. Controls are incorporated for level of economic development, education, and measures of economic strain. The results of a multiple regression analysis demonstrated that controlling for the other constructs in the model, religiousness is associated with lower suicide rates, confirming the hypothesis. Even in secularized European nations, where there is a relatively weak moral community to reinforce religion, religiousness acts as a protective factor against suicide. Future work is needed to explore the relationship in other culture zones of the world. © 2018 The American Association of Suicidology.
Paris, A; Maurice-Tison, S; Coatleven, F; Vandenbossche, F; Dallay, D; Horovitz, J
2012-06-01
To compare the interest of lactate microanalysis with pH measurement (Gold Standard procedure) in cord blood and fetal scalp blood samples for the assessment of abnormal fetal heart rate (FHR) during labour. A prospective observational study conducted from July 1st 2007 till March 31st 2008 on 162 patients with abnormal FHR during labour. Sampling failure for scalp lactate was less than 1 % compared to a failure of 10.5 % for scalp pH (Pinterest. Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Methods radiation protection data sheets for the use radionuclides in unsealed sources
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheets are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to safety in this field. They contain the essential radiation protection data for the use of radionuclides in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: bromine 82, cobalt 58, cobalt 60, manganese 54, mercury 197, mercury 203, promethium 147, xenon 133 and ytterbium 169. (O.M.)
International Nuclear Information System (INIS)
Martinelli, P.
1960-01-01
The process for analysing and measuring the thickness of deposits by β-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [fr
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Installation for producing sealed radioactive sources
International Nuclear Information System (INIS)
Fradin, J.; Hayoun, C.
1969-01-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [fr
Psoriatic arthritis: A retrospective study of 162 patients
Directory of Open Access Journals (Sweden)
Pavlica Ljiljana
2005-01-01
Full Text Available Aim. The aim of our study was to determine the prevalence of psoriatic arthritis in the patients with psoriasis and to analyze retrospectively the results of a 34-year multidisciplinary management of the patients with psoriatic arthritis. Methods. The study included 162 out of 183 treated patients with psoriatic arthritis, aged 48 ± 15 years. All the patients satisfied the current diagnostic criteria for psoriasis and psoriatic arthritis according to the American College of Rheumatology. Results. Psoriatic arthritis developed in 183 (9.3% out of 1976 patients with psoriasis. Time interval for establishing the diagnosis was 4 years. A positive family history of the disease had 15.0% of the studied patients. Its onset was most often at 42 years of age in 70.4% of the cases, and 2 months to 59 years after the appearance of psoriasis. Psoriatic arthritis without psoriasis appeared in 1.8% of the patients. A severe form of arthritis had 64.2% of the patients, mainly the patients with scalp psoriasis (χ2=3.2; p<0.05. Nail changes had 35% of the patients. Distal interphalangeal joints were involved in 63.6%, axial skeleton in 36.4%, oligoarthritis in 45.0%, polyarthritis in 55.0%, and mutilating form in 6.8% of the patients. Elevated Erythrocyte Sedimentation Rate was reveald in 61.7% of the patients. Immunoglobulin M (IgM rheumatoid factor was altered in 4.3% of the patients. The human leukocyte antigen (HLA typing in the 28 patients were: A2 32.0%, A3 18.0%, Al and A9 14.0%, A28 and A29 3.5%, B8 and B16 14.0%, B5 and B12 11.0%, B13,B15, B18, B27 and B35 7.0%. Radiologic changes were most often in hand and foot joints, less frequently in the knees and quite infrequently in hips and shoulders joints. Sacroiliitis was found in 46.4% of the patients. Psoriasis was treated with topical corticosteroids and salicylic ointments in all the patients, ultraviolet (PUVA therapy in 5.6% and retinoids in 4.3% of them. Artrithis was treated with nonsteroidal anti
Energy Technology Data Exchange (ETDEWEB)
Niu, Hai Hua; Li, Youtang [Lanzhou University of Technology, Lanzhou (China); He, Yuan; Zhang, Bin; Huang, Shichun; Yuan, Chenzhang; Jia, Huan; Zhang, Shenghu [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou (China)
2017-08-15
A buncher is one of the main pieces of equipment in the medium energy beam transport line (MEBT) for China accelerator driven sub-critical system (C-ADS) Injector II. To focus the beam longitudinally and match the beam for the acceptance of the superconducting linac section, two room temperature quarter wave resonator (QWR) bunchers with frequency of 162.5 MHz have been designed as parts of the MEBT. According to the beam transmission matching of the MEBT and the geometric parameters requirements of bunchers, the unique mechanical structure and the main processing technology of buncher cavities and their couplers and tuners are described in this paper. The fabrication of bunchers and their parts have been completed and tested at high power, the test results agree well with the design requirements. These bunchers work well for about two years in Institute of Modern Physics, Chinese Academy of Sciences.
Yu, Zonghuo; Wang, Fei
2016-03-12
Substantial research has shown that emotions play a critical role in physical health. However, most of these studies were conducted in industrialized countries, and it is still an open question whether the emotion-health connection is a "first-world problem". In the current study, we examined socio-economic development's influence on emotion-health connection by performing multilevel-modeling analysis in a dataset of 33,600 individuals from 162 counties in China. Results showed that both positive emotions and negative emotions predicted level of physical health and regional Gross Domestic Product Per Capita (GDPPC) had some impact on the association between emotion and health through accessibility of medical resources and educational status. But these impacts were suppressed, and the total effects of GDPPC on emotion-health connections were not significant. These results support the universality of emotion-health connection across levels of GDPPC and provide new insight into how socio-economic development might affect these connections.
Directory of Open Access Journals (Sweden)
Haihua Niu
2017-08-01
Full Text Available A buncher is one of the main pieces of equipment in the medium energy beam transport line (MEBT for China accelerator driven sub-critical system (C-ADS Injector II. To focus the beam longitudinally and match the beam for the acceptance of the superconducting linac section, two room temperature quarter wave resonator (QWR bunchers with frequency of 162.5 MHz have been designed as parts of the MEBT. According to the beam transmission matching of the MEBT and the geometric parameters requirements of bunchers, the unique mechanical structure and the main processing technology of buncher cavities and their couplers and tuners are described in this paper. The fabrication of bunchers and their parts have been completed and tested at high power, the test results agree well with the design requirements. These bunchers work well for about two years in Institute of Modern Physics, Chinese Academy of Sciences.
Energy Technology Data Exchange (ETDEWEB)
Devereux, M.J.
1979-05-01
Elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references.
Huang, Yang; Liu, Zhuofu; Wang, Jingjing; Sun, Xicai; Yang, Lei; Wang, Dehui
2014-08-01
The purpose of this study was to report on a series of 162 patients presenting with juvenile nasopharyngeal angiofibroma in a single academic hospital during the past 17 years, in an effort to compare outcomes between open and transnasal endoscopic approach, and to define an ideal treatment strategy. Patients who received either open or endoscopic surgery with a minimum follow-up of 6 months were selected. Local control and complications were compared between groups. Retrospectively, clinical data, surgical reports, pre- and postoperative images, and follow-up information were reviewed and analyzed. All patients were male subjects from 8 to 41 years old. Ninety-six patients were treated by transpalatal or transmaxillary approach, and the remaining 66 patients were treated using transnasal endoscopic approach with/without labiogingival incision. When compared to the open surgery group, the endoscopic surgery group showed a lower median intraoperative blood loss (800 vs. 1100 mL, P = .017) and a lower number of postoperative complications (one vs. 10). In addition, recurrence statistically correlated with Radkowski's classification and patient age. Transnasal endoscopic approach can be successfully used for Radkowski's stages I-IIb tumors and selective IIc-IIIb lesions, allowing for less blood loss, fewer postoperative complications, and a lower percentage of recurrence in comparison to open surgery. The management of recurrent tumor is complex, should be individually tailored, and should take into account tumor location, patient age, complications of treatment, and the possibility of spontaneous involution, to better define treatment strategy. © 2014 The American Laryngological, Rhinological and Otological Society, Inc.
Genitourinary injuries after traffic accidents: Analysis of a registry of 162,690 victims.
Terrier, Jean-Etienne; Paparel, Philippe; Gadegbeku, Blandine; Ruffion, Alain; Jenkins, Lawrence C; N'Diaye, Amina
2017-06-01
Traffic accidents are the most frequent cause of genitourinary injuries (GUI). Kidney injuries after trauma have been well described. However, there exists a paucity of data on other traumatic GUI after traffic accidents. The objective of this study was to analyze the frequency and type of all GUI, by user category, after traffic accidents. Patient cases were extracted from the trauma registry of the French department of Rhone from 1996 to 2013. We assessed the urogenital injuries presented by each of road user's categories. Severity injuries were coded with the Abbreviated Injury Scale and the Injury Severity Score. Kidney trauma was mapped with the classification of the American Association for the Surgery of Trauma. Multivariate prediction models were used for analysis of data. Of 162,690 victims, 963 presented with GUI (0.59%). 47% were motorcyclists, 22% were in a car, 18% on bicycles, and 9% were pedestrians. The most common organ injury was kidney (41%) followed by testicular (23%). Among the 208 motorists with a GUI, kidney (70%), bladder (10%), and adrenal gland (9%) were the most frequent lesions. Among the 453 motorcyclist victims with GUI, kidney (35%) and testicular (38%) traumas were the most frequent and 62% of injuries involved external genitalia. There were 175 cyclists with GUI, 70% of injuries involved external genitalia; penile traumas (23%) were the most frequent. In total, there were 395 kidney injuries, most being low grade. According to the American Association for the Surgery of Trauma kidney injuries were grade I, 59%; grade II, 11%; grade III, 16%; grade IV, 9%; grade V, 3%; and indeterminate, 2%. GUI is an infrequent trauma after traffic accidents, with kidneys being the most commonly injured. Physicians must maintain a high awareness for external genitalia injuries in motorcyclists and cyclists. Prognostic and epidemiologic study, level III.
Pitfalls of CT for deep neck abscess imaging assessment: a retrospective review of 162 cases.
Chuang, S Y; Lin, H T; Wen, Y S; Hsu, F J
2013-01-01
To investigate the diagnostic value of contrast-enhanced computed tomography (CT) for the prediction of deep neck abscesses in different deep neck spaces and to evaluate the false-positive results. We retrospectively analysed the clinical charts, CT examinations, surgical findings, bacteriology, pathological examinations and complications of hospitalised patients with a diagnosis of deep neck abscess from 2004 to 2010. The positive predictive values (PPV) for the prediction of abscesses by CT scan in different deep neck spaces were calculated individually on the basis of surgical findings. A total of 162 patients were included in this study. All patients received both intravenous antibiotics and surgical drainage. The parapharyngeal space was the most commonly involved space. The overall PPV for the prediction of deep neck abscess with contrast-enhanced CT was 79.6%. The PPV was 91.3% when more than one deep neck space was involved but only 50.0% in patients with isolated retropharyngeal abscesses. In the false-positive group, cellulitis was the most common final result, followed by cystic degeneration of cervical metastases. Five specimens taken intra-operatively revealed malignancy and four of these were not infected. There are some limitations affecting the differentiation of abscesses and cellulitis, particularly in the retropharyngeal space. A central necrotic cervical metastatic lymph node may sometimes also mimic a simple pyogenic deep neck abscess on both clinical pictures and CT images. Routine biopsy of the tissue must be performed during surgical drainage.
DISCOVERY OF A STRONG LENSING GALAXY EMBEDDED IN A CLUSTER AT z = 1.62
International Nuclear Information System (INIS)
Wong, Kenneth C.; Suyu, Sherry H.; Tran, Kim-Vy H.; Papovich, Casey J.; Momcheva, Ivelina G.; Brammer, Gabriel B.; Koekemoer, Anton M.; Brodwin, Mark; Gonzalez, Anthony H.; Kacprzak, Glenn G.; Rudnick, Gregory H.; Halkola, Aleksi
2014-01-01
We identify a strong lensing galaxy in the cluster IRC 0218 (also known as XMM-LSS J02182–05102) that is spectroscopically confirmed to be at z = 1.62, making it the highest-redshift strong lens galaxy known. The lens is one of the two brightest cluster galaxies and lenses a background source galaxy into an arc and a counterimage. With Hubble Space Telescope (HST) grism and Keck/LRIS spectroscopy, we measure the source redshift to be z S = 2.26. Using HST imaging in ACS/F475W, ACS/F814W, WFC3/F125W, and WFC3/F160W, we model the lens mass distribution with an elliptical power-law profile and account for the effects of the cluster halo and nearby galaxies. The Einstein radius is θ E =0.38 −0.01 +0.02 arcsec (3.2 −0.1 +0.2 kpc) and the total enclosed mass is M tot (<θ E )=1.8 −0.1 +0.2 ×10 11 M ⊙ . We estimate that the cluster environment contributes ∼10% of this total mass. Assuming a Chabrier initial mass function (IMF), the dark matter fraction within θ E is f DM Chab =0.3 −0.3 +0.1 , while a Salpeter IMF is marginally inconsistent with the enclosed mass (f DM Salp =−0.3 −0.5 +0.2 ). The total magnification of the source is μ tot =2.1 −0.3 +0.4 . The source has at least one bright compact region offset from the source center. Emission from Lyα and [O III] are likely to probe different regions in the source
A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence
International Nuclear Information System (INIS)
Andersson, Oe.
1995-08-01
The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb 22+ ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb 22+ ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb 21+ ). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs
DISCOVERY OF A STRONG LENSING GALAXY EMBEDDED IN A CLUSTER AT z = 1.62
Energy Technology Data Exchange (ETDEWEB)
Wong, Kenneth C.; Suyu, Sherry H. [Institute of Astronomy and Astrophysics, Academia Sinica (ASIAA), P.O. Box 23-141, Taipei 10617, Taiwan (China); Tran, Kim-Vy H.; Papovich, Casey J. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics and Astronomy, Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); Momcheva, Ivelina G. [Astronomy Department, Yale University, New Haven, CT 06511 (United States); Brammer, Gabriel B.; Koekemoer, Anton M. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Brodwin, Mark [Department of Physics and Astronomy, University of Missouri, 5110 Rockhill Road, Kansas City, MO 64110 (United States); Gonzalez, Anthony H. [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Kacprzak, Glenn G. [Swinburne University of Technology, Victoria 3122 (Australia); Rudnick, Gregory H. [Department of Physics and Astronomy, The University of Kansas, Malott Room 1082, 1251 Wescoe Hall Drive, Lawrence, KS 66045 (United States); Halkola, Aleksi
2014-07-10
We identify a strong lensing galaxy in the cluster IRC 0218 (also known as XMM-LSS J02182–05102) that is spectroscopically confirmed to be at z = 1.62, making it the highest-redshift strong lens galaxy known. The lens is one of the two brightest cluster galaxies and lenses a background source galaxy into an arc and a counterimage. With Hubble Space Telescope (HST) grism and Keck/LRIS spectroscopy, we measure the source redshift to be z {sub S} = 2.26. Using HST imaging in ACS/F475W, ACS/F814W, WFC3/F125W, and WFC3/F160W, we model the lens mass distribution with an elliptical power-law profile and account for the effects of the cluster halo and nearby galaxies. The Einstein radius is θ{sub E}=0.38{sub −0.01}{sup +0.02} arcsec (3.2{sub −0.1}{sup +0.2} kpc) and the total enclosed mass is M {sub tot}(<θ{sub E})=1.8{sub −0.1}{sup +0.2}×10{sup 11} M{sub ⊙}. We estimate that the cluster environment contributes ∼10% of this total mass. Assuming a Chabrier initial mass function (IMF), the dark matter fraction within θ{sub E} is f{sub DM}{sup Chab}=0.3{sub −0.3}{sup +0.1}, while a Salpeter IMF is marginally inconsistent with the enclosed mass (f{sub DM}{sup Salp}=−0.3{sub −0.5}{sup +0.2}). The total magnification of the source is μ{sub tot}=2.1{sub −0.3}{sup +0.4}. The source has at least one bright compact region offset from the source center. Emission from Lyα and [O III] are likely to probe different regions in the source.
Calculated single-proton levels for nuclei with N equal to 152, 154, 156, 158, 160 and 162
International Nuclear Information System (INIS)
Moeller, P.; Nix, J.R.; Swiatecki, W.
1986-09-01
The decay properties of nuclei in many cases depend strongly on the quantum numbers of the single-particle levels in the vicinity of the Fermi surface. A striking illustration is the prolonged fission half-lives of odd nuclei relative to their even neighbors. The hindrance factor depends on the spin of unpaired odd particle and increases with increasing spin of the odd particle. The effect has been studied theoretically. For 257 Fm the hindrance factor is almost ten orders of magnitude. The computer code for calculating nuclear masses calculates single-particle levels at the deformations considered as one step in the calculations. We have run this code at the ground state deformation of all nuclei considered in the 1981 mass study and stored the calculated single-particle levels on permanent mass storage. A computer code has been constructed for extracting levels of nuclei that are specified to the program and plotting them. In this report we consider single-proton levels for even-N nuclei in the range 152 ≤ N ≤ 162. Six such plots are included in this report. The levels are plotted relative to the Fermi surface of each nucleus. We also include tables of the plotted single-particle levels since it is not always possible to determine the spin from an inspection of the plots, when levels are overlapping. 6 figs
Goode, Diana; Truong, Rosaline; Villegas, Guillermo; Calenda, Giulia; Guerra-Perez, Natalia; Piatak, Michael; Lifson, Jeffrey D.; Blanchard, James; Gettie, Agegnehu; Robbiani, Melissa; Martinelli, Elena
2014-01-01
The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM) model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7 high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7 high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7 high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission. PMID:25521298
Goode, Diana; Truong, Rosaline; Villegas, Guillermo; Calenda, Giulia; Guerra-Perez, Natalia; Piatak, Michael; Lifson, Jeffrey D; Blanchard, James; Gettie, Agegnehu; Robbiani, Melissa; Martinelli, Elena
2014-12-01
The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM) model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission.
Directory of Open Access Journals (Sweden)
Diana Goode
2014-12-01
Full Text Available The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission.
International Nuclear Information System (INIS)
Ellis, D.G.; Curtis, L.J.
1982-01-01
Term values and ionization potentials have been calculated for several ions in the promethium (N = 61) isoelectronic sequence. As the nuclear charge is increased, the ground configuration changes from 4f 13 5s 2 to 4f 14 5s giving the upper portion of the sequence an alkali-like character. According to our most recent Hartree-Fock calculations with first-order relativistic corrections, the ground term is 5s 2 S for Z > 77 (Ir XVII) and the first excited term is 5p 2 P 0 for Z > 84 (P 0 XXIV). Comparisons are made with calculations of Cowan in W XIV. The prospects for observation of these spectra in fast ion beams are discussed. (orig.)
A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence
Energy Technology Data Exchange (ETDEWEB)
Andersson, Oe
1995-08-01
The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb{sup 22+} ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb{sup 22+} ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb{sup 21+}). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs.
Acoustic study of the characteristic temperature of metals
International Nuclear Information System (INIS)
Tekuchev, V.V.; Rygalov, L.N.; Ivanova, I.V.; Barashkov, B.I.
2000-01-01
The calculation of the Debye temperature for 64 metals, including Be, La, Mo, W, Os, Ni, Cd, In, Ta, U, Sc, Cs, Sr, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Dy, Ho, Er, Yb, Lu, Th is carried out. The data on polonium and promethium are obtained for the first time. The calculation is performed with application of ultrasound velocity value at the melting temperature of the given metal. The average derivation of the calculational data on the Debye temperature from the published ones equals 12%. It is noted, that application of the acoustic method for determination of the characteristic temperature makes it possible to solve the wide range of theoretical and applied problems [ru
Directory of Open Access Journals (Sweden)
Qi Wang
Full Text Available By analyzing the different phenotypes of two Chinese DFNA9 families with the same mutation located in the intervening region between the LCCL and vWFA domains of cochlin and testing the functional changes in the mutant cochlin, we investigated the different pathogeneses for mutations in LCCL and vWFA domains.Targeted next-generation sequencing for deafness-related genes was used to identify the mutation in the proband in family #208. The probands of family #208 and family #32 with the same p.C162Y mutation were followed for more than 3 years to evaluate the progression of hearing loss and vestibular dysfunction using pure-tone audiometry, caloric testing, electrocochleogram, vestibular-evoked myogenic potential, and video head-impulse test. The disruption of normal cleavage to produce secreted LCCL domain fragments and the tendency to form aggregations of mutant cochlins were tested by in vitro cell experiments.The two families showed different clinical symptoms. Family #32 was identified as having early-onset, progressive sensorineural hearing loss, similar to the symptoms in DFNA9 patients with cochlin mutations in the vWFA domain. The proband of family #208 endured late-onset recurrent paroxysmal vertigo attacks and progressively deteriorating hearing, similar to symptoms in those with cochlin mutations in the LCCL domain. We therefore suggest that the disrupted cleavage of the LCCL domain fragment is likely to cause vestibular dysfunction, and aggregation of mutant cochlin caused by mutations in the vWFA domain is responsible for early-onset hearing loss. The p.C162Y mutation causes either disruption of LCCL domain fragment cleavage or aggregation of mutant cochlin, resulting in the different phenotypes in the two families.This study demonstrates that DFNA9 families with the same genotype may have significantly different phenotypes. The mutation site in cochlin is related to the pathological mechanism underlying the different phenotypes.
Measurement of 147Pm in-vivo using phoswich detectors
International Nuclear Information System (INIS)
Johnson, J.R.
1977-10-01
Recently an individual was suspected of having inhaled significant amounts of the almost pure beta emitter, 147 Pm. Urine analysis confirmed that contaminations had occurred but these results could not be used to evaluate the amount of material deposited in the lungs because an acceptable model of promethium clearance from the lung to blood and hence to urine has not been developed. Therefore another method of evaluation, that of the measurement, using phoswich detectors, of the soft photons emitted by the deposited 147 Pm was used. This paper describes the calibrations and measurements that were done in order that an upper limit on the deposited activity, and hence limits for committed dose to the various organs, could be assigned. (author)
Busarev, Vladimir V.; Makalkin, Andrei B.; Vilas, Faith; Barabanov, Sergey I.; Scherbina, Marina P.
2018-04-01
For the first time, spectral signs of subtle coma activity were observed for four main-belt primitive asteroids (145) Adeona, (704) Interamnia, (779) Nina, and (1474) Beira around their perihelion distances in September 2012, which were interpreted as manifestations of the sublimation of H2O ice in/under the surface matter (Busarev et al., 2015a, 2015b). We confirm the phenomenon for Nina when it approached perihelion in September 2016. At the same time, based on results of spectral observations of near-Earth asteroid (162,173) Ryugu (Vilas, 2008) being a target of Japan's Hayabusa 2 space mission, we suspected a periodic similar transient activity on the Cg-type asteroid. However, unlike the main-belt primitive asteroids demonstrating sublimation of ices close to their perihelion distances, the effect on Ryugu was apparently registered near aphelion. To explain the difference, we calculated the subsolar temperature depending on heliocentric distance of the asteroids, considered qualitative models of internal structure of main-belt and near-Earth primitive asteroids including ice and performed some analytical estimations. Presumed temporal sublimation/degassing activity of Ryugu is a sign of a residual frozen core in its interior. This could be an indication of a relatively recent transition of the asteroid from the main asteroid belt to the near-Earth area.
Directory of Open Access Journals (Sweden)
Géraldine Arrode-Brusés
2016-06-01
Full Text Available Mucosal HIV-1 transmission is inefficient. However, certain viral and host characteristics may play a role in facilitating HIV acquisition and systemic expansion. Cells expressing high levels of integrin α4β7 have been implicated in favoring the transmission process and the infusion of an anti-α4β7 mAb (RM-Act-1 prior to, and during a repeated low-dose vaginal challenge (RLDC regimen with SIVmac251 reduced SIV acquisition and protected the gut-associated lymphoid tissues (GALT in the macaques that acquired SIV. α4β7 expression is required for lymphocyte trafficking to the gut lamina propria and gut inductive sites. Several therapeutic strategies that target α4β7 have been shown to be effective in treating inflammatory conditions of the intestine, such as inflammatory bowel disease (IBD. To determine if blocking α4β7 with ELN, an orally available anti-α4 small molecule, would inhibit SHIV-SF162P3 acquisition, we tested its ability to block MAdCAM-1 (α4β7 natural ligand and HIV-gp120 binding in vitro. We studied the pharmacokinetic profile of ELN after oral and vaginal delivery in macaques. Twenty-six macaques were divided into 3 groups: 9 animals were treated with ELN orally, 9 orally and vaginally and 8 were used as controls. All animals were challenged intra-vaginally with SHIV-SF162P3 using the RLDC regimen. We found that ELN did not protect macaques from SHIV acquisition although it reduced the SHIV-induced inflammatory status during the acute phase of infection. Notably, integrins can exist in different activation states and, comparing the effect of ELN and the anti-α4β7 mAb RM-Act-1 that reduced susceptibility to SIV infection, we determined that ELN induces the active conformation of α4β7, while RM-Act-1 inhibits its activation through an allosteric mechanism. These results suggest that inhibition of α4β7 activation may be necessary to reduce susceptibility to SIV/SHIV infection and highlight the complexity of anti
Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young
2017-10-19
Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4 g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.
Separation device of radio lanthanides (DISER)
International Nuclear Information System (INIS)
Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.
2008-01-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and
Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)
Energy Technology Data Exchange (ETDEWEB)
Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com
2008-07-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166
International Nuclear Information System (INIS)
Peterson, J.R.
1989-01-01
For some time the author has been using solid state absorption spectrophotometry to identify the crystal structure of selected transuranium (5f) and promethium (4f) compounds, based on spectral-structural correlations in his data base. More recently he has shown that Raman phonon spectroscopy is also very useful in this regard. These spectral probes of structure have their specific advantages and disadvantages; however, both are applicable to the structural characterization of radioactive compounds and can provide data for interpretation faster and more reliably than the commonly used X-ray powder diffraction method. The experimental methods, examples from the growing data bases, successes and limitations of these spectral probes of crystal structure, and some useful applications to the study of f-element compounds under varying conditions of temperature and pressure are presented
Sommer, A; Schopphoven, S; Land, I; Blaser, D; Sobczak, T
2014-05-01
As part of the physico-technical quality assurance of the German breast cancer screening program, the threshold contrast visibility and the average glandular dose of every digital mammography system have to fulfill the requirements of the "European guidelines for quality assurance in breast cancer screening and diagnosis" (4th Edition). To accomplish uniform measurements in all federal states of Germany, the physical board of the reference centers developed a special guideline in 2009. Due to recent changes in the guidelines and standards, a second version of the guideline was developed by the reference centers. This guideline describes the determination of the average glandular dose as well as the CDMAM image acquisition and the CDMAM image evaluation. The determination of the threshold contrast visibility can be performed visually or automatically. The determination of the average glandular dose is based on DIN 6868 - 162 and the threshold contrast visibility test is based on the German "Quality Assurance Guideline". © Georg Thieme Verlag KG Stuttgart · New York.
African Journals Online (AJOL)
ARTICLE. SAJCC August 2014, Vol. 30, No. 1. 5. The needs of patient family members in ..... has been done in all sectors to improve the quality of life after the .... Leske JS. Needs of relatives of critically ill patients: A follow-up. Heart Lung 1986 ...
African Journals Online (AJOL)
premature infants, children who died within 2 hours of admission, or children transferred .... [7] The mean difference in probability represented the bias in .... in terms of risk-adjusted mortality rates. ... The age and diagnostic category distribution.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'
African Journals Online (AJOL)
pc
mechanical properties of doped polyester fabric with aniline w s of various ... tion of the PANI solution rly constant up to ... computer interface and printer according to the AS. Figure 2: .... Material Systems and Structures, 23(17), pp. 1969-1986.
Directory of Open Access Journals (Sweden)
Ruth G. Biro
2017-09-01
Full Text Available Kandó-Melocco, Ferenc. 2015. An Anti-Nazi at Hitler's Table: Political Memoirs of a Hungarian Nobleman Who Dared to Oppose Both Hitler and the Communists. (trans. and ed. Esther Kando Odescalchi. North Charleston, SC: CreateSpace. 162 pp., Illus.; Odescalchi, Esther Kando. 2016. My Escape: Memoirs of a Hungarian Teenage Freedom Fighter. North Charleston, SC: CreateSpace. Illus. 148 pp.
International Nuclear Information System (INIS)
2010-03-01
After a recall of the project of stopping and dismantling of the hardware storage installation (INB n.162) which had been created after the stopping and dismantling of the Monts d'Arree heavy water nuclear reactor (INB n.28), this report analyzes the results of the public inquiry, and highlights the arguments of those in favour of this project and those opposed to it. Then, it states the Inquiry Commission's opinion which addresses the request for a national public debate, the project justification, the inquiry file, the site radiological status, the site radiological control during works, the impacts of dismantling, the various risks (for the population and the workers, in terms of fire risks), the issue of radioactive wastes, economic aspects (costs, jobs, local economy, tourism and site image), and site reconversion
Radioactive rare earths from fallout for study of particle movement in the sea
International Nuclear Information System (INIS)
Sugihara, Thomas T.; Bowen, Vaughan T.
1962-01-01
As part of an extensive study of the distribution of long-lived radionuclides from fallout in the Atlantic Ocean, a large number of measurements of cerium-144 and promethium-147 concentration have been made. Comparison of these concentrations as they vary both horizontally and vertically, with simultaneously measured concentrations of strontium-90, indicates that the rare earths are generally depleted in surface water, by comparison with the nuclides known to be soluble. This observation, coupled with frequent observation of rare-earth enrichment at depth, leads us to postulate rapid vertical transport of rare earths by attachment to particles undergoing sedimentation. This is completely plausible in terms of the 'radiocolloid' behaviour generally observed for rare earths at sea-water pH. An attempt is made to interpret this study in the overall picture of the marine geochemistry of the trivalent cations, as well as to emphasize the unique and generally useful aspects of the fallout tracer experiment. (author) [fr
Determination of stability constants of lanthanide complexes with tetracycline
International Nuclear Information System (INIS)
Saiki, Mitiko
1975-01-01
The stability constants of complexes compounds formed with tetracycline and lanthanides elements were determined for all lanthanides except promethium. The experimental procedure used was solvent extraction of the lanthanides labelled with their radioactive isotopes. It was shown that the formed complexes are mononuclear and that no hydroxo complexes or negatively charged complexes are formed in the experimental conditions of this work. Four methods of calculation were used for all complexes studied: the method of the average number of ligands, the method of limiting value, the method of two parameters and the method of weighted least squares. A comparison was made of the graphical methods with the method of least squares, showing the convenience of preceding least squares calculation by the graphical methods, in order to verify eventual mistakes of numerical data. It was shown the advantage of using radioisotopes of the elements for such a study, specially if the solvent extraction technique is used to-get the experimental data. (author)
Dosimetry in single lung cells by means of microautoradiographic activity measurements
International Nuclear Information System (INIS)
Kraus, W.
1976-01-01
After inhalation of compounds containing promethium-147 in the lungs of mice most of the activity was deposited in the form of local concentrations (hotspots). By means of a special quantitative microautoradiographic method using stripping film ORWO K 105, measurements of the activity of single hotspots of about 10 -14 Ci were possible. A microphotometer with a variable measuring diaphragm was used for the determination of the density profile of the autoradiographic image in order to get hotspot depth within the biological specimen. To determine hotspot activity it was necessary to calibrate the film with a Pm-147 plane source. The systematic and random errors of the method are discussed in detail, giving a total error of +- 21% (SD) for one hotspot activity measurement. A few examples of biological results obtained by the method are given. Simple models were used to calculate doses absorbed in macrophage and alveolar cell nuclei from the measured activities. (author)
Studies of photon spectra from a thallium-204 foil source as an aid to dosimetry and shielding
Francis, T M
1976-01-01
Beta ray foil sources incorporating nuclides such as thallium-204, promethium-147 and strontium-90 plus yttrium-90 ar increasingly used in industrial devices such as thickness gauges. These sources are so constructed that they give rise to complex photon spectra containing low energy Bremsstrahlung and X-rays characteristic of the constructional materials. The energy response of practical monitoring instruments is such that they are likely to underestimate the dose due to such spectra unless they are calibrated using appropriate spectra. This report describes a series of measurements carried out on a commercially available thallium-204 foil source and five commonly used shielding materials. The measurements made with a NaI(T1) spectrometer have been corrected for instrumental distortions to obtain the photon spectra in air. These spectra are presented and have been used to compute dose in air with the help of published data on mass energy-absorption coefficients. Also included in the report are data derived f...
Results of submerged sediment core sampling and analysis on Par Pond, Pond C, and L Lake: July 1995
International Nuclear Information System (INIS)
Koch, J.W. II; Martin, F.D.; Friday, G.P.
1996-06-01
Sediment cores from shallow and deep water locations in Par Pond, Pond C, and L Lake were collected and analyzed in 1995 for radioactive and nonradioactive constituents. This core analysis was conducted to develop a defensible characterization of contaminants found in the sediments of Par Pond, Pond C, and L Lake. Mercury was the only nonradiological constituent with a nonestimated quantity that was detected above the U.S Environmental Protection Agency Region IV potential contaminants of concern screening criteria. It was detected at a depth of 0.3--0.6 meters (1.0--2.0 feet) at one location in L Lake. Cesium-137, promethium-146, plutonium-238, and zirconium-95 had significantly higher concentrations in Par Pond sediments than in sediments from the reference sites. Cobalt-60, cesium-137, plutonium-238, plutonium-239/240, and strontium-90 had significantly higher concentrations in L-Lake sediments than sediments from the reference sites
DEFF Research Database (Denmark)
Christoffersen, Peter Woetmann
2015-01-01
MS Amiens 162 was made in Paris in 1502 in cooperation between a professional music copyist and the young monk Antoine de Caulaincourt. The MS contained simple polyphony for funerals and commemorative services, and it was to be used in a confraternity, Confrérie Ste Barbe, at the big Benedictine...... the ideas of a new age, fought with arguments as well as violence. A bold move to bolster its position was the demolition of the abbey’s old main church and starting the building of a vast new one in 1502. The founding of the confraternity and the ordering of the music manuscript in Paris were probably...... deliverate moves to ensure local support for the building project. The MS offers music whose sound may compare with contemporary art music in fullness and solemnity, but monks who were neither able to read modern mensural notation nor improvise simple polyphony could perform it. Their competence in singing...
DEFF Research Database (Denmark)
Wessel, I; Jensen, L H; Jensen, P B
1999-01-01
in expression of the beta isoform. Sequencing of the entire topoisomerase IIalpha cDNA from NYH/187 cells demonstrated a homozygous G-->A point mutation at nucleotide 485, leading to a R162Q conversion in the Walker A consensus ATP binding site (residues 161-165 in the alpha isoform), this being the first drug......-selected mutation described at this site. Western blotting after incubation with ICRF-187 showed no depletion of the alpha isoform in NYH/187 cells in contrast to wild-type (wt) cells, whereas equal depletion of the beta isoform was observed in the two sublines. Alkaline elution assay demonstrated a lack...... of inhibition of etoposide-induced DNA single-stranded breaks in NYH/187 cells, whereas this inhibition was readily apparent in NYH cells. Site-directed mutagenesis in human topoisomerase IIalpha introduced into a yeast Saccharomyces cerevisiae strain with a temperature-conditional yeast TOP2 mutant...
The Danish Air Quality Monitoring Programme
DEFF Research Database (Denmark)
Ellermann, Thomas; Nøjgaard, Jacob Klenø; Nordstrøm, Claus
Aarhus University, DCE – Danish Centre for Environment and Energy, 64 pp. Scientific Report from DCE – Danish Centre for Environment and Energy No. 162. http://dce2.au.dk/pub/SR162.pdf......Aarhus University, DCE – Danish Centre for Environment and Energy, 64 pp. Scientific Report from DCE – Danish Centre for Environment and Energy No. 162. http://dce2.au.dk/pub/SR162.pdf...
2010-01-01
... appreciation. (2) The value appreciation of property with a cross-collateralized loan is based on the market... are due and payable when the borrower transfers title or ceases to occupy the property. (b) Amount to... family housing property. (3) Interest reduced from the promissory note rate to six percent under the...
2010-01-01
... waters of the Atlantic Ocean, Caribbean, or Gulf of Mexico without passive or active introduction to such... animal and plant life other than marine mammals and birds. Fishing means: (1) The catching, taking, or...
42 CFR 81.23 - Guidelines for cancers for which primary site is unknown.
2010-10-01
...), 189 (M). Brain and spinal cord (198.3) 162, 172 (M), 174 (F). Other parts of nervous system (198.4) 162, 172 (M), 174 (F), 185 (M), 202. Bone and bone marrow (198.5) 162, 174 (F), 185 (M). Ovary (198.6...
Astronomy Matters for Chemistry Teachers
Huebner, Jay S.; Vergenz, Robert A.; Smith, Terry L.
1996-11-01
The purpose of this paper is to encourage more chemistry teachers to become familiar with some of the basic ideas described in typical introductory astronomy courses (1 - 9), including those about the origin of elements and forms of matter. These ideas would enrich chemistry courses and help resolve some basic misconceptions that are expressed in many introductory texts (10 - 16) and journal articles for chemistry teachers (17, 18). These misconceptions are typified by statements such as "we can classify all substances as either elements or compounds," and "nature has provided 92 elements out of which all matter is composed." If students accept these misconceptions, they could be deprived of (i) an appreciation of the history of elements and knowing that the elemental composition of the universe continues to evolve, (ii) knowing that of the first 92 elements in the periodic table, technetium and promethium do not occur naturally on Earth, and (iii) understanding that there are forms of matter other than elements and compounds. This paper briefly explores these ideas.
International Nuclear Information System (INIS)
Herbert, R.A.; Scott, B.R.; Hahn, F.F.; Newton, G.J.; Snipes, M.B.; Damon, E.G.; Boecker, B.B.
1988-01-01
To determine the biological response following low-energy, beta irradiation of the lung, F344/Crl rats were exposed to aerosols of promethium-147 in fused aluminosilicate particles and observed for their life spans. Radiation pneumonitis and pulmonary fibrosis caused the majority of deaths during the first year after exposure with cumulative doses to the lungs of 210 to 630 Gy. Primary pulmonary neoplasms were responsible for the majority of deaths that occurred beyond 1 yr after exposure and in rats receiving lower cumulative doses to the lung. Hemangiosarcomas and squamous cell carcinomas were the most prevalent pulmonary neoplasms. Three adenocarcinomas were found. The uncorrected crude incidence of primary lung tumors increased with increasing dose to the lung for cumulative doses less than 140 Gy. With higher doses, the incidence declined. Adjusting the data for competing risks eliminated the turnover in the dose-response curve. The times of onset of pulmonary tumors and median survival times were dose-dependent. Rats with higher accumulated radiation doses developed fatal lung tumors at earlier times after exposure. (author)
García Carrillo, Mercedes; Ferrario, Mariana; Guerrero, Sandra
2018-08-01
The aim of this study was to analyze the effectiveness of UV-C light (0-10.6 kJ/m 2 ) assisted by mild heat treatment (50 °C) on the inactivation of Saccharomyces cerevisiae KE 162 in peptone water and fresh carrot-orange juice blend (pH: 3.8; 9.8°Brix; 707 NTU; absorption coefficient: 0.17 cm -1 ). Yeast induced damage by single UV-C and mild heat (H) and the combined treatment UV-C/H, was investigated by flow cytometry (FC) and transmission electron microscopy (TEM). When studying induced damage by FC, cells were labeled with fluorescein diacetate (FDA) and propidium iodide (PI) to monitor membrane integrity and esterase activity. UV-C/H provoked up to 4.7 log-reductions of S. cerevisiae; whereas, only 2.6-3.3 log-reductions were achieved by single UV-C and H treatments. FC revealed a shift with treatment time from cells with esterase activity and intact membrane to cells with permeabilized membrane. This shift was more noticeable in peptone water and UV-C/H treated juice. In the UV-C treated juice, double stained cells were detected, suggesting the possibility of being sub-lethally damaged, with compromised membrane but still metabolically active. TEM images of treated cells revealed severe damage, encompassing coagulated inner content, disorganized lumen and cell debris. FC and TEM provided additional information regarding degree and type of damage, complementing information revealed by the traditional plate count technique. Copyright © 2018 Elsevier Ltd. All rights reserved.
46 CFR 162.050-3 - Definitions.
2010-10-01
... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... monitoring and control system that is designed to measure the oil content of cargo residues from cargo tanks and oily mixtures combined with these residues. PPM means parts per million by volume of oil in water...
21 CFR 133.162 - Neufchatel cheese.
2010-04-01
... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... which produces a finished cheese having the same physical and chemical properties. The milkfat content... this section is subjected to the action of a harmless lactic acid-producing bacterial culture, with or...
34 CFR 668.162 - Requesting funds.
2010-07-01
... Secretary, the Secretary may provide funds to an institution under the advance, reimbursement, just-in-time, or cash monitoring payment methods. (2) Each time an institution requests funds from the Secretary... received those funds. (c) Just-in-time payment method. Under the just-in-time payment method— (1) For each...
46 CFR 162.028-3 - Requirements.
2010-10-01
... cutting, forming, and bending operations are completed, are considered to provide suitable corrosion... points of contact or close proximity of dissimilar metals; (iv) The extinguisher and its bracket, if any... examined and tested to establish its reliability and effectiveness in accordance with the intent of this...
2010-10-01
... best quality spring steel consistent with the design of the valve and the service requirement. [CGFR 52... materials melting above 1700 °F. for liquefied flammable gas service. Consideration of lower melting materials for internal pressure-containing parts will be given if their use provides significant improvement...
Vegetation - Suisun Marsh 2003 [ds162
California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...
2010-04-01
... the cost of acquisition or production or the gain or loss basis of the taxpayer's plant, equipment, or other property, as the case may be, is not increased by the amount of such expenditures. Repairs in the... incidental repairs which neither materially add to the value of the property nor appreciably prolong its life...
Plasma Separation Process: Betacell (BCELL) code: User's manual. [Bipolar barrier junction
Energy Technology Data Exchange (ETDEWEB)
Taherzadeh, M.
1987-11-13
The emergence of clearly defined applications for (small or large) amounts of long-life and reliable power sources has given the design and production of betavoltaic systems a new life. Moreover, because of the availability of the plasma separation program, (PSP) at TRW, it is now possible to separate the most desirable radioisotopes for betacell power generating devices. A computer code, named BCELL, has been developed to model the betavoltaic concept by utilizing the available up-to-date source/cell parameters. In this program, attempts have been made to determine the betacell energy device maximum efficiency, degradation due to the emitting source radiation and source/cell lifetime power reduction processes. Additionally, comparison is made between the Schottky and PN junction devices for betacell battery design purposes. Certain computer code runs have been made to determine the JV distribution function and the upper limit of the betacell generated power for specified energy sources. A Ni beta emitting radioisotope was used for the energy source and certain semiconductors were used for the converter subsystem of the betacell system. Some results for a Promethium source are also given here for comparison. 16 refs.
Technology for recovery of by-products
International Nuclear Information System (INIS)
Van Tuy, H.H.
1983-01-01
Products of conventional nuclear fuel processing plants are uranium and plutonium, and any other recovered material is considered to be a by-product. Some by-products have been recovered from past nuclear fuel processing operations, either as a normal mode of operation or by special campaigns. Routing recovery over an extended period has been limited to neptunium, but extended campaigns were used at Hanford to recover strontium for radioisotope thermoelectric generators. Krypton is recovered at Idaho Chemical Processing Plant on a campaign basis, and isotope separation of krypton is done at Oak Ridge National Laboratory. Past campaigns at Hanford PUREX have recovered cesium, promethium, amercium, cerium, and technetium. Past by-product recovery efforts were usually severely constrained by the status of flowsheet development and availability of existing facilities at the time decisions wee made to recover the by-products. Additional processes were developed to accommodate other unit operations and in response to changes in waste management objectives or user requirements. Now an impressive variety of recovery technology is available for most potential by-products, with varying degrees of demonstration under conditions which satisfy today's environmental protection and waste management constraints
Energy Technology Data Exchange (ETDEWEB)
Martinelli, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires; Seibel, G [Institut de Recherches de la Siderurgie, 78 - Saint-Germain-en-Laye (France)
1960-07-01
The process for analysing and measuring the thickness of deposits by {beta}-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [French] Le procede d'analyse et de mesure des epaisseurs de depots par fluorescence {beta}-X que nous avons precedemment decrit a fait l'objet de nouveaux developpements. L'emploi de sources de prometheum-147 et de krypton-85 permet de reduire le bruit de fond que l'on observe avec le strontium-90. Nous dormons les resultats obtenus pour diverses mesures d'epaisseurs de depots metalliques et la mesure en continu du calcium et du fer dans les carottes de minerais. Nous decrivons les essais effectues en vue d'analyser le rayonnement X au moyen d'un cristal. (auteur)
International Nuclear Information System (INIS)
Ammerich, M.
2009-01-01
This article goes back over the incidents occurring during the summer 2008, that is to say the uranium release from the Socatri facility in the South of France. From this point, the purpose studies the radiological situation of the Camargue seashore; the levels of radioactivity are from 3 to thirty times higher than these ones expected in this area, but the natural radioactivity with thorium and uranium coming from the granitic massifs erosion brings an important part. It is difficult to make the part between human and natural contribution to ambient radioactivity. However, it appears that to limit the water consumption until the time of dilution played its part was absolutely necessary. Then, because it is question of water, the drinking water is tackled. Some mineral waters go over the recommended limits of doses. A last return to the past with the radioactive watches, but this time with actual watches that activate detection. Two watches contained promethium 147, 147 Pm is a beta emitter but also gamma emitter. To end, in Ireland and Great Britain, some fire detectors contain americium 241. In fact, this article constitutes a summary of different abnormalities around radioactivity. (N.C.)
Advanced Processing for Biomedical Informatics (APBI)
2009-10-01
pothetical gene CG018 CG018 90634 1.62E-06 4.16E-05 7.21 4.81 -5.3 203881_s_at dystrophin (muscular dystrophy , Duchenne and Becker types) DMD 1756 1.93E-06...fundus dystrophy , pseudoinflammatory) TIMP3 7078 1.62E-06 4.16E-05 10.96 8.63 -5.0 1563466_at myosin, light chain kinase MYLK 4638 1.62E-06 4.16E-05
Liu, Jun'e; Wang, Zhanli; Li, Yuanyuan
2017-12-22
Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162) on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m²), three rainfall intensities (1, 1.5 and 2 mm/min) and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S.
Directory of Open Access Journals (Sweden)
Jun’e Liu
2017-12-01
Full Text Available Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162 on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m2, three rainfall intensities (1, 1.5 and 2 mm/min and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S.
Liu, Jun’e; Wang, Zhanli; Li, Yuanyuan
2017-01-01
Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162) on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m2), three rainfall intensities (1, 1.5 and 2 mm/min) and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S. PMID:29271899
1998-12-01
Bromoform Bromomethane iso -Butanol n-Butanol 2-Butanone n-Butylbenzene sec-Butylbenzene tert-Butylbenzene Carbon disulfide Carbon tetrachloride...1994 TABLE 10 DIRECT INJECTION .ANALYSIS OF NEW OIL AT 5 PPM Compound Acetone Benzene n-Butanol*,** iso -Butanol*,** Carbon tetrachlorid Carbon...Sediment 48.0 48.0 2977 16.2 Autocl.sediment 53.7 2.7 15.7 11.0 83.1 12755 16.2 Gravel 53.1 6.8 7.8 8.7 76.4 8583 16.2 Autocl.gravel 11.0 7.7
Genetics Home Reference: Omenn syndrome
... immunodeficiency. Front Immunol. 2014 Apr 22;5:162. doi: 10.3389/fimmu.2014.00162. Erratum in: Front ... immunodeficiency. Front Immunol. 2014 Apr 22;5:162. doi: 10.3389/fimmu.2014.00162. Erratum in: Front ...
Czech Academy of Sciences Publication Activity Database
Antolíková, Emília; Žáková, Lenka; Jiráček, Jiří
2010-01-01
Roč. 16, S1 (2010), s. 162-162 ISSN 1075-2617. [European Peptide Symposium /31./. 05.09.2010-09.09.2010, Copenhagen] Institutional research plan: CEZ:AV0Z40550506 Keywords : insulin * insulin analogues * diabetes Subject RIV: CC - Organic Chemistry
24 CFR 891.685 - Prohibited relationships.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Prohibited relationships. 891.685... and Individuals-Section 162 Assistance § 891.685 Prohibited relationships. The requirements for prohibited relationships for 202/162 projects are provided in § 891.130. ...
162. Seguimiento de pacientes cardiovasculares por telemedicina
Directory of Open Access Journals (Sweden)
I. Díaz de Tuesta Revilla
2010-01-01
Conclusiones: Sin costes adicionales para un hospital razonablemente informatizado, la telemedicina ahorra tiempo, mejora el acceso al especialista, adelanta decisiones y evita desplazamientos para trivialidades. Mejora la calidad. Es el futuro en la toma de decisiones.
26 CFR 1.162-29 - Influencing legislation.
2010-04-01
...) Reading any publications available to the general public or viewing or listening to other mass media... lobbying communication; and (ii) All activities, such as research, preparation, planning, and coordination, including deciding whether to make a lobbying communication, engaged in for a purpose of making or...
Search Results | Page 162 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Islamist Parties and Democratization : Lessons from Turkey's Justice and Development Party. The Turkish elections of November 2002 brought a new Islamic-oriented political party to power, with almost two-thirds of the seats in Parliament. Project ...
7 CFR 1786.162 - Outstanding loan documents.
2010-01-01
... outstanding notes issued to RUS, and the RUS Mortgage. (b) Nothing in this subpart shall affect any rights of... shall prohibit a borrower from making prepayments of any loans pursuant to the RE Act in accordance with...
26 CFR 1.162-2 - Traveling expenses.
2010-04-01
... traveling expenses as are reasonable and necessary in the conduct of the taxpayer's business and directly... expenses. If the trip is solely on business, the reasonable and necessary traveling expenses, including travel fares, meals and lodging, and expenses incident to travel, are business expenses. For the...
African Journals Online (AJOL)
userpc
Department of Chemistry, Fede baffasma@gmail. ABSTRACT. This research is aimed at titrimetric det collected from boreholes and irrigation ch. Nigeria. Twenty three samples were random the samples was determined immediately was determined using Flame Absorption concentration of Arsenic from boreholes in t.
Rare-earth metal prices in the USA ca. 1960 to 1994
Hedrick, James B.
1997-01-01
Rare-earth metal prices were compiled from the late 1950s and early 1960s through 1994. Although commercial demand for rare-earth metals began in 1908, as the alloy mischmetal, commercial quantities of a wide range of individual rare-earth metals were not available until the late 1950s. The discovery of a large, high-grade rare-earth deposit at Mountain Pass. CA, USA, in 1949, was significant because it led to the production of commercial quantities or rare-earth elements that reduced prices and encouraged wider application of the materials. The availability of ore from Mountain Pass, and other large rare-earth deposits, especially those in Australia and China, has provided the world with abundant resources for rare-earth metal production. This availability, coupled with improved technology from Government and private-sector metallurgical research, has resulted in substantial decreases in rare-earth metal prices since the late 1950s and early 1960s. Price series for the individual rare-earth metals (except promethium) are quoted on a kilogram basis from the late 1950s and early 1960s through 1994. Prices are given in US dollars on an actual and constant dollar basis. Industrial and economic factors affecting prices during this time period are examined.
1981-01-01
SCIENCE & TECH 162 - UNITED KINGDOM MINISTRY OF DEFENCE 2,670 - UN KINGDOM 162 UN KINGDOM 2,670 INSTITUT FUER ATMOSPHAERISCHE 25 - UNIVERSITE RENE ... DESCARTES 10 - GERMANY 25 FRANCE 10 INVERESK RESEARCH INTERNATIONAL 106 - 8,602 UN KINGDOM 106 ISRAEL INSTITUTE OF TECHNOLOGY 55 - ISRAEL 55 KEELE UNIVERSITY
Measurement of formation cross sections of short-lived nuclei by 14 MeV neutron. Nd, Sm, Dy, Er, Yb
Energy Technology Data Exchange (ETDEWEB)
Sakane, H.; Yamamoto, H.; Kawade, K. [Nagoya Univ. (Japan). School of Engineering; Iida, T.; Takahashi, A.
1997-03-01
Eight neutron activation cross sections producing the nuclei with half-lives between 3 min and 24 min were obtained at the energy range between 13.4 and 14.9 MeV by activation method. The cross sections were {sup 146}Nd(n,p){sup 146}Pr, {sup 154}Sm(n,{alpha}){sup 151}Nd, {sup 162}Dy(n,p){sup 162}Tb, {sup 163}Dy(n,np){sup 162}Tb, {sup 163}Dy(n,p){sup 163}Tb, {sup 164}Dy(n,p){sup 164}Tb, {sup 170}Er(n,{alpha}){sup 167}Dy, {sup 174}Yb(n,p){sup 170}Tm. {sup 163}Dy(n,np){sup 162}Tb (T{sub 1/2}=7.7 min) was obtained for the first time. Present results are compared with previous results and the evaluated data of JENDL-3 and ENDF/B-VI. There are some discrepancies between present results and the JENDL-3 and ENDF/B-VI. (author)
Directory of Open Access Journals (Sweden)
Okorie E. Okorie
2014-01-01
Full Text Available This feeding trial was carried out to evaluate the effects of different dietary cadmium levels on growth and tissue cadmium content in juvenile parrotfish, Oplegnathus fasciatus, using cadmium chloride (CdCl2 as the cadmium source. Fifteen fish averaging 5.5±0.06 g (mean±SD were randomly distributed into each of twenty one rectangular fiber tanks of 30 L capacity. Each tank was then randomly assigned to one of three replicates of seven diets containing 0.30 (C0, 21.0 (C21, 40.7 (C41, 83.5 (C83, 162 (C162, 1,387 (C1,387 and 2,743 (C2,743 mg cadmium/kg diet. At the end of sixteen weeks of feeding trial, weight gain (WG, specific growth rate (SGR and feed efficiency (FE of fish fed C21 were significantly higher than those of fish fed C83, C162, C1,387 and C2,743 (p<0.05. Weight gain, SGR and FE of fish fed C0, C21 and C41 were significantly higher than those of fish fed C162, C1,387 and C2,743. Protein efficiency ratio of fish fed C0, C21 and C41 were significantly higher than those of fish fed C1,387 and C2,743. Average survival of fish fed C0, C21, C41 and C162 were significantly higher than that of fish fed C2,743. Tissue cadmium concentrations increased with cadmium content of diets. Cadmium accumulated the most in liver, followed by gill and then muscle. Muscle, gill and liver cadmium concentrations of fish fed C0, C21, C41 and C83 were significantly lower than those of fish fed C162, C1,387 and C2,743. Based on the ANOVA results of growth performance and tissue cadmium concentrations the safe dietary cadmium level could be lower than 40.7 mg Cd/kg diet while the toxic level could be higher than 162 mg Cd/kg diet.
Stemcell Information: SKIP000949 [SKIP Stemcell Database[Archive
Lifescience Database Archive (English)
Full Text Available SKIP000949 ... dermal fibroblast 表皮繊維芽細胞 Diseased SP16.2 SP16.2 ... パーキンソン病 G20 Parkinson...s of genetic and sporadic Parkinson's disease. Sanchez-Danes A, Richaud-Patin Y, Carballo-Carbajal I, Jimene
X-Ray Photoionized Bubble in the Wind of Vela X-1 Pulsar Supergiant Companion
Czech Academy of Sciences Publication Activity Database
Krtička, J.; Kubát, Jiří; Skalický, J.
2012-01-01
Roč. 757, č. 2 (2012), 162/1-162/6 ISSN 0004-637X R&D Projects: GA ČR GA205/08/0003 Institutional support: RVO:67985815 Keywords : hydrodynamics * radiative transfer * early-type stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.733, year: 2012
DEFF Research Database (Denmark)
Hallund, Jesper; Tetens, Inge; Bugel, S.
2008-01-01
the lignan complex intervention period compared with 0.80 (0.62, 1.62) mg/L at baseline and 1.10 (0.72, 1.62) mg/L after placebo. No significant differences in interleukin-6, tumor necrosis factor-alpha, soluble intracellular adhesion motecule-1, soluble vascular cell adhesion molecule-1, and monocyte...
46 CFR 38.10-15 - Safety relief valves-TB/ALL.
2010-10-01
.... plus the maximum flow rate of the cargo filling pipes or, (2) The vapors generated under fire exposure..., constructed and flow tested for capacity in conformance with subpart 162.017 or 162.018 of subchapter Q... excessive external pressure. (f) Void spaces between the primary and secondary barriers of nonpressure...
77 FR 74546 - Posting of Pamphlet Provided for in the International Marriage Broker Regulation Act
2012-12-14
... Marriage Broker Regulation Act ACTION: Notice of posting of pamphlet provided for in section 833(a) of the International Marriage Broker Regulation Act, Title D of Public Law 109-162. SUMMARY: Section 833(a) of the International Marriage Broker Regulation Act, Title D of Public Law 109-162, provided that the Secretary of...
Predikce rizika vzniku přívalové povodně s využitím dat meteorologických radarů
Czech Academy of Sciences Publication Activity Database
Rapant, P.; Kolejka, Jaromír; Inspektor, T.
2016-01-01
Roč. 50, č. 3 (2016), s. 162-166 ISSN 0044-4863 R&D Projects: GA MV VG20132015106 Institutional support: RVO:68145535 Keywords : flash floods * prediction * weather radar * early warning Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://147.213.211.222/sites/ default /files/2016_3_162_166_Rapant_a_kol.pdf
Czech Academy of Sciences Publication Activity Database
Kříbek, B.; Majer, V.; Bezuško, Petr; Pašava, J.; Adamovič, Jiří; Nyambe, I.; Liyungu, K.; Chibesakunda, F.
2007-01-01
Roč. 2006, - (2007), s. 160-162 ISSN 0514-8057 R&D Projects: GA AV ČR KSK3012103 Institutional research plan: CEZ:AV0Z30130516; CEZ:AV0Z30860518 Keywords : contamination * heavy metals * soils Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2006/2006-str.160-162.pdf
Constructing two new crystalline metal–organic frameworks based on a mixed-donor ligand
Wang, Xiaofang; Xue, Ming; Wu, Gang; Pan, Ying; Qiu, Shilun
2016-01-01
© 2015 Elsevier B.V. All Rights Reserved. The self-assembly of a prominent ligand, 5-(4-(1H-tetrazolyl)phen)isophthalic acid (H3TZPI), with Zn2 +/Cu2 + centres generates two new MOFs, [Zn2(TZPI)(μ3-OH)(H2O)2]·2H2O (JUC-161) and [Cu(HTZPI)(μ2-H2O)0.5(H2O)1.5]·5(H2O) (JUC-162). JUC-161 exhibits fascinating three-dimensional structures containing rectangular channels with dimensions of 6.5 × 3.0 Å2, and JUC-162 displays 3D supramolecular structures with 12.5 × 14.6 Å2 hexagonal channels. The observed structural diversity in these frameworks is due to the two distinct coordinating moieties of the H3TZPI ligand. The photoluminescence of JUC-161 and the magnetic properties of JUC-162 are also measured at room temperature. Photoluminescence investigations reveal that JUC-161 displays a strong main emission spectrum peak at 388 nm. JUC-162 is found to exhibit an antiferromagnetic interaction between Cu2 + ions.
Constructing two new crystalline metal–organic frameworks based on a mixed-donor ligand
Wang, Xiaofang
2016-02-01
© 2015 Elsevier B.V. All Rights Reserved. The self-assembly of a prominent ligand, 5-(4-(1H-tetrazolyl)phen)isophthalic acid (H3TZPI), with Zn2 +/Cu2 + centres generates two new MOFs, [Zn2(TZPI)(μ3-OH)(H2O)2]·2H2O (JUC-161) and [Cu(HTZPI)(μ2-H2O)0.5(H2O)1.5]·5(H2O) (JUC-162). JUC-161 exhibits fascinating three-dimensional structures containing rectangular channels with dimensions of 6.5 × 3.0 Å2, and JUC-162 displays 3D supramolecular structures with 12.5 × 14.6 Å2 hexagonal channels. The observed structural diversity in these frameworks is due to the two distinct coordinating moieties of the H3TZPI ligand. The photoluminescence of JUC-161 and the magnetic properties of JUC-162 are also measured at room temperature. Photoluminescence investigations reveal that JUC-161 displays a strong main emission spectrum peak at 388 nm. JUC-162 is found to exhibit an antiferromagnetic interaction between Cu2 + ions.
Zang, Xinshan; Geng, Xiaoli; Liu, Kelu; Wang, Fei; Liu, Zhenshan; Zhang, Liyuan; Zhao, Yue; Tian, Xuejun; Hu, Zhaorong; Yao, Yingyin; Ni, Zhongfu; Xin, Mingming; Sun, Qixin; Peng, Huiru
2017-05-01
Abiotic stresses, such as heat and drought, are major environmental factors restricting crop productivity and quality worldwide. A plastid outer envelope protein gene, TaOEP16-2, was identified from our previous transcriptome analysis [1,2]. In this study, the isolation and functional characterization of the TaOEP16-2 gene was reported. Three homoeologous sequences of TaOEP16-2 were isolated from hexaploid wheat, which were localized on the chromosomes 5A, 5B and 5D, respectively. These three homoeologues exhibited different expression patterns under heat stress conditions, TaOEP16-2-5B was the dominant one, and TaOEP16-2-5B was selected for further analysis. Compared with wild type (WT) plants, transgenic Arabidopsis plants overexpressing the TaOEP16-2-5B gene exhibited enhanced tolerance to heat stress, which was supported by improved survival rate, strengthened cell membrane stability and increased sucrose content. It was also found that TaOEP16-2 was induced by drought stress and involved in drought stress tolerance. TaOEP16-2-5B has the same function in ABA-controlled seed germination as AtOEP16-2. Our results suggest that TaOEP16-2-5B plays an important role in heat and drought stress tolerance, and could be utilized in transgenic breeding of wheat and other crop plants. Copyright © 2017 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Palagonia, M. S.; Němcová, A.; Kuběna, Ivo; Šmíd, Miroslav; Gao, S.; Liu, H.; Zhong, X. L.; Haigh, S. J.; Santamaria, M.; Di Quarto, F.; Habazaki, H.; Skeldon, P.; Thomson, G.
2015-01-01
Roč. 162, č. 9 (2015), C487-C494 ISSN 0013-4651 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : alloying element * anodizing * ion beam analysis * magnesium * TEM Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 3.014, year: 2015 http://jes.ecsdl.org/content/162/9/C487.full
46 CFR 162.050-5 - Contents of application.
2010-10-01
... control procedures, in-process and final inspections and tests followed in manufacturing the item, and construction and sales record keeping systems maintained. (4) Arrangement drawings and piping diagrams of the... containing detailed and easily understandable instructions on installation, operation, calibration, zeroing...
40 CFR 162.154 - Disapproval of State registrations.
2010-07-01
... unreasonable adverse effects on man or the environment by the registered use. (ii) Refusal of the registering... (b)(1) of this section, the Administrator will make a final decision on disapproval of a State... days of its effective date, then the Administrator will make a final decision on disapproval within 90...
What we do | Page 162 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... valuable decision support information is vital to the delivery of effective health services. ... The IDRC program initiative, Acacia (communities and the information ... is characterized by great socioeconomic diversity and strong social networks ...
Lifescience Database Archive (English)
Full Text Available mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus par...adoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle
26 CFR 1.162-13 - Depositors' guaranty fund.
2010-04-01
... carried to the credit of the State banking board or duly authorized State officer, ceases to be an asset of the bank and may be withdrawn in whole or in part upon demand by such board or State officer to... deductible except as it is actually paid out as required by law and upon demand of the proper State officers. ...
47 CFR 36.162 - Intangible assets-Account 2690.
2010-10-01
... costs of organizing and incorporating the company, franchises, patent rights, and other intangible... the operations on the basis of the separation of the cost of Telecommunications Plant In Service...
South of Sahara | Page 162 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Our research program for the region dovetails with The World Economic Forum's Survey on the Global Agenda, which revealed sub-Saharan Africa's most pressing challenges: education and skills development, building sustainable governance systems, and delivering hard infrastructure. Working closely with researchers ...
26 CFR 1.162-21 - Fines and penalties.
2010-04-01
... country; or (3) A political subdivision of, or corporation or other entity serving as an agency or... (felony or misdemeanor) in a criminal proceeding; (ii) Paid as a civil penalty imposed by Federal, State... potential liability for a fine or penalty (civil or criminal); or (iv) Forfeited as collateral posted in...
7 CFR 993.162 - Voluntary prune plum diversion.
2010-01-01
... SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE DRIED... production/dehydration characteristics. The addition of a county or counties, as the case may be, to one of...
Czech Academy of Sciences Publication Activity Database
Pytelková, Jana; Hubert, J.; Lepšík, Martin; Šobotník, Jan; Šindelka, Radek; Křížková, I.; Horn, Martin; Mareš, Michael
2009-01-01
Roč. 276, Suppl. 1 (2009), s. 162-162 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA ČR GP525/09/P600; GA AV ČR IAA400550617 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50520701 Keywords : Ephestia kuehniella * alpha amylase * alkaline adaptation Subject RIV: CE - Biochemistry
Job satisfaction among secondary school teachers in Tanzania : the case of Njombe district
Ngimbudzi, Fredy Wilson
2009-01-01
The purpose of this study is to examine the factors that are associated with teachers‟ job satisfaction. A study sample of 162 (N=162) teachers was surveyed. The descriptive statistics techniques revealed that teachers are satisfied with aspects under the following dimensions: social benefits, meaningfulness of the job and support from administration. Conversely, the teachers indicated they are least satisfied with the aspects under the job characteristics dimension. Additionally, the inde...
Chia, Phee-Phee; Fan, Sook-Ha; Say, Yee-How
2015-11-05
This study aimed to investigate the association of peroxisome proliferator-activated receptor (PPAR) genes PPARα L162V, PPARγ2 C161T and PPARδ T294C single nucleotide polymorphisms (SNPs) with obesity and metabolic syndrome (Met-S) in a multi-ethnic population in Kampar, Malaysia. Socio-demographic data, anthropometric and biochemical measurements (plasma lipid profile, adiponectin and interleukin-6 [IL-6] levels) were taken from 307 participants (124 males; 180 obese; 249 Met-S; 97 Malays, 85 ethnic Chinese, 55 ethnic Indians). The overall minor allele frequencies were .08, .22 and .30 for PPAR α L162V, γ C161T, δ T294C, respectively. All SNPs were not associated with obesity, Met-S and obesity with/without Met-S by χ(2) analysis, ethnicity-stratified and logistic regression analyses. Nevertheless, participants with V162 allele of PPARα had significantly higher IL-6, while those with T161 allele of PPARγ2 had significantly lower HOMA-IR. All PPAR SNPs were not associated with obesity and Met-S in the suburban population of Kampar, Malaysia, where only PPARα V162 and PPARγ2 T161 alleles were associated with plasma IL-6 and HOMA-IR, respectively.
Measuring capital market efficiency: long-term memory, fractal dimension and approximate entropy
Czech Academy of Sciences Publication Activity Database
Krištoufek, Ladislav; Vošvrda, Miloslav
2014-01-01
Roč. 87, č. 7 (2014), "162-1"-"162-9" ISSN 1434-6028 R&D Projects: GA ČR(CZ) GBP402/12/G097 EU Projects: European Commission(XE) FP7/2007-2013 Program:FP7 Institutional support: RVO:67985556 Keywords : Statistical and Nonlinear Physics * fractal dimension * stock market efficiency Subject RIV: AH - Economics Impact factor: 1.345, year: 2014 http://library.utia.cas.cz/separaty/2014/E/kristoufek-0431151.pdf
Numerical analysis of a hypersonic turbulent and laminar flow using a commercial CFD solver
Pajčin Miroslav P.; Simonović Aleksandar M.; Ivanov Toni D.; Komarov Dragan M.; Stupar Slobodan N.
2017-01-01
Computational fluid dynamics computations for two hypersonic flow cases using the commercial ANSYS FLUENT 16.2 CFD software were done. In this paper, an internal and external hypersonic flow cases were considered and analysis of the hypersonic flow using different turbulence viscosity models available in ANSYS FLUENT 16.2 as well as the laminar viscosity model were done. The obtained results were after compared and commented upon. [Project of the Serbian Ministry of Education, Science and Tec...
No cases of perioperative allergy to local anaesthetics in the Danish Anaesthesia Allergy Centre
DEFF Research Database (Denmark)
Kvisselgaard, A D; Krøigaard, M; Mosbech, H F
2017-01-01
BACKGROUND: Local anaesthetics (LA) are often suspected as possible causes of allergic reactions. The Danish Anaesthesia Allergy Centre (DAAC) is the national reference centre for investigation of perioperative allergic reactions. The purpose of this study was to investigate the incidence of Ig......E-mediated immediate type perioperative allergic reactions to LA. METHODS: In the period 2004-2013, a total of 409 patients (244 women/165 men; median age 49 years, range 1-86 years) were investigated in DAAC on suspicion of allergy associated with anaesthesia and surgery. A total of 162 (40%) patients were exposed...... were carried out on 162 patients (89 women/73 men; mean age 49 years, range 2-85 years) with the following drugs: Lidocaine n = 80 (49%), bupivacaine n = 82 (51%), ropivacaine n = 31 (19%) and mepivacaine n = 10 (6%). All 162 patients had negative subcutaneous provocation for all tested LA (95% CI: 0...
Piao, Chenyu; Zheng, Weiwei; Li, Yao; Liu, Chongxi; Jin, Liying; Song, Wei; Yan, Kai; Wang, Xiangjing; Xiang, Wensheng
2017-09-01
Two novel actinomycetes, designated strains 2C-SSA16(2) T and 1C-GS8 T , were isolated from the cuticle of Camponotus japonicus Mayr, collected from Northeast Agricultural University, Heilongjiang Province, north China. Both of them contained genes (involved in antibiotics biosynthesis) of the ketosynthase (KS) and methyl malonyl transferase domains (PKS-I) and the adenylation domain (NRPS). A polyphasic study was carried out to establish the taxonomic positions of these strains. The 16S rRNA gene sequence analysis showed that the two novel isolates 2C-SSA16(2) T and 1C-GS8 T exhibited 98.8% similarity with each other and that they are most closely related to Streptomyces umbrinus JCM 4521 T (99.0, 98.6%), Streptomyces ederensis JCM 4958 T (98.9, 98.7%), Streptomyces aurantiacus JCM 4453 T (98.6, 98.2%), Streptomyces glomeroaurantiacus JCM 4677 T (98.6, 98.1%), Streptomyces tauricus JCM4837 T (98.2, 98.0%) and Streptomyces phaeochromogenes JCM 4070 T (98.2, 99.2%). The corresponding phylogenetic analysis based on partial gyrB gene sequences showed that strains 2C-SSA16(2) T and 1C-GS8 T formed a cluster with the above-mentioned strains. The DNA-DNA hybridization data and phenotypic characteristics indicated that strains 2C-SSA16(2) T and 1C-GS8 T could be readily distinguished from each other and their closest phylogenetic relatives. Therefore, these two strains are suggested to represent two novel species of the genus Streptomyces, for which the names Streptomyces camponoti sp. nov. and Streptomyces cuticulae sp. nov. are proposed. The type strains are 2C-SSA16(2) T (=CGMCC 4.7276 T = DSM 100522 T ) and 1C-GS8 T (=CGMCC 4.7348 = DSM 103127 T ), respectively.
Interaction of C-terminal truncated human alphaA-crystallins with target proteins.
Directory of Open Access Journals (Sweden)
Anbarasu Kumarasamy
2008-09-01
Full Text Available Significant portion of alphaA-crystallin in human lenses exists as C-terminal residues cleaved at residues 172, 168, and 162. Chaperone activity, determined with alcohol dehydrogenase (ADH and betaL-crystallin as target proteins, was increased in alphaA(1-172 and decreased in alphaA(1-168 and alphaA(1-162. The purpose of this study was to show whether the absence of the C-terminal residues influences protein-protein interactions with target proteins.Our hypothesis is that the chaperone-target protein binding kinetics, otherwise termed subunit exchange rates, are expected to reflect the changes in chaperone activity. To study this, we have relied on fluorescence resonance energy transfer (FRET utilizing amine specific and cysteine specific fluorescent probes. The subunit exchange rate (k for ADH and alphaA(1-172 was nearly the same as that of ADH and alphaA-wt, alphaA(1-168 had lower and alphaA(1-162 had the lowest k values. When betaL-crystallin was used as the target protein, alphaA(1-172 had slightly higher k value than alphaA-wt and alphaA(1-168 and alphaA(1-162 had lower k values. As expected from earlier studies, the chaperone activity of alphaA(1-172 was slightly better than that of alphaA-wt, the chaperone activity of alphaA(1-168 was similar to that of alphaA-wt and alphaA(1-162 had substantially decreased chaperone activity.Cleavage of eleven C-terminal residues including Arg-163 and the C-terminal flexible arm significantly affects the interaction with target proteins. The predominantly hydrophilic flexible arm appears to be needed to keep the chaperone-target protein complex soluble.
Field, Frank R; Wallington, Timothy J; Everson, Mark; Kirchain, Randolph E
2017-12-19
A comprehensive component-level assessment of several strategic and minor metals (SaMMs), including copper, manganese, magnesium, nickel, tin, niobium, light rare earth elements (LREEs; lanthanum, cerium, praseodymium, neodymium, promethium, and samarium), cobalt, silver, tungsten, heavy rare earth elements (yttrium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium), and gold, use in the 2013 model year Ford Fiesta, Focus, Fusion, and F-150 is presented. Representative material contents in cars and light-duty trucks are estimated using comprehensive, component-level data reported by suppliers. Statistical methods are used to accommodate possible errors within the database and provide estimate bounds. Results indicate that there is a high degree of variability in SaMM use and that SaMMs are concentrated in electrical, drivetrain, and suspension subsystems. Results suggest that trucks contain greater amounts of aluminum, nickel, niobium, and silver and significantly greater amounts of magnesium, manganese, gold, and LREEs. We find tin and tungsten use in automobiles to be 3-5 times higher than reported by previous studies which have focused on automotive electronics. Automotive use of strategic and minor metals is substantial, with 2013 vehicle production in the United States, Canada, EU15, and Japan alone accounting for approximately 20% of global production of Mg and Ta and approximately 5% of Al, Cu, and Sn. The data and analysis provide researchers, recyclers, and decision-makers additional insight into the vehicle content of strategic and minor metals of current interest.
Directory of Open Access Journals (Sweden)
Dongiovanni Paola
2010-09-01
Full Text Available Abstract Background Peroxisome proliferator-activated receptors (PPARs play key roles in the pathogenesis of nonalcoholic fatty liver disease (NAFLD. Aim to assess the effect of functional single nucleotide polymorphisms (SNPs of PPARα and PPARγ2, previously associated with insulin resistance and dyslipidemia, on liver damage in NAFLD, whose progression is influenced by metabolic abnormalities and inherited factors. Methods The Leu162Val PPARα and Pro12Ala PPARγ2 SNPs were evaluated by restriction analysis. We considered 202 Italian patients with biopsy-proven NAFLD. Results The frequency of the evaluated SNPs did not differ between patients and 346 healthy controls. The presence of the PPARα 162Val allele (prevalence 57%, but not of the PPARγ2 12Ala allele (prevalence 18%, was associated with higher insulin resistance (HOMA-IR index 4.71 ± 3.8 vs. 3.58 ± 2.7, p = 0.026, but not with hyperglycemia. The PPARα 162Val and PPARγ2 12Ala alleles were not associated with the severity of steatosis, necroinflammation, or fibrosis. Conclusions The presence of the PPARα 162Val allele was associated with insulin resistance, but not with liver damage in NAFLD. Because of the limited power of the present sample, larger studies are needed to exclude a minor effect of the PPARγ2 12Ala allele on necroinflammation/fibrosis in NAFLD.
All projects related to | Page 162 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Topic: Poverty, URBAN COMMUNITIES, SOCIAL INEQUALITY, LOCAL LEVEL, ... Nutrition and Food Security in Uplands of Vietnam and Thailand ... SURVEYS, INTERVIEWS, POLICY MAKING, Capacity building, Food security, Gender.
Publications | Page 162 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Taking Care of What We Have : Participatory Natural Resource Management on ... affirment qu'il améliorerait à la fois l'accès aux soins de santé et leur qualité. ... des régions où il y a eu domestication et évolution des cultures constituent la ...
Development of somaclones in sugarcane genotype BF-162 and ...
African Journals Online (AJOL)
pris
2012-02-21
Feb 21, 2012 ... Cluster and sub cluster formation further verified the presence of variability in the red rot resistant somaclones with respect to the parent. Key words: Sugarcane, callogenesis, organogenesis, somaclone, polymorphism, cluster. INTRODUCTION. Sugarcane (Saccharum officinarum L) is a major source.
15 CFR 16.2 - Description and goal of program.
2010-01-01
... particular advantages of their products. These objectives are accomplished by: (1) Selecting or developing.... (c) For selected categories of consumer products, the program includes advertising guidelines covering situations where quantitative performance values are stated in advertising or where qualitative...
Development of somaclones in sugarcane genotype BF-162 and ...
African Journals Online (AJOL)
pris
2012-02-21
Feb 21, 2012 ... Baksha R, Alam R, Karim MZ, Paul SK, Hossain MA, Miah MAS,. Rahman ABMM (2002). In vitro Shoot Tip Culture of Sugarcane. (Saccharum officinarum) Variety Isd 28. Int. Quarterly J. Biotech. 1: 67-72. Brisibe E, Miyake AH, Taniguchi T, Maeda E (1994). Regulation of somatic embryogenesis in long-term ...
Publications | Page 162 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
africain. Il y a deux ans, le Centre de recherches pour le développement ... African Youth on the Information Highway : Participation and Leadership in Community Development. Tout comme elle l'a fait dans le Nord industrialisé, la révolution de ...
African Journals Online (AJOL)
a tu N = 30 oca a una ve. Ref. 12. 164.3. 102.8". 182.28. 160.8. 99 1". 162.09. 104.1. 154.7. 104.0. 120.3. 128.3. 16.0. 161.I. 116.0. 128.3. 165.0. 103.5. 183.0. 161.9. 99.7. 162.7. 104.8. 155.3. 104.5. 120.8. 129.1. 116.6. 161.4. 116.6. 129.1. Chemical shifts with the same subscript are interchangeable. The 'H NMR spectrum ...
China Report, Agriculture, No. 255, 1981 Agricultural Yearbook.
1983-04-28
Prevention and Control of Forest Insect Pests 161 Animal Husbandry Industry 162 The Rise of China’s Beef Cattle Industry 162 Quickening Development...and Research on Sichuan’s Peng [2766] Ducks Enterprise 477 Research on Gosling Plague 477 Medicinal Techniques for Livestock Castration 478 Forestry...inventory rate percent 62.1 62.3 2. Beef cattle sold or 10,000 slaughtered for per- head 332.2 296.8 35.4 11.9 sonal use during year 3. Mutton sheep
1967-12-05
4-’Al 0 SM40- INMAN’ - -a-. STATION O: STATION AME: LATITUDE: LONGITUDi. S N MONO STATION HISTORY AND WIND EQUIPMENT INFORMATION DATE OF fYEOF...75) 75,l a 60oo 15.5 16.2 16.2 16.5 16.5 76.5 16.5 16.5 16.5 165 76.o 1os5 16o5 16.5 16.5 16. C $ 000 71 a& Aw -jai -1 k. i, LC6 -m" go, to, IkeA
Numerical analysis of a hypersonic turbulent and laminar flow using a commercial CFD solver
Directory of Open Access Journals (Sweden)
Pajčin Miroslav P.
2017-01-01
Full Text Available Computational fluid dynamics computations for two hypersonic flow cases using the commercial ANSYS FLUENT 16.2 CFD software were done. In this paper, an internal and external hypersonic flow cases were considered and analysis of the hypersonic flow using different turbulence viscosity models available in ANSYS FLUENT 16.2 as well as the laminar viscosity model were done. The obtained results were after compared and commented upon. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. 35035
Directory of Open Access Journals (Sweden)
Elmutaz Atta Awad
2014-05-01
Full Text Available A three-week trial was conducted to determine the effect of lowering dietary protein level (DPL with optimal amino acid (AA profile on growth performance, blood metabolites, and relative weights of abdominal fat and internal organs in broiler chickens raised under tropical hot and humid environment. Five isocaloric (3023 metabolisable energy/kg starter (1-21 days experimental diets were formulated in a gradual crude protein (CP decline from 22.2 (control to 16.2% by 1.5% interval. All diets were meeting or exceeding National Research Council recommendations except CP and metabolisable energy. The formulations were also adjusted to contain 1.1 digestible Lys to meet the ideal AA ratios concept. Body weights (BW, weight gains (WG, feed intake and feed conversion ratio of groups with 19.2, 20.7 and 22.2% DPL were not significantly different. However, BW and WG suppressed (P<0.05 with 16.2 and 17.7% DPL. Feeding the 16.2% CP diet significantly reduced serum total protein and uric acid, but increased serum triglyceride (P<0.05. Moreover, relative heart weights increased (P<0.05 but no changes occurred in liver and abdominal fat weights in chicks with 16.2% DPL. In summary, CP of broilers starter (1-21 days diet can be reduced till 19.2% with essential AA fortification and without any adverse effect on growth performance under the hot, humid tropics.
Directory of Open Access Journals (Sweden)
Xiulai Chen
Full Text Available Fumarate is a well-known biomass building block compound. However, the poor catalytic efficiency of fumarase is one of the major factors preventing its widespread production. To address this issue, we selected residues 159HPND162 of fumarase from Rhizopus oryzae as targets for site-directed mutagenesis based on molecular docking analysis. Twelve mutants were generated and characterized in detail. Kinetic studies showed that the Km values of the P160A, P160T, P160H, N161E, and D162W mutants were decreased, whereas Km values of H159Y, H159V, H159S, N161R, N161F, D162K, and D162M mutants were increased. In addition, all mutants displayed decreased catalytic efficiency except for the P160A mutant, whose kcat/Km was increased by 33.2%. Moreover, by overexpressing the P160A mutant, the engineered strain T.G-PMS-P160A was able to produce 5.2 g/L fumarate. To further enhance fumarate production, the acid tolerance of T.G-PMS-P160A was improved by deleting ade12, a component of the purine nucleotide cycle, and the resulting strain T.G(△ade12-PMS-P160A produced 9.2 g/L fumarate. The strategy generated in this study opens up new avenues for pathway optimization and efficient production of natural products.
ORF Alignment: NC_001148 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available .3.2) ... Length = 177 ... Query: 103 LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLCXXXXXXXXXXXXXXXXXX 162 ... ... ... LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLC ... Sbjct: 1 ... LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLC
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... AVRRVTEVGEEVLHRPCRDVTEFGPDLAALIDDMFRTMYVAEGAGLAANQVGVDLRLFVY 60 ... Query: 145 GVPLLVEGTGYFARC...LAHETDHVNGHVYLDRLSGRERKAALR 186 ... GVPLLVEGTGYFARCLAHETDHVNGHVYLDRLSGRERKAALR Sbjct: 121 GVPLLVEGTGYFARCLAHETDHVNGHVYLDRLSGRERKAALR 162
Directory of Open Access Journals (Sweden)
Maryon Guilherme Strack
2013-03-01
Full Text Available The purpose of this study was to evaluate the performance and carcass quality and beef and cull cow subjected to diets with two levels of concentrate (1.08 and 1.62% of body weight, whith base in dry matter durind the feedlot finishing. In this study were used twenty cull cows of the breed Aberdeen Angus, Charolais, Caracu, Canchim and Charolais x Caracu whith a mean age of 7.2 years. The average weight gain during the termination was similar between levels 1.08 and 1.62% (1.81 and 2.00 kg/day, respectively. However, animals in the 1.62% group consumed much digestible energy (46.13 Mcal / day compared to the lowest level (38.32 Mcal / day, showing similarity (P > 0.01 in the values of conversion food (6.78 and 6.93 kg dry matter / kg weight gain and energy efficiency (21.68 and 23.40 between the two groups. In feedlot finishing cull cows with an average age of 7.5 years, the increase of the concentrate from 1.08 to 1.62% of body weight based on dry matter based on corn silage, no benefits productive performance of cows nor the quality characteristics of meat. Increasing the concentrate level in the diet of this category can cause greater haunch thickness and better carcass conformation in feedlot finishing.O objetivo do presente estudo foi avaliar o desempenho e a qualidade da carcaça e da carne de vacas de descarte submetidas a dietas com dois teores de concentrado (1,08 e 1,62% do peso vivo, com base na matéria seca durante o processo de terminação em confinamento. Foram utilizadas 20 vacas de descarte, de raça mestiça, que compõem a formação do composto Purunã, Aberdeen Angus, Charolês, Caracu, Canchim e Caracu x Charolês com idade média de 7,2 anos. Independente do nível de concentrado o ganho de peso médio durante a terminação foi semelhante entre os teores 1,08 e 1,62% (1,81 e 2,00 kg/ dia, respectivamente. No entanto, os animais do grupo 1,62% consumiram maior quantidade energia digestível (46,13Mcal/dia em relação ao
Protein (Cyanobacteria): 647660116 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available :162 ... hypothetical protein, partial Prochlorococcus sp. scB243_496A2 MRILLAAAECAPMIKVGGMGDVVGSLPPSLIKLGHDVRVIIPGYGKLWSLLEVSNEPVFRTNTMGTDFAVYEAKHPIHNYVIYLVGHPTFDSDQIYGGENEDWRFTFFASAT
Molecular cloning and biologically active production of IpaD N-terminal region.
Hesaraki, Mahdi; Saadati, Mojtaba; Honari, Hossein; Olad, Gholamreza; Heiat, Mohammad; Malaei, Fatemeh; Ranjbar, Reza
2013-07-01
Shigella is known as pathogenic intestinal bacteria in high dispersion and pathogenic bacteria due to invasive plasmid antigen (Ipa). So far, a number of Ipa proteins have been studied to introduce a new candidate vaccine. Here, for the first time, we examined whether the N-terminal region of IpaD(72-162) could be a proper candidate for Shigella vaccine. Initially, the DNA sequence coding N-terminal region was isolated by PCR from Shigella dysenteriae type I and cloned into pET-28a expression vector. Then, the heterologous protein was expressed, optimized and purified by affinity Ni-NTA column. Western blot analysis using, His-tag and IpaD(72-162) polyclonal antibodies, confirmed the purity and specificity of the recombinant protein, respectively. Subsequently, the high immunogenicity of the antigen was shown by ELISA. The results of the sereny test in Guinea pigs showed that IpaD(72-162) provides a protective system against Shigella flexneri 5a and S. dysenteriae type I. Copyright © 2013. Published by Elsevier Ltd.
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available FATMYAAHGVGLAANQVGEAVRVFVYD Sbjct: 1 ... VRPLGLLGDPVLHARCAEVTDFGPELAALVEDLFATMYAAHGVGLAANQVGEAVRVFVYD 60 ... Query: 171 TVRGTGFFARC...LQHECDHLEGRVYADRLTGRRHRKLMRQVAR 212 ... TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR Sbjct: 121 TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR 162
International Nuclear Information System (INIS)
Honious, H.B.; Janzow, E.F.; Malson, H.A.; Moyer, S.E.
1980-01-01
The invention relates to radiation sources comprising a substrate having an electrically-conductive non-radioactive metal surface, a layer of a metal radioactive isotope of the scandium group, which in addition to scandium, yttrium, lanthanum and actinium, includes all the lanthanide and actinide series of elements, with the actinide series usually being preferred because of the nature of the radioactive isotopes therein, particularly americium-241, curium-244, plutonium-238, californium-252 and promethium-147, and a non-radioactive bonding metal codeposited on the surface by electroplating the isotope and bonding metal from an electrolytic solution, the isotope being present in the layer in minor amount as compared to the bonding metal, and with or without a non-radioactive protective metal coating covering the isotoype and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating. The invention also relates to a process for providing radiation sources comprising codepositing a layer of the metal radioactive isotope with a non-radioactive bonding metal from an electrolytic solution in which the isotope is present in minor molar amount as compared to the bonding metal such that the codeposited layer contains a minor molar amount of the isotope compared to the bonding metal by electroplating on an electrically-conductive non-radioactive metal surface of a cathode substrate, and with or without depositing a nonradioactive protective metal coating over the isotope and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating
Contaminação por chumbo na serrapilheira do Parque Nacional da Tijuca - RJ
Oliveira, Rogério Ribeiro de; Lacerda, Luiz Drude de
1987-01-01
As matas formadoras do Parque Nacional da Tijuca, Rio de Janeiro, apresentaram em sua serrapilheira um teor médio de chumbo de 16,2 µg/g ao longo de um ano. A entrada do metal no sistema via queda da serrapilheira foi de 140 g/ha/ano. O Pb atinge o sistema florestal pela deposição atmosférica, e tem origem provável na queima de combustíveis (gasolina e petróleo)Analysis of the litter layer of the Tijuca National Park rainforest revealed an average annual lead concentration of 16.2 µg/g. Rate ...
Directory of Open Access Journals (Sweden)
José Tavares-Neto
1990-06-01
Full Text Available Na cidade de Uberaba, Estado de Minas Gerais, dos 162 doadores de sangue, 13 (8,0% apresentaram anticorpos neutralizantes contra o vesiculovirus Piry. Nos indivíduos positivos foi estatisticamente mais freqüente o relato de residência anterior em área rural (p Thirteen (8.0% of 162 blood donors from Uberaba - Minas Gerais State showed neutralizing antibodies to the vesiculovirus Piry. The previous residence in rural area (p < 0.0001 and in the cities of the São Paulo State (p < 0.05 were statistically more frequent in the Piry seropositive group.
People’s Republic of China Scientific Abstracts, Number 162
1977-01-28
endocrine function of the syncytiotrophoblasts. It should be mentioned that the decrement rate in the levels of HCG zh hours after in- jection showed some...photograph and one map are included. AUTHOR: KAO HSIA [7559/0201+] ORG: None TITLE: " Gigantic Tasks Performed Along the Thousands of Miles of the
Résultats de recherche | Page 162 | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
Société civile et islamisme en Iraq et au Maroc. Par son dynamisme, la société civile du Maroc s'est approprié avec les années un rôle traditionnellement dévolu aux institutions de l'État, soit offrir des services sociaux dans les secteurs de la santé, de l'éducation et du logement. Projet ...
46 CFR 162.050-27 - Oil content meter: Approval tests.
2010-10-01
... dimension not exceeding 0.5 mm in diameter arranged in line with the sample flow. The quantity of air.... The pump is run at one-fourth of its design speed. The oil content reading, when steady, is recorded...
24 CFR 891.655 - Definitions applicable to 202/162 projects.
2010-04-01
... includes a kitchen and a bath. Operating costs means expenses related to the provision of housing and...) Security expenses; (4) Utilities expenses, including gas, oil, electricity, water, sewer, trash removal...
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TMYAANGVGLAANQIGVPLRVFVYD Sbjct: 1 ... VRPLALLGDPVLHAPCEEVTDHGPELARLVEDMFATMYAANGVGLAANQIGVPLRVFVYD 60 ... Query: 133 RVLGTGWFARC...LQHECDHLDGGVYVDRVSGWRHRRVMRQAAR 174 ... RVLGTGWFARCLQHECDH...LDGGVYVDRVSGWRHRRVMRQAAR Sbjct: 121 RVLGTGWFARCLQHECDHLDGGVYVDRVSGWRHRRVMRQAAR 162
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SQRTAEGVGLAANQIGVDLKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECKDVTDFGAELEQLVADMFASQRTAEGVGLAANQIGVDLKVFVYDC 60 ... Query: 162 PIKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PIKVRGTGYFARCLQ...HETDHLYGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PIKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GVGLAANQIGVSKKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDC 60 ... Query: 162 PVKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PVKVRGTGYFARCLQHETDHL...YGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PVKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164
Talbert, Erin E; Yang, Jennifer; Mace, Thomas A; Farren, Matthew R; Farris, Alton B; Young, Gregory S; Elnaggar, Omar; Che, Zheng; Timmers, Cynthia D; Rajasekera, Priyani; Maskarinec, Jennifer M; Bloomston, Mark; Bekaii-Saab, Tanios; Guttridge, Denis C; Lesinski, Gregory B
2017-02-01
Involuntary weight loss, a part of the cachexia syndrome, is a debilitating comorbidity of cancer and currently has no treatment options. Results from a recent clinical trial at our institution showed that biliary tract cancer patients treated with a MEK inhibitor exhibited poor tumor responses but surprisingly gained weight and increased their skeletal muscle mass. This implied that MEK inhibition might be anticachectic. To test this potential effect of MEK inhibition, we utilized the established Colon-26 model of cancer cachexia and the MEK1/2 inhibitor MEK162. Results showed that MEK inhibition effectively prevented muscle wasting. Importantly, MEK162 retained its ability to spare muscle loss even in mice bearing a Colon-26 clone resistant to the MEK inhibitor, demonstrating that the effects of blocking MEK are at least in part independent of the tumor. Because single-agent MEK inhibitors have been limited as a first-line targeted therapy due to compensatory activation of other oncogenic signaling pathways, we combined MEK162 with the PI3K/Akt inhibitor buparlisib. Results showed that this combinatorial treatment significantly reduced tumor growth due to a direct activity on Colon-26 tumor cells in vitro and in vivo, while also preserving skeletal muscle mass. Together, our results suggest that as a monotherapy, MEK inhibition preserves muscle mass, but when combined with a PI3K/Akt inhibitor exhibits potent antitumor activity. Thus, combinatorial therapy might serve as a new approach for the treatment of cancer cachexia. Mol Cancer Ther; 16(2); 344-56. ©2016 AACRSee related article by Kobayashi et al., p. 357. ©2016 American Association for Cancer Research.
Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel
2017-02-01
Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.
ORF Alignment: NC_006526 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ltransferase [Zymomonas mobilis subsp. mobilis ... ZM4] ... Length = 162 ... Query: 11 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE 70 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE Sbjct: 1 ... IALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGKSPLFSSEERASM
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available family ... [Bacillus clausii KSM-K16] ... Length = 162 ... Query: 84 ... LIAEMESIYKAIIGGSRELINQDDIV...QAATLLENANRIEIYGIGSSGLSGQEMKFRLMRM 143 ... LIAEMESIYKAIIGGSRELINQDDIVQAATL...LENANRIEIYGIGSSGLSGQEMKFRLMRM Sbjct: 1 ... LIAEMESIYKAIIGGSRELINQDDIVQAATLLENANRIEIYGIGSSGLSGQEMKFRLMRM 60 ... Qu
ORF Alignment: NC_003423 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available pombe) ... Length = 141 ... Query: 22 ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSD...LCGYKNIVHGGF 81 ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSDLCGYKNIVHGGF Sbjct: 1 ... ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSDLCGYKNIVHGGF 60 ... Query: 142 LLRLNGSEPPVLCAKASGFFV 162 ... LLRLNGSEPPVLCAKASGFFV Sbjct: 121 LLRLNGSEPPVLCAKASGFFV 141
A Pilot Study to Assess Solanesol Levels in Exhaled Cigarette Smoke
Directory of Open Access Journals (Sweden)
Moldoveanu SC
2014-12-01
Full Text Available This paper describes the results obtained during the measurement of the level of solanesol in exhaled cigarette smoke from human subjects. The study was performed with three different cigarettes with U.S. Federal Trade Commission (FTC ‘tar’ values of 5.0 mg, 10.6 mg, and 16.2 mg. The number of human subjects was ten smokers for each of the evaluated products, each subject smoking three cigarettes within one hour. The exhaled smoke was collected using a vacuum assisted procedure that avoids strain in exhaling, and the solanesol was analyzed using an original high performance liquid chromatography (HPLC technique. The cigarette butts from the smokers were collected and also analyzed for solanesol. The results obtained for the cigarette butts from the smokers were used to calculate the level of solanesol delivered to the smoker, based on calibration curves. These curves were generated separately by analyzing the solanesol in smoke and in the cigarette butts obtained by machine smoking under different puffing regimes. Knowing the levels of solanesol delivered to the smoker and the exhaled levels it was possible to calculate the retention and retention % of this compound from mainstream smoke for different cigarettes types. The amount of retained solanesol is the lowest for the 5.0 mg ‘tar’ product, and the highest for the 16.2 mg ‘tar’ product, although there is not much difference between the 10.6 mg ‘tar’ product and the 16.2 mg ‘tar’ product. For the 10.6 mg ‘tar’ cigarettes the retention % was between 60% and 72%, for the 5.0 mg product the retention % was slightly lower ranging between 53% and 70%, while for the 16.2 mg ‘tar’ product, the retention % was slightly higher ranging between 62% and 82%.
Directory of Open Access Journals (Sweden)
Paula Bacelar Leite
2013-06-01
Full Text Available The "witch broom disease" caused by the fungus called Moniliophthora perniciosa is one of the most important cocoa diseases in Latin America, causing around 70% production reduction in the southern Bahia. In attempt to solve the problem, many cultivars resistant to the disease have been recommended to farmers. On the other hand, the chocolate flavour is composed by many compounds whose formation depends on the genetic background, environment where cocoa is grown and processing operations. Therefore, this work aimed at determining the monomeric phenolic compounds, methylxanthines and antioxidant activity of cocoa mass and dark chocolate from cocoa cultivars resistant to "witch broom disease" and non resistant to the disease. The total phenolic compounds in cocoa mass did not vary among cultivars with values ranging from 23.95mg g-1 to 25.03mg g-1. Chocolates made from non resistant cultivars showed higher total phenolic compounds (19.11mg g-1 than SR162 and PH16 with 16.08mg g-1 and 15.46mg g-1, respectively. Epicatechin had higher content than catechin and the levels of these two compounds were higher in SR162. There were significant differences among samples of cocoa mass analyzed for caffeine. Chocolate made from SR162 had the highest amount of monomeric compounds due to its high concentration of catechin and epicatechin. The chocolate sample with the highest antioxidant activity was the SR162, followed by non resistant blend and PH16, showing relationship between the antioxidant activity and monomeric phenolics content.A "vassoura bruxa" causada pelo fungo Moniliophthora perniciosa, é uma das doenças mais importantes do cacau na América Latina, provocando uma redução de cerca de 70% na produção das amêndoas na Bahia. Para tentar resolver o problema, muitos cultivares resistentes à enfermidade têm sido recomendados para os agricultores. Por outro lado, as características do chocolate são oriundas de várias substâncias, cuja forma
Casting core for a cooling arrangement for a gas turbine component
Lee, Ching-Pang; Heneveld, Benjamin E
2015-01-20
A ceramic casting core, including: a plurality of rows (162, 166, 168) of gaps (164), each gap (164) defining an airfoil shape; interstitial core material (172) that defines and separates adjacent gaps (164) in each row (162, 166, 168); and connecting core material (178) that connects adjacent rows (170, 174, 176) of interstitial core material (172). Ends of interstitial core material (172) in one row (170, 174, 176) align with ends of interstitial core material (172) in an adjacent row (170, 174, 176) to form a plurality of continuous and serpentine shaped structures each including interstitial core material (172) from at least two adjacent rows (170, 174, 176) and connecting core material (178).
Investigation of LiF, Mg and Ti (TLD-100) Reproducibility.
Sadeghi, M; Sina, S; Faghihi, R
2015-12-01
LiF, Mg and Ti cubical TLD chips (known as TLD-100) are widely used for dosimetry purposes. The repeatability of TL dosimetry is investigated by exposing them to doses of (81, 162 and 40.5 mGy) with 662keV photons of Cs-137. A group of 40 cubical TLD chips was randomly selected from a batch and the values of Element Correction Coefficient (ECC) were obtained 4 times by irradiating them to doses of 81 mGy (two times), 162mGy and 40.5mGy. Results of this study indicate that the average reproducibility of ECC calculation for 40 TLDs is 1.5%, while these values for all chips do not exceed 5%.
Identical and shifted identical bands
International Nuclear Information System (INIS)
Dodder, R.S; Jones, E.F.; Hamilton, J.H.
1997-01-01
Spontaneous fission of 252 Cm was studied with 72 large Compton suppressed Ge detectors in Gamma sphere. New isotopes 160 Sm and 162 Gd were identified. Through X-ray-γ and γ-γ-γ) coincidence measurements, level energies were established to spins 14 + to 20 + in 152 , 154 156 60 Nd 92 94 96 , 156 , 158 , 160 62 Sm 94 , 96 , 98 , and 160 , 162 64 Gd 96 , 98 . These nuclei exhibit a remarkable variety of identical bands and bands where the energies and moments of inertia are shifted by the same constant amount for every spin state from 2 + to 12 + for various combinations of nuclei differing by 2n, 4n, 2p, 4p, and α
[The management of 126 cases of posterior cracked crown of tooth and its effective observation].
Chen, L L
2000-06-01
To detect the treatment and effect of posterior cracked tooth. 162 posterior cracked teeth of 158 cases, including enamel fissure and dentin fissure, all there cases undergone the synthetical treatment and follow up in different period, the longest observation period was 2.5 years. The healing and improved rate of 162 cracked teeth 90.74%. Among cases of failure, we have founded 6 cases of acute pulpitis (3.7%), 3 cases of alveodental abscess (1.85%), 2 cases of chronic apical periodontitis (1.24%), 4 cases of tooth fracture (2.4%). Cracked tooth was caused by multiple factors. Early diagnosis, synthetical treatment, and follow up in different period are 3 main factors in treatment.
Blahopřání Alexandře Navrátilové
Czech Academy of Sciences Publication Activity Database
Frolcová, Věra
2016-01-01
Roč. 33, č. 2 (2016), s. 159-162 ISSN 1211-8117 Institutional support: RVO:68378076 Keywords : congratulations * ethnology * anniversary * personality Subject RIV: AC - Archeology, Anthropology, Ethnology
Lung function study and diffusion capacity in anorexia nervosa.
Pieters, T; Boland, B; Beguin, C; Veriter, C; Stanescu, D; Frans, A; Lambert, M
2000-08-01
In humans, malnutrition alters the respiratory system in different ways. It impairs the ventilatory drive, decreases respiratory muscle strength and reduces immune competence. In addition, typical emphysema-like changes were demonstrated in starved animals. The presence of emphysema has never been demonstrated in starved humans. Our objective was to investigate whether pulmonary emphysema occurs in anorexia nervosa by means of a pulmonary function study. We examined 24 women aged between 14 and 38 years (nine smokers). We studied the lung function including lung volumes, ventilatory capacity, maximal respiratory pressures and transfer factor, as well as PaO2. All respiratory tests were within normal limits with the exception of decreased maximal inspiratory (59% of predicted values) and expiratory pressures (35%), and increased residual volume (162%). Diffusion capacity (98.1 +/- 16.2%) and transfer coefficient (98.4 +/- 16.2%) were also normal. The diffusion coefficient was lower in current smokers than in those who had never smoked (P anorexia nervosa, pulmonary function tests are within normal limits with the exception of maximal pressures and residual volume. Diffusion capacity is not decreased. The present results within the limitations of the used method are not compatible with the hypothesis of starvation-induced pulmonary emphysema.
Critical role of DNA intercalation in enzyme-catalyzed nucleotide flipping
Hendershot, Jenna M.; O'Brien, Patrick J.
2014-01-01
Nucleotide flipping is a common feature of DNA-modifying enzymes that allows access to target sites within duplex DNA. Structural studies have identified many intercalating amino acid side chains in a wide variety of enzymes, but the functional contribution of these intercalating residues is poorly understood. We used site-directed mutagenesis and transient kinetic approaches to dissect the energetic contribution of intercalation for human alkyladenine DNA glycosylase, an enzyme that initiates repair of alkylation damage. When AAG flips out a damaged nucleotide, the void in the duplex is filled by a conserved tyrosine (Y162). We find that tyrosine intercalation confers 140-fold stabilization of the extrahelical specific recognition complex, and that Y162 functions as a plug to slow the rate of unflipping by 6000-fold relative to the Y162A mutant. Surprisingly, mutation to the smaller alanine side chain increases the rate of nucleotide flipping by 50-fold relative to the wild-type enzyme. This provides evidence against the popular model that DNA intercalation accelerates nucleotide flipping. In the case of AAG, DNA intercalation contributes to the specific binding of a damaged nucleotide, but this enhanced specificity comes at the cost of reduced speed of nucleotide flipping. PMID:25324304
International Nuclear Information System (INIS)
Turgis, Mélanie; Stotz, Viviane; Dupont, Claude; Salmieri, Stéphane; Khan, Ruhul A.; Lacroix, Monique
2012-01-01
Two new bacteria were isolated from human feces and were designated MT 104 and MT 162. They were able to produce bacteriocins that are active against five strains of Listeria monocytogenes. Bacteriocins produced by these isolated strains had 100% and 82.35% residual activity when they were treated by gamma radiation at doses of 4 and 40 kGy, respectively. A reduction of 1.0, 1.5 and 3 log CFU/g of L. monocytogenes was observed in sausage meat when treated with bacteriocins from MT 104, MT 162, and nisin, respectively. For synergic effect, the D 10 value in presence of the bacteriocins produced by MT 104 showed a 1.08 fold increased relative sensitivity of L. monocytogenes as compared to control after 5 days. The highest synergic effect was observed in presence of nisin which led to 1.61 fold increased relative sensitivity. Combined treatments with nisin and γ-irradiation showed a synergic antimicrobial effect in meat after 24 h and 5 days of storage. A synergic effect was observed only after 5 days at 4 °C for the bacteriocin from MT 104, as compared to the bacteriocin produced by MT 162 that had only an additive antimicrobial effect in all conditions.
Caffeine-enhanced survival of radiation-sensitive, repair-deficient Chinese hamster cells
International Nuclear Information System (INIS)
Utsumi, H.; Elkind, M.M.
1983-01-01
A clone of V79 Chinese hamster cells (V79-AL162/S-10) with unique properties has been isolated after a challenge of parental cells (V79-AL162) with 1 mM ouabain. Compared with parental cells, or with other clones isolated after the ouabain challenge, these cells form smaller colonies, are more sensitive to both x rays and fission-spectrum neutrons, and respond atypically to a postirradiation treatment with caffeine. Their enhanced response to x rays results mainly from a large reduction in the shoulder of their survival curve, probably because in late S phase, the most resistant phase in the cell cycle, the survival curve of these cells has a reduced shoulder width. Caffeine, and to a lesser extent theophylline, added to the colony-forming medium immediately after exposure appreciably increases the width of the shoulder of these sensitive cells, whereas caffeine has the opposite effect on the response of normal V79 cells. Thus the unique response of the V79-AL162/S-10 cells to a radiation posttreatment with caffeine (increased survival) results from a net increase in their ability to repair damage that is otherwise lethal; caffeine treatment ordinarly prevents normal V79 cells from repairing damage that is only potentially lethal
Determination of the cross section for (n,p) and (n,α) reactions on 165Ho at 13.5 and 14.8 MeV
International Nuclear Information System (INIS)
Luo, Junhua; An, Li; Jiang, Li; He, Long
2015-01-01
Activation cross-sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured by means of the activation method at 13.5 and 14.8 MeV, to resolve inconsistencies in existing data. A neutron beam produced via the 3 H(d,n) 4 He reaction was used. Statistical model calculations were performed using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. Results are also discussed and compared with some corresponding values found in the literature. The calculational results on the 165 Ho(n,α) 162 Tb reaction agreed fairly well with experimental data, but there were large discrepancies in the results for the 165 Ho(n,p) 165 Dy reaction. - Highlights: • 27 Al(n,α) 24 Na was used as a monitor for neutron fleunce. • The cross sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured at 13.5 and 14.8 MeV neutron energies. • Nuclear reaction codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • Inconsistency with previous data and with model calculations are noted
Wang, Huan; Song, Zhenfeng; Ba, Yanhui; Zhu, Lin; Wen, Ying
2014-10-01
To describe the knowledge, attitudes and practices of type 2 diabetics in Yakeshi City and to assess the effect of implementation of nutritional and eating education in enhancing knowledge and practices regarding a healthy diet. A questionnaire-based survey was conducted with 162 diabetics to determine their nutrition knowledge, attitudes and practices; fifty-four participants received nutritional and eating education for 6 months. Diabetes-related nutrition knowledge, awareness, practice accuracy, dietary intake and glycaemic control were assessed before and after education. Yakeshi, a remote city in northern China. A total of 162 type 2 diabetics recruited from three hospitals, fifty-four of whom were selected randomly to receive education. Among the 162 respondents, most diabetics (75%) considered that controlling diet was important in the methods of controlling blood glucose. Scores for knowledge, practices and overall KAP (knowledge-attitude-practice) were low, but scores for attitude were high. Participants with diabetes education experiences, practice duration over 1 year or high education level all had higher scores for KAP (P nutrition knowledge, awareness and practice accuracy improved significantly (P nutrition knowledge and practices. Nutritional and eating education was effective in improving diabetics' nutrition knowledge and practices, and this optimal practice helped them control blood glucose effectively.
Turgis, Mélanie; Stotz, Viviane; Dupont, Claude; Salmieri, Stéphane; Khan, Ruhul A.; Lacroix, Monique
2012-08-01
Two new bacteria were isolated from human feces and were designated MT 104 and MT 162. They were able to produce bacteriocins that are active against five strains of Listeria monocytogenes. Bacteriocins produced by these isolated strains had 100% and 82.35% residual activity when they were treated by gamma radiation at doses of 4 and 40 kGy, respectively. A reduction of 1.0, 1.5 and 3 log CFU/g of L. monocytogenes was observed in sausage meat when treated with bacteriocins from MT 104, MT 162, and nisin, respectively. For synergic effect, the D10 value in presence of the bacteriocins produced by MT 104 showed a 1.08 fold increased relative sensitivity of L. monocytogenes as compared to control after 5 days. The highest synergic effect was observed in presence of nisin which led to 1.61 fold increased relative sensitivity. Combined treatments with nisin and γ-irradiation showed a synergic antimicrobial effect in meat after 24 h and 5 days of storage. A synergic effect was observed only after 5 days at 4 °C for the bacteriocin from MT 104, as compared to the bacteriocin produced by MT 162 that had only an additive antimicrobial effect in all conditions.
20 CFR 702.162 - Liens on compensation authorized under special circumstances.
2010-04-01
... district director or the administrative law judge is not satisfied that the trust fund qualifies for a lien... under special circumstances. (a) Pursuant to section 17 of the Act, 33 U.S.C. 917, when a trust fund... authorized on such compensation in favor of the trust fund for the amount of such payments. (b)(1) An...
The Search for a Cold War Grand Strategy: NSC 68 & 162
2014-05-22
Harper Collins Publishers, 1990. Chandler , Alfred D., Jr., and Louis Galamos Jr. The Papers of Dwight D. Eisenhower. Baltimore, MD, 1970. Cutler...76Alfred D. Chandler Jr., and Louis Galamos Jr., The Papers of Dwight D. Eisenhower (Baltimore, MD, 1970), Vol. 11, 1312; Vol. 8, 1609. 77Ibid
26 CFR 1.162-28 - Allocation of costs to lobbying activities.
2010-04-01
... following example. Example. (i) Three full-time employees, A, B, and C, work in the Washington office of... include costs attributable to full-time, part-time, and contract employees. Labor costs include all..., to assume that all full-time personnel spend 1,800 hours per year on a taxpayer's trade or business...
33 CFR 162.15 - Manhasset Bay, N.Y.; seaplane restricted area.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Manhasset Bay, N.Y.; seaplane... Bay, N.Y.; seaplane restricted area. (a) The restricted area. An area in Manhasset Bay between the... line bearing 166°50′ true from latitude 40°50′17.337 N, longitude 73°43′03.877 W, which point is on the...
Ce que nous faisons | Page 162 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
... est une organisation non gouvernementale internationale qui encourage la coopération entre les ... Réseau d'information sur la santé du Mozambique ... de plus en plus fréquentes entre des professionnels issus de différentes disciplines.
: tous les projets | Page 162 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Une nouvelle vision de la transition en Syrie. Projet. Le régime syrien ayant exercé un important contrôle sur l'émergence des institutions de la société civile, ces dernières n'ont jamais atteint le degré d'inclusion, de participation et de pluralisme requis afin de donner lieu à une société ouverte et démocratique. Date de ...
78 FR 35022 - Parker-Davis Project-Rate Order No. WAPA-162
2013-06-11
...), a power marketing administration within the Department of Energy (DOE), is proposing to extend the... transmission service, firm transmission service of Salt Lake City Area/Integrated Projects power, and non-firm...
45 CFR 162.1302 - Standards for referral certification and authorization transaction.
2010-10-01
... Standards for Electronic Data Interchange Technical Report Type 3, April 2008, ASC X12N/005010X217E1... authorization. The NCPDP Telecommunication Standard Implementation Guide, Version 5, Release 1 (Version 5.1... (Version 1.1), January 2000, supporting Telecommunications Standard Implementation Guide, Version 5...
40 CFR 205.162-3 - Instructions for maintenance, use, and repair.
2010-07-01
...-technical language. (3) The instructions must not be used to secure an unfair competitive advantage. They shall not restrict replacement equipment to original equipment or restrict service to dealer service...
Search Results | Page 50 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 491 - 500 of 9601 ... ... WOMEN'S RIGHTS (162) Apply WOMEN'S RIGHTS filter · GENDER ... Knowledge for Democracy Myanmar (7) Apply Knowledge for ... INDIGENOUS POPULATION ETHNIC MINORITIES TRADITIONAL CULTURE ...
Startup Report for Ground Water Extraction, Treatment, and Recharge System
National Research Council Canada - National Science Library
Lamb, Steve
1997-01-01
The document presents startup procedures, observations and measurements conducted during the startup of the Groundwater Extraction, Treatment and Recharge System, built for the 162nd Fighter Wing, Air...
76 FR 38220 - Submission for OMB Review
2011-06-29
...: Self-Monitoring Questionnaire for Insurance and Finance Projects. Form Number: OPIC 162. Frequency of...); individuals. Standard Industrial Classification Codes: All. Description of Affected Public: U.S. companies or...
Energy Technology Data Exchange (ETDEWEB)
Butler, T A; Lamb, E; Rupp, A F [Oak Ridge National Laboratory, Oak Ridge, TN (United States)
1962-01-15
Recent developments in the radioisotope production programme at Oak Ridge National Laboratory include new processes and process improvements for the production of cerium-144, promethium-147, technetium-99 and strontium-90. Cerium-144 has been produced in kc quantities in a test run. A product recovery of more than 98% with a product purity of more than 99% was attained. The cerium was further processed to obtain pure cerium-144 oxide powder having an activity concentration of 235 c/g. The powder was pressed into pellets which were sintered to a dense ceramic form. Promethium-147 has been produced in kc quantities by a combination of precipitation and ion exchange techniques. A solvent extraction system for separating promethium- 147 from other rare earths has been tested on a tracer scale. Gram quantities of technetium-99 have been recovered from fission-product waste streams by a combination of precipitation and solvent extraction processes. The technetium product was produced with a chemical purity of more than 99.9% and radiochemical purity of more than 99.99%. The separation and purification of strontium-90 from gross contaminants by a continuous solvent-extraction flowsheet has been demonstrated on a tracer scale. Product quality of 98% strontium has been achieved from feed containing 95% inert calcium contaminant. The strontium-90 is further processed to form strontium titanate ceramic elements. (author) [French] Les faits recents a noter dans le programme de production de radioisotopes du laboratoire national d'Oak Ridge sont l'introduction de nouvelles methodes et l'amelioration des techniques existantes pour la production du eerium-144, du prometheum-147, du technetium-99 et du strontium-90. Le cerium-144 a ete obtenu en quantites de l'ordre du kilocurie, lors d'une experience. On a obtenu un taux d'extraction de plus de 98% et un produit d'une purete superieure a 99%. On a ensuite traite le cerium pour avoir de l'oxyde de cerium-144 pur en poudre ayant
Xie, Yesi; Meng, Huanxin; Han, Jie; Pan, Shaoxia; Zhang, Li; Shi, Dong
2016-02-01
To compare the incidence of technical complications of implant-supported fixed dental prostheses in Chinese patients with a history of moderate or severe periodontitis and periodontally healthy patients(PHP) and analyze the effects of interproximal papillae patterns on food impaction and efficacy of plaque control. A total of 103 partially edentulous patients treated with implant-supported fixed dental prostheses between December 2009 and December 2012 for a minimum 1-year follow-up period were recruited from Department of Periodontology, Peking University, School and Hospital of Stomatology. Based on the initial periodontal examination, the participants were divided into three groups: 30 PHP, 36 moderate periodontally compromised patients(mPCP) and 37 severe periodontally compromised patients(sPCP). Implant survival/loss, technical complications, plaque index, papilla index, food impaction and degree of proximal contact tightness of each patient were assessed around the implants at follow-up. According to the implant papilla index, the implants were divided into two groups: the "filling" group with the mesial and distal aspects with papilla index=3 and the "no filling" group with at least one aspect with papilla indextechnical complications were analyzed. Comparisons of the incidence of technical complications were performed between the patients with different periodontal conditions with chi-square or Fisher's exact test. The influences of the interproximal papillae loss on food impaction and efficacy of plaque control were estimated with chi-square and Mann-Whitney U tests. The total implant survival rate was 100%(162/162) for all three groups. Technical complications were as following: veneer fractures(1.9%, 3/162), abutment screw loosening(1.9%, 3/162), prosthetic screw loosening(3.1%, 5/162) and decementation(3.1%, 5/162) in all subjects. No implant/screw fracture was noted. The incidence of technical complications in sPCP, mPCP and PHP did not yield
Star Wars als bron van religie : Voorbeeld van een lessenserie in bovenbouw havo/vwo
Ouden, den J.A.J.; Davidsen, M.A.
2017-01-01
Voorbeeldlessen bij Davidsen, Markus Altena & Jeannette den Ouden (2016), “Star Wars in het religieonderwijs: Religiekunde in de lespraktijk I”, Narthex: tijdschrift voor levensbeschouwing en educatie 16(2), 64-71.
Antigravitace a její projevy, aneb platí zákon zachování energie? Část 2
Czech Academy of Sciences Publication Activity Database
Křížek, Michal
2013-01-01
Roč. 63, č. 3 (2013), s. 162-167 ISSN 0009-0700 Institutional support: RVO:67985840 Keywords : gravitational aberration * solar system * dark energy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics
Investigation of LiF, Mg and Ti (TLD-100 Reproducibility
Directory of Open Access Journals (Sweden)
Sadeghi M.
2015-12-01
Full Text Available LiF, Mg and Ti cubical TLD chips (known as TLD-100 are widely used for dosimetry purposes. The repeatability of TL dosimetry is investigated by exposing them to doses of (81, 162 and 40.5 mGy with 662keV photons of Cs-137. A group of 40 cubical TLD chips was randomly selected from a batch and the values of Element Correction Coefficient (ECC were obtained 4 times by irradiating them to doses of 81 mGy (two times, 162mGy and 40.5mGy. Results of this study indicate that the average reproducibility of ECC calculation for 40 TLDs is 1.5%, while these values for all chips do not exceed 5%.
DEFF Research Database (Denmark)
Fischer, T.K.; Eugen-Olsen, J.; Pedersen, Anders Gorm
2005-01-01
We characterized the G and P types from 162 rotavirus-positive stool specimens collected from 162 persons in Denmark (134 children and 28 adults) with acute diarrhea in 1998, 2000, and 2002. Samples were obtained during outpatient consultations (73%) and from hospitalized patients (27%). Although...... is the highest frequency reported in any European population. The standard reverse transcription-PCR methods initially failed to identify a considerable fraction of the rotavirus P strains due to mutations at the VP4 primer-binding sites of P[8] strains. The application of a degenerate P[8] primer resulted...... for rotavirus vaccine implementation in a European population and underscore the importance of extensive strain surveillance prior to, during, and after introduction of any vaccine candidate....
Gene : CBRC-EEUR-01-0576 [SEVENS
Lifescience Database Archive (English)
Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID
National Oceanic and Atmospheric Administration, Department of Commerce — Surficial sediment samples were collected from 162 locations within five estuaries - Charleston Harbor, Winyah Bay, Leadenwah Creek, Savannah River, and St. Simons...
Directory of Open Access Journals (Sweden)
S.O. Procópio
2006-09-01
Full Text Available O trabalho teve como objetivo avaliar a ação dos herbicidas imazethapyr e chlorimuron-ethyl em aplicações de pré-semeadura da cultura da soja, visando o controle das plantas daninhas presentes antes da semeadura e a redução na emergência de plantas daninhas durante o ciclo da cultura. O experimento foi conduzido a campo, em área de produção de soja em sistema de plantio direto. O delineamento experimental utilizado foi o de blocos casualizados, com quatro repetições, em esquema fatorial (4 x 4 + 1, sendo quatro tratamentos herbicidas [glyphosate (1,62 kg ha-1; glyphosate (1,62 kg ha-1 + imazethapyr (100 g ha-1; glyphosate (1,62 kg ha-1 + chlorimuron-ethyl (10 g ha-1; glyphosate (1,62 kg ha-1 + chlorimuron-ethyl (20 g ha-1] e quatro intervalos entre a aplicação dos herbicidas e a semeadura da soja (0, 1, 3 e 7 dias, mais uma testemunha não-dessecada. A adição dos herbicidas imazethapyr (100 g ha¹ e chlorimuron-ethyl (10 ou 20 g ha-1 junto ao glyphosate não melhorou o controle e também não diminuiu a rebrota posterior das plantas daninhas Digitaria insularis, Tridax procumbens e Leptochloa filiformis. Três dias antes da semeadura da soja foi o intervalo mínimo para que o controle dessas três espécies de plantas daninhas não fosse prejudicado pela operação de semeadura mecânica. Constatou-se que os tratamentos herbicidas não afetaram o número de plantas emergidas das espécies Sida santaremnensis, Digitaria insularis, Eleusine indica, Chamaesyce hirta, Bidens pilosa e Senna obtusifolia. Apenas para a espécie Althernantela tenella foi verificado que a adição de imazethapyr ou de chlorimuron-ethyl junto ao glyphosate reduziu a emergência dessa planta daninha na área, mostrando eficiência em pré-emergência. Todos os tratamentos herbicidas aplicados em pré-semeadura proporcionaram maior produtividade da cultura da soja em relação à testemunha não-dessecada, mas o incremento dos herbicidas imazethapyr e
76 FR 3135 - Pesticide Experimental Use Permit; Receipt of Extension Application;
2011-01-19
... (vector PHP 17662) necessary for their production in Event DAS-59122-7 corn, 3) [MIR162] Bacillus... language for your requested changes. iv. Describe any assumptions and provide any technical information and...
Neoalloionema indicum n.sp. (Nematoda: Alloinematidae), a new alloionematid from India
Czech Academy of Sciences Publication Activity Database
Nermuť, Jiří; Půža, Vladimír; Mráček, Zdeněk
2016-01-01
Roč. 18, č. 8 (2016), s. 949-962 ISSN 1388-5545 Institutional support: RVO:60077344 Keywords : Alloionema appendiculatum * Neoalloionema tricaudatum * molecular Subject RIV: EG - Zoology Impact factor: 1.162, year: 2016
Czech Academy of Sciences Publication Activity Database
Senvar, M. O.; Vayvay, O.; Kurt, E.; Hloch, Sergej
2014-01-01
Roč. 21, č. 1 (2014), s. 155-162 ISSN 1330-3651 Institutional support: RVO:68145535 Keywords : balanced scorecard * fuzzy * automotive Subject RIV: JQ - Machines ; Tools Impact factor: 0.579, year: 2014
Mechanismen und Strategien der\
Czech Academy of Sciences Publication Activity Database
Nosková, Jana; Kreisslová, S.; Pavlásek, Michal
2017-01-01
Roč. 58 (2017), s. 158-162. ISBN 978-3-8309-2501-9. ISSN 0075-2738 Institutional support: RVO:68378076 Keywords : family memory * generation * Germany * Czech Republic * Croatia OBOR OECD: Antropology, ethnology
Lifescience Database Archive (English)
Full Text Available 5 update on diagnosis, risk-stratification and management. ... JOURNAL ... Am J Hematol 90:162-73 (2015) DOI:10.... TITLE ... Pharmacological management of essential thrombocythemia. ... JOURNAL ... Expert Opin Pharmacother 14:
Newall Glacier Snow Pit and Ice Core, 1987 to 1989, Version 1
National Aeronautics and Space Administration — Snow pit and ice core data from the Newall Glacier (location - 162 30' East, 77 35' South) were collected during 1987 and 1988. These include information on...
Czech Academy of Sciences Publication Activity Database
Garcia-Sanchez, M.; Garcia-Romera, I.; Cajthaml, Tomáš; Tlustoš, P.; Száková, J.
2015-01-01
Roč. 162, OCT 2015 (2015), s. 63-73 ISSN 0301-4797 Institutional support: RVO:61388971 Keywords : Amendments * Communities structure * Physiological diversity Subject RIV: EE - Microbiology, Virology Impact factor: 3.131, year: 2015
African Journals Online (AJOL)
Owner
Emecheta's Double Yoke and Ama Ata Aidoo's Changes reveals that these inimitable feminist writers, .... From this knowledge springs a decision equipped with forceful ... aware of is desolation” (162) and her personality drastically changes.
Czech Academy of Sciences Publication Activity Database
Rákosník, Jiří; Rozložník, Miroslav; Strakoš, Zdeněk
2016-01-01
Roč. 497, 15 May (2016), s. 162-166 ISSN 0024-3795 Keywords : Miroslav Fiedler * linear algebra * geometry Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/article/pii/S0024379516001178
South African Journal of Animal Science - Vol 15, No 4 (1985)
African Journals Online (AJOL)
Supplementary winter feeding and reproduction of beef heifers on Dohne sourveld · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JA Erasmus, HH Barnard, 162-164 ...
Czech Academy of Sciences Publication Activity Database
Žurovcová, Martina; Ayala, F. J.
2002-01-01
Roč. 162, - (2002), s. 177-188 ISSN 0016-6731 Institutional research plan: CEZ:AV0Z5007907 Keywords : Drosophila melanogaster Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.483, year: 2002
Minato, Taketoshi; Izumi, Yasuo; Aika, Ken-Ichi; Ishiguro, Atsushi; Nakajima, Takayuki; Wakatsuki, Yasuo
2003-08-28
Ruthenium site structures supported on metal oxide surfaces were designed by reacting organometallic Ru cluster [Ru6C(CO)16](2-) or [Ru6(CO)18](2-) with various metal oxides, TiO2, Al2O3, MgO, and SiO2. The surface Ru site structure, formed under various catalyst preparation and reaction conditions, was investigated by the Ru K-edge extended X-ray absorption fine structure (EXAFS). Samples of [Ru6C(CO)16](2-)/TiO2(anatase) and [Ru6C(CO)16](2-)/TiO2(rutile) were found to retain the original Ru6C framework when heated in the presence of NO (2.0 kPa) or NO (2.0 kPa) + CO (2.0 kPa) at 423 K, i.e., catalytic reaction conditions for NO decomposition. At 523 K, the Ru-Ru bonds of the Ru6C framework were cleaved by the attack of NO. In contrast, the Ru site became spontaneously dispersed over TiO2 (anatase). When being supported over TiO2 (mesoporous), MgO, or Al2O3, the Ru6C framework split into fragments in gaseous NO or NO + CO even at 423 K. The Ru6 framework of [Ru6(CO)18](2-) was found to break easily into smaller ensembles in the presence of NO and/or CO at 423 K on support. Taking into consideration the realistic environments in which these catalysts will be used, we also examined the effect of water and oxygen. When water was introduced to the sample [Ru6C(CO)16](2-)/TiO2(anatase) at 423 K, it did not have any effects on the stabilized Ru6C framework structure. In the presence of oxygen gas, however, the Ru hexanuclear structure decomposed into isolated Ru cations bound to surface oxygen atoms of TiO2 (anatase).
Madyastha, Prof. Kattigari Madhava
Indian Academy of Sciences (India)
Pune), FNASc. Date of birth: 22 July 1937. Specialization: Bio-organic Chemistry, Xenobiotics Metabolism, Plant Biochemistry and Microbial Transformations Address: 162, Srikrishna, 5th Main, 4th Cross, NGEF Layout, Sanjay Nagar, Bengaluru ...
1989-01-01
NSV Liidu seaduse "Kodanike õigusi ahistava riigijuhtimisorganite ja ametiisikute õigusvastase tegevuse peale kohtusse kaebamise korrast" kehtestamise kohta vt. Eesti Jurist 1990 nr. 2, lk. 162-163 (NSVL RKÜT 1989 nr. 22 art. 417)
2017-2018 Hospitality Expense Reports for Jean Lebel, President
International Development Research Centre (IDRC) Digital Library (Canada)
SD
Page 1. Description: Lunch - Discuss programming with rural development research partners. Date: 2017-04-12. Attendees: 7 (IDRC 3). Location: Ottawa. Total: $162.00. Comments: 2017-2018 Hospitality Expense Reports for Jean Lebel, President.
Czech Academy of Sciences Publication Activity Database
Kamarainen, J.; Knoop, H.; Stanford, N.; Guerrero, F.; Akhtar, M. K.; Aro, E. M.; Steuer, Ralf; Jones, P. R.
2012-01-01
Roč. 162, č. 1 (2012), s. 67-74 ISSN 0168-1656 Institutional support: RVO:67179843 Keywords : Cyanobacteria * Hydrocarbon * Fuel * Toxicity * Stoichiometric potential Subject RIV: EH - Ecology, Behaviour Impact factor: 3.183, year: 2012
Chemical plant factors affecting resistance in sugarcane in against Scirpophaga Nivella f
International Nuclear Information System (INIS)
Ashfaq, M.; Khan, A.; Ali, A.
2003-01-01
The study was conducted during 2000 to determine the role of various chemical plant factors viz., total minerals, nitrogen, fat contents, carbohydrate, macro an micro nutrients in the leaves of five genotypes of sugarcane i.e., BF-162, SPSG-26, L-118, CP-43/33 and CP-72/2086 by correlating the infestation of top borer, Scirpophaga Nivella F. at tillering stage. None of the genotype was found completely resistant to the pest. CP-43/33 and BF-162 proved susceptible and resistant varieties, respectively. Total mineral, manganese and copper contents did not show significant correlation with the pest infestation, whereas nitrogen, potassium, calcium, magnesium and ferrous contents played a positive and significant role. Phosphorous, carbohydrates, fats and zinc contents played a significant and negative effect on the pest infestation at tillering stage. (author)
Shell model Monte Carlo investigation of rare earth nuclei
International Nuclear Information System (INIS)
White, J. A.; Koonin, S. E.; Dean, D. J.
2000-01-01
We utilize the shell model Monte Carlo method to study the structure of rare earth nuclei. This work demonstrates the first systematic full oscillator shell with intruder calculations in such heavy nuclei. Exact solutions of a pairing plus quadrupole Hamiltonian are compared with the static path approximation in several dysprosium isotopes from A=152 to 162, including the odd mass A=153. Some comparisons are also made with Hartree-Fock-Bogoliubov results from Baranger and Kumar. Basic properties of these nuclei at various temperatures and spin are explored. These include energy, deformation, moments of inertia, pairing channel strengths, band crossing, and evolution of shell model occupation numbers. Exact level densities are also calculated and, in the case of 162 Dy, compared with experimental data. (c) 2000 The American Physical Society
Hubungan Self Monitoring Dengan Impulsive Buying Terhadap Produk Fashion Pada Remaja
Directory of Open Access Journals (Sweden)
Anastasia Anin F
2015-11-01
Full Text Available The aim of this study is to investigate the relationship between self monitoring and impulsive buying towards fashion product on adolescent. It was hypothesized that there is a positive relationship between self monitoring and impulsive buying towards fashion product on adolescent. The subjects of this study (N = 92 were the students of Faculty of Economy Gadjah Mada University, Yogyakarta. Two questionnaires were applied to measure self monitoring and impulsive buying towards fashion product on adolescent. The result indicated a positive and significant relationship between attitude towards modernization and entrepreneurship on adolescent (r = 0,402; p = 0,000, meaning that the research hypothesis was accepted. The determination coefficient was 0,162 indicating that the self monitoring contributes 16,2% to the impulsib\\ve buying toward fashion product on adolescent.
DIFFUSION OF INNOVATION IN MODERN SCHOOL
Directory of Open Access Journals (Sweden)
Lazar Stosic
2013-06-01
Full Text Available This paper presents the results of research aimed to examine how teachers are interested in the application of innovation in teaching and in their personal development. An attempt was made to determine their opinion on the application of innovation in education. Sample consisted of 162 teachers (N = 162 in primary and secondary schools. We used the technique of scaling and instrument evaluation scale that was specifically designed for this research. The results show that teachers easily and smoothly implement innovations in their educational work and the knowledge gained by applying innovation far better in terms of practical application and durability of the knowledge acquired without the use of innovation. A qualitative analysis has shown that the majority of respondents had positive views of the use of innovations in their schools.
Castellanos, Daniel; Kosoy, Jennifer Ellyn; Ayllon, Karla Diaz; Acuna, Juan
2016-10-01
This study examines the association between the presence of drugs and alcohol at time of suicide in Hispanic versus non-Hispanic youth suicide victims in Miami-Dade County, Florida. The Medical Examiner's records of 435 persons aged 24 years or younger classified as suicides in Miami-Dade County, Florida, from 1990 to 2011 were reviewed. Hispanic youth in Miami-Dade County, Florida were 1.62 times more likely than non-Hispanic youth to have used drugs and alcohol at time of suicide (OR 1.62; 95 % CI 1.07-2.04; p = 0.049). Firearm use was significantly associated with drug and alcohol use at time of death. Use of drugs and alcohol at the time of death are important risk factors for suicide in Hispanic youth.
Elucidating the molecular physiology of lantibiotic NAI-107 production in Microbispora ATCC-PTA-5024
DEFF Research Database (Denmark)
Gallo, Giuseppe; Renzone, Giovanni; Palazzotto, Emilia
2016-01-01
by a complex regulatory and metabolic network that may be elucidated by the integration of genomic, proteomic and bioinformatic tools. Accordingly, an extensive evaluation of the proteomic changes associated with NAI-107 production was performed on Microbispora ATCC-PTA-5024 by combining two......; ii) during three time-points (117, 140, and 162 h) at D stage characterized by different profiles of NAI-107 yield accumulation (117 and 140 h) and decrement (162 h). Regulatory, metabolic and unknown-function proteins, were identified and functionally clustered, revealing that nutritional signals......, regulatory cascades and primary metabolism shift-down trigger the accumulation of protein components involved in nitrogen and phosphate metabolism, cell wall biosynthesis/maturation, lipid metabolism, osmotic stress response, multi-drug resistance, and NAI-107 transport. The stimulating role on physiological...
Mathematical expression of discharge capacity of compound open ...
Indian Academy of Sciences (India)
value of 0.162 has the best performance, among the various analytical methods tested. ...... Iran, who introduced us to the advanced concept of compound open channel ... management in practice: Better water management for development ...
Lead contamination of an agricultural soil in the vicinity of a shooting range
Czech Academy of Sciences Publication Activity Database
Chrastný, V.; Komárek, M.; Hájek, Tomáš
2010-01-01
Roč. 162, 1-4 (2010), s. 37-46 ISSN 0167-6369 Institutional research plan: CEZ:AV0Z60050516 Keywords : lead * contamination * lead Subject RIV: EH - Ecology, Behaviour Impact factor: 1.436, year: 2010
National Oceanic and Atmospheric Administration, Department of Commerce — Site Palmyra Atoll, (5.88467, -162.10281 ) ARGOS ID 307-001. Time series data from this mooring provide high resolution sea surface temperature and conductivity, and...
Czech Academy of Sciences Publication Activity Database
Sabirianova Peter, K.; Švejnar, Jan; Terrell, D.
-, č. 72 (2005), s. 1-62 ISSN N Institutional research plan: CEZ:AV0Z70850503 Keywords : foreign direct investment * economic development * productivity * efficiency Subject RIV: AH - Economics http://hdl.handle.net/2027.42/61179
Transparent conducting film: Effect of mechanical stretching
Indian Academy of Sciences (India)
We describe in this paper a transparent conducting film (TCF). ... conducting carbon nanotube film which is crack-resistant for solar cell applications. ... CA 90095, USA; Nanocomp Technologies, Inc, 162 Pembroke Road, Concord, NH 03301 ...
Winter banding of passerines on the Alaska Peninsula
Department of the Interior — Between February 1969 and May 1973, bait traps were operated during winter at Cold Bay (55° 12' N, 162° 43' W), Alaska, headquarters of the Izembek National Wildlife...
Tse, Pui-Kwan
2011-01-01
Introduction China's dominant position as the producer of over 95 percent of the world output of rare-earth minerals and rapid increases in the consumption of rare earths owing to the emergence of new clean-energy and defense-related technologies, combined with China's decisions to restrict exports of rare earths, have resulted in heightened concerns about the future availability of rare earths. As a result, industrial countries such as Japan, the United States, and countries of the European Union face tighter supplies and higher prices for rare earths. This paper briefly reviews China's rare-earth production, consumption, and reserves and the important policies and regulations regarding the production and trade of rare earths, including recently announced export quotas. The 15 lanthanide elements-lanthanum, cerium, praseodymium, neodymium, promethium, samarium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium (atomic numbers 57-71)-were originally known as the rare earths from their occurrence in oxides mixtures. Recently, some researchers have included two other elements-scandium and yttrium-in their discussion of rare earths. Yttrium (atomic number 39), which lies above lanthanum in transition group III of the periodic table and has a similar 3+ ion with a noble gas core, has both atomic and ionic radii similar in size to those of terbium and dysprosium and is generally found in nature with lanthanides. Scandium (atomic number 21) has a smaller ionic radius than yttrium and the lanthanides, and its chemical behavior is intermediate between that of aluminum and the lanthanides. It is found in nature with the lanthanides and yttrium. Rare earths are used widely in high-technology and clean-energy products because they impart special properties of magnetism, luminescence, and strength. Rare earths are also used in weapon systems to obtain the same properties.
Creative Artist: A Journal of Theatre and Media Studies - Vol 9, No 1 ...
African Journals Online (AJOL)
A semiotic reading of costumes in Nigerian video films: African bride as a paradigm · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mary Nkechi Okadigwe, 139-162 ...
Specific Statistics of Czech Legislation
Czech Academy of Sciences Publication Activity Database
Novák, František
2015-01-01
Roč. 5, č. 3 (2015), s. 162-183 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : legislation * quantitative description of legislation * structure and development of the legislation in the CR Subject RIV: AG - Legal Sciences
Czech Academy of Sciences Publication Activity Database
Krepl, Miroslav; Clery, A.; Blatter, M.; Allain, F.H.T.; Šponer, Jiří
2016-01-01
Roč. 44, č. 13 (2016), s. 6452-6470 ISSN 0305-1048 Institutional support: RVO:68081707 Keywords : molecular- dynamics simulations * particle mesh ewald * pre-ribosomal-rna Subject RIV: BO - Biophysics Impact factor: 10.162, year: 2016
The Royal Summer Palace, Ferdinand I and Anne
Czech Academy of Sciences Publication Activity Database
Dobalová, Sylva
2015-01-01
Roč. 7, č. 2 (2015), s. 162-175 ISSN 1804-1132 Institutional support: RVO:68378033 Keywords : Anne of Jagiello * Prague Castle * Ferdinand I of Habsburg * olive tree * dynasticism Subject RIV: AL - Art, Architecture, Cultural Heritage
Delinquent directors under the Companies Act 71 of 2008: Gihwala ...
African Journals Online (AJOL)
Potchefstroom Electronic Law Journal/Potchefstroomse Elektroniese Regsblad ... 71 of 2008 infringed the constitutional right to dignity, the right to choose a trade, ... determining whether the offences set out in section 162(5) of the Companies ...
39 The Validity of Herzberg's Dual-Factor Theory on Job Satisfaction ...
African Journals Online (AJOL)
User
2012-01-24
Jan 24, 2012 ... But Herzberg's two-factor theory (also called motivation /Hygiene theory) has been ... democratic process and more importantly, it attracts the right calibre of politicians into ..... Journal of Applied Psychology pp.162. Francis ...
Wachs, Sebastian; Jiskrova, Gabriela Ksinan; Vazsonyi, Alexander T.; Wolf, Karsten D.; Junger, Marianne
2016-01-01
The present study reports frequency rates of cybergrooming, profiled characteristics of cybergrooming perpetrators, and examine direct and indirect associations between cyberbullying victimization, self-esteem, and cybergrooming victimization. The study sample included 2,162 adolescents between 11
ÿþE k a m e n S e p t 2 0 1 0 4 A j o l . c d r
African Journals Online (AJOL)
ÿþU s e r
1890), Kelly. (1893),Latzko (1942) .... General Five point occupational classification modified to suit our environment. A total of 4520 deliveries ... Vulval dermatitis/Vaginal Stenosis. 6. (16.2). Abdominalpains/swelling. 3. (8.1). Others. 4. (10.8).
Synthesis and crystal structure of tischendorfite, Pd8Hg3Se9
Czech Academy of Sciences Publication Activity Database
Laufek, F.; Vymazalová, A.; Drábek, J.; Navrátil, Jiří; Drahokoupil, Jan
2014-01-01
Roč. 26, č. 1 (2014), s. 157-162 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : tischendorfite * crystal structure * Pd-Hg selenides Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.483, year: 2014
Synthesis and crystal structure of tischendorfite, Pd.sub.8./sub.Hg.sub.3./sub.Se.sub.9./sub
Czech Academy of Sciences Publication Activity Database
Laufek, F.; Vymazalová, A.; Drábek, M.; Navrátil, J.; Drahokoupil, Jan
2014-01-01
Roč. 26, č. 1 (2014), s. 157-162 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : tischendorfite * crystal structure * Pd-Hg selenides Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.483, year: 2014
Behavior of bubbles in glass melts under effect of the gravitational and centrifugal fields
Czech Academy of Sciences Publication Activity Database
Němec, Lubomír; Tonarová, V.
2005-01-01
Roč. 49, č. 3 (2005), s. 162-169 ISSN 0862-5468 Institutional research plan: CEZ:AV0Z40320502 Keywords : glass refining * bubbles * modelling Subject RIV: CA - Inorganic Chemistry Impact factor: 0.463, year: 2005
Czech Academy of Sciences Publication Activity Database
Doroshenko, I.; Žurková, J.; Moravec, Z.; Bezdička, Petr; Pinkas, J.
2015-01-01
Roč. 26, SEP (2015), s. 157-162 ISSN 1350-4177 Institutional support: RVO:61388980 Keywords : Uranium * Phosphates * Sonochemistry * Nuclear waste * Trimethyl phosphate * Triethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 4.556, year: 2015
Karyotypes of the mammals of Turkey and neighbouring regions: a review
Czech Academy of Sciences Publication Activity Database
Arslan, A.; Zima, Jan
2014-01-01
Roč. 63, č. 1 (2014), s. 1-62 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : chromosomes * banding pattern * Balkan * Caucasus * Middle East * species * taxonomy Subject RIV: EG - Zoology Impact factor: 0.724, year: 2014
Search Results | Page 8 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 71 - 80 of 162 ... ... access to knowledge contained in learning resources and materials. ... health information systems in Africa using open technologies. ... divides, and highlight the need for comparative analysis of the use and impact of.
45 CFR 162.1202 - Standards for eligibility for a health plan transaction.
2010-10-01
... benefit inquiry and response. The ASC X12 Standards for Electronic Data Interchange Technical Report Type... Telecommunication Standard Implementation Guide, Version 5, Release 1 (Version 5.1), September 1999, and equivalent... supporting Telecommunications Standard Implementation Guide, Version 5, Release 1 (Version 5.1) for the NCPDP...
26 CFR 1.162-19 - Capital contributions to Federal National Mortgage Association.
2010-04-01
... issuance price (the amount of capital contributions evidenced by a share of stock) over the fair market... sale to FNMA of mortgage paper gives rise to the issuance of a share of FNMA stock during a taxable... gain or loss from the sale to FNMA of mortgage paper, with respect to which a share of FNMA stock is...
Measurement of dose equivalent distribution on-board commercial jet aircraft
Czech Academy of Sciences Publication Activity Database
Kubančák, Ján; Ambrožová, Iva; Ploc, Ondřej; Pachnerová Brabcová, Kateřina; Štěpán, Václav; Uchihori, Y.
2014-01-01
Roč. 162, č. 3 (2014), s. 215-219 ISSN 0144-8420 Institutional support: RVO:61389005 Keywords : aircrew dosimetry * space weather * CERF Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.913, year: 2014
African Journals Online (AJOL)
Items 51 - 100 of 162 ... ... on sodium nitrite‑induced cerebellar cortex toxicity in adult Wistar rats, Abstract .... Vol 14, No 2 (2015), Histopathological effects of acetaminophen ... extracts of Garcinia Kola on acetaminophen-Induced liver injury in ...
Fast 2D Fluid-Analytical Simulation of IEDs and Plasma Uniformity in Multi-frequency CCPs
Kawamura, E.; Lieberman, M. A.; Graves, D. B.
2014-10-01
A fast 2D axisymmetric fluid-analytical model using the finite elements tool COMSOL is interfaced with a 1D particle-in-cell (PIC) code to study ion energy distributions (IEDs) in multi-frequency argon capacitively coupled plasmas (CCPs). A bulk fluid plasma model which solves the time-dependent plasma fluid equations is coupled with an analytical sheath model which solves for the sheath parameters. The fluid-analytical results are used as input to a PIC simulation of the sheath region of the discharge to obtain the IEDs at the wafer electrode. Each fluid-analytical-PIC simulation on a moderate 2.2 GHz CPU workstation with 8 GB of memory took about 15-20 minutes. The 2D multi-frequency fluid-analytical model was compared to 1D PIC simulations of a symmetric parallel plate discharge, showing good agreement. Fluid-analytical simulations of a 2/60/162 MHz argon CCP with a typical asymmetric reactor geometry were also conducted. The low 2 MHz frequency controlled the sheath width and voltage while the higher frequencies controlled the plasma production. A standing wave was observable at the highest frequency of 162 MHz. Adding 2 MHz power to a 60 MHz discharge or 162 MHz to a dual frequency 2 MHz/60 MHz discharge enhanced the plasma uniformity. This work was supported by the Department of Energy Office of Fusion Energy Science Contract DE-SC000193, and in part by gifts from Lam Research Corporation and Micron Corporation.
2011-04-28
... royalties of $10 per acre and 16\\2/3\\ percent. The lessee paid the $500 administration fee for the... terms and conditions of the leases; The increased rental of $10 per acre; The increased royalty of 16\\2...
Lifescience Database Archive (English)
Full Text Available tting of euvolemia, without evidence of renal disease or thyroxine or cortisol deficiency. Treatment options...rmone: current and future management options. ... JOURNAL ... Eur J Endocrinol 162 Suppl 1:S13-8 (2010) DOI:10.1
Je náboženství důležité pro ekonomický rozvoj?
Czech Academy of Sciences Publication Activity Database
Hamplová, Dana
2009-01-01
Roč. 11, č. 1 (2009), s. 143-162 ISSN 1212-8112 R&D Projects: GA ČR GA403/08/0720 Institutional research plan: CEZ:AV0Z70280505 Keywords : Religion * economy Subject RIV: AO - Sociology, Demography
2010-05-11
... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
2010-05-10
... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
Czech Academy of Sciences Publication Activity Database
Feng, Z.; Wang, J.; Bek, Jiří
2008-01-01
Roč. 149, 3-4 (2008), s. 150-162 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z30130516 Keywords : lycopsids * in situ spores * sigillarian * monosporangiate Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.325, year: 2008
Czech Academy of Sciences Publication Activity Database
Çimen, H.; Půža, Vladimír; Nermuť, Jiří; Hatting, J.; Ramakuwela, T.; Faktorová, Lucie; Hazir, S.
2016-01-01
Roč. 18, č. 4 (2016), s. 439-453 ISSN 1388-5545 R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : description * molecular * morphology Subject RIV: EG - Zoology Impact factor: 1.162, year: 2016
Phasmarhabditis apuliae n. sp. (Nematoda: Rhabditidae), a new rhabditid nematode from milacid slugs
Czech Academy of Sciences Publication Activity Database
Nermuť, Jiří; Půža, Vladimír; Mráček, Zdeněk
2016-01-01
Roč. 18, č. 9 (2016), s. 1095-1112 ISSN 1388-5545 R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : bionomics * description * Italy Subject RIV: EG - Zoology Impact factor: 1.162, year: 2016
Arabidopsis CDS blastp result: AK063995 [KOME
Lifescience Database Archive (English)
Full Text Available AK063995 001-124-E11 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehy...drogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...
Arabidopsis CDS blastp result: AK101517 [KOME
Lifescience Database Archive (English)
Full Text Available AK101517 J033046H09 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehyd...rogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...
Adolescents beliefs of the role of self concept and government policy ...
African Journals Online (AJOL)
-entry of adolescents into school in Abia State. Four continuing education and two skills acquisition schools were randomly selected for the study. One hundred and sixty two (162) adolescents who re-enrolled in these schools participated in ...
the place of quinolones in the treatment of enteric fevers in the 21st ...
African Journals Online (AJOL)
Dr. Jombo
conducted to verify the view that poverty influences the incidence and ... sample of 274 subjects: males (162/59%) and females (112/41%) within the economically ..... India. Intl. J. Tubercl. Lung Dis. 3:869–877. World. Health. Organization.
ELEVATION ON BOINLING POINT OF COFFE EXTRACT
Directory of Open Access Journals (Sweden)
Telis-Romero J.
2002-01-01
Full Text Available The rise in boiling point of coffee extract was experimentally measured at soluble solids concentrations in the range of 9.2 to 52.4ºBrix and pressures between 5.8 × 10³ and 9.4 × 10(4 Pa (abs.. Different approaches to representing experimental data, including the Dühring's rule, the Antoine equation and empirical models proposed in the literature were tested. In the range of 9.2 to 16.2ºBrix, the rise in boiling point was nearly independent of pressure, varying only with extract concentration. Considerable deviations of this behavior began to occur at concentrations higher than 16.2ºBrix. Experimental data could best be predicted by adjusting an empirical model which consists of a single equation that takes into account the dependence of rise in boiling point on pressure and concentration.
Contaminação por chumbo na serrapilheira do Parque Nacional da Tijuca - RJ
Directory of Open Access Journals (Sweden)
Rogério Ribeiro de Oliveira
1987-12-01
Full Text Available As matas formadoras do Parque Nacional da Tijuca, Rio de Janeiro, apresentaram em sua serrapilheira um teor médio de chumbo de 16,2 µg/g ao longo de um ano. A entrada do metal no sistema via queda da serrapilheira foi de 140 g/ha/ano. O Pb atinge o sistema florestal pela deposição atmosférica, e tem origem provável na queima de combustíveis (gasolina e petróleoAnalysis of the litter layer of the Tijuca National Park rainforest revealed an average annual lead concentration of 16.2 µg/g. Rate of lead in the litter fall was 140 g/ha/yr. Lead en ters the forest ecosystem by way of the atmosphere, gasoline usage and petroleum combustion being the most probable causes
1987-10-01
abstract display format (Williams & Flexman, 1949; Flexman, Matheny, & Brown, 1950; Flexman, Townsend, and Ornstein, 1954; Creelman , 1959; Hennessy, Lintern...Resources Laboratory. Creelman , J. A. (1959). Evaluation of approach training procedures. Pensacola, FL: US. Naval School of Aviation Medicine, 162
2010-05-11
... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...
South African Journal of Geomatics - Vol 1, No 2 (2012)
African Journals Online (AJOL)
A Comparison of Close-Range Photogrammetry to Terrestrial Laser Scanning for Heritage Documentation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Rüther, J Smit, D Kamamba, 149-162 ...
Search Results | Page 52 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 511 - 520 of 9602 ... ... Economics (172) Apply Economics filter · WOMEN'S RIGHTS (162) ... Ecohealth Emerging Infectious Diseases Research Initiative (2) Apply ... Perspectives on public sector antiretroviral access ... Journal articles ... Trade liberalisation and economic growth : empirical evidence on Bangladesh.
together towards new life for missiology? mission and missiology
African Journals Online (AJOL)
2013-11-04
Nov 4, 2013 ... “Together towards life – mission and evangelism in changing landscapes”. This is .... from the CWME and three WCC mission-related networks were engaged ... Much later, Moltmann (2010:162) articulated it in a very powerful ...
Search Results | Page 10 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 91 - 100 of 162 ... Hungry Cities Initiative: Informality, Inclusive Growth, and Food Security in Cities of the Global South. As urban populations grow in developing countries, promoting inclusive growth that ensures food security for all is critical. Project.
Liszt. Concertos for Piano and Orchestra / Bryce Morrison
Morrison, Bryce
1993-01-01
Uuest heliplaadist "Pärt: Te Deum. Silouans Song. "My soul yearns after the Lord...". Magnificat. Berliner Messe. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra/Tõnu Kaljuste." ECM New Series 439 162-2 (66 minutes: DDD). Texts and translations included
Palmyra Island Monthly Oxygen Isotope Data (delta 18O) for 1886-1998
National Oceanic and Atmospheric Administration, Department of Commerce — Palmyra Island Monthly Coral Oxygen Isotope Data. 112-yr, monthly-resolved coral record from Palmyra Island (5 deg 52 min N, 162 deg 8 min W). The coral was drilled...
Dotazník proaktivního zvládání životních nároků
Czech Academy of Sciences Publication Activity Database
Šolcová, Iva; Lukavský, Jiří; Greenglass, E.
2006-01-01
Roč. 50, č. 2 (2006), s. 148-162 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : Proactive coping Inventory * psychometric properties * Czech adaptation Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006
NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0499 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-162 80% ...
77 FR 42175 - Securities Act Industry Guides
2012-07-18
... June 30, 2009, the Financial Accounting Standards Board (``FASB'') issued FASB Statement of Financial... Accepted Accounting Principles--a replacement of FASB Statement No. 162 (``Statement No. 168''), to establish the FASB Codification as the source of authoritative non-Commission accounting principles...
African Journals Online (AJOL)
16(2) ... or short children. In certain subgroups, e.g. brain injury and blunt trauma, higher SBP seems to improve outcome. In everyday anaesthesia practice, SBP is monitored more often than MAP. .... of television watched per day. Although we ...
South African Journal of Higher Education - Vol 21, No 1 (2007)
African Journals Online (AJOL)
Burnout and engagement in university students: A psychometric analysis of the MBI-SS and UWES-S · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Mostert, J Pienaar, C Gauche, LTB Jackson, 147-162 ...
African Journals Online (AJOL)
Annals of Pediatric Surgery 2016, 12:162–163 ... management of different medical and surgical pediatric conditions. ... After induction of anesthesia, a size 12F NGT was inserted ... tube is the main risk factor predisposing to self-tube knotting ...
Search Results | Page 6 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 51 - 60 of 162 ... Farmers' perceptions lead to experimentation and learning ... Climate change ADAPTATION ENVIRONMENTAL EDUCATION ... Research leading to accessible public education and responsive community-based ... The social sciences literature and policymakers often take for granted that positive ...
Control of the maximal chlorophyll fluorescence yield by the Q(B) binding site
Czech Academy of Sciences Publication Activity Database
Prášil, Ondřej; Kolber, Z. S.; Falkowski, P. G.
2018-01-01
Roč. 56, č. 1 (2018), s. 150-162 ISSN 0300-3604 R&D Projects: GA MŠk(CZ) LO1416 Institutional support: RVO:61388971 Keywords : conformational change * electron transport * photosystem II OBOR OECD: Microbiology Impact factor: 1.507, year: 2016
Antioxidačné posobenie serotonínu - účinok na chemiluminiscenciu bunkových a bezbunkových systémov
Czech Academy of Sciences Publication Activity Database
Jančinová, V.; Drábiková, K.; Číž, Milan; Nosál, R.; Lojek, Antonín
2001-01-01
Roč. 50, č. 4 (2001), s. 162 ISSN 1210-6313. [Farmakologické dny /51./. 05.09.2001-07.09.2001, Hradec Králové] Institutional research plan: CEZ:AV0Z5004920 Keywords : serotonin * chemiluminescence Subject RIV: BO - Biophysics
Search Results | Page 12 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 111 - 120 of 162 ... Although birth and death rates are still relatively high in Africa, African populations display some of the most youthful age structures in the world. ... Because of the prevalence and intensity of poverty, populations in ...
Assessment of Tigecycline Prescription and Patients' Outcomes at ...
African Journals Online (AJOL)
Susceptibility testing revealed 22 different bacterial pathogens, most commonly Acinetobacter baumannii (20 patients) and Klebsiella pneumoniae (14 patients). A significant proportion (56.7 %) was polymicrobial and 16.2. % involved suspected resistant pathogens. Sixteen patients recovered (5 on tigecycline alone, 5 with.
Estimating the burden of disease attributable to low fruit and ...
African Journals Online (AJOL)
, ischaemic stroke, lung cancer, gastric cancer, colorectal cancer and oesophageal cancer.Results. Low fruit and vegetable intake accounted for 3.2% of total deaths and 1.1 % of the 16.2 million attributable DALYs. For both males and females ...
2011-01-25
... DEPARTMENT OF TRANSPORTATION Maritime Administration [USCG-2010-0993] Liberty Natural Gas LLC, Liberty Liquefied Natural Gas (LNG) Deepwater Port License Application AGENCY: Maritime Administration... application describes an offshore natural gas deepwater port facility that would be located approximately 16.2...
Dextran-modified iron oxide nanoparticles
Czech Academy of Sciences Publication Activity Database
Hradil, Jiří; Pisarev, A. G.; Babič, Michal; Horák, Daniel
2007-01-01
Roč. 5, 1-2 (2007), s. 162-168 ISSN 1672-2515 R&D Projects: GA ČR GA203/05/2256 Institutional research plan: CEZ:AV0Z40500505 Keywords : iron oxide * nanoparticles * dextran Subject RIV: CD - Macromolecular Chemistry
Czech Academy of Sciences Publication Activity Database
Štillová, K.; Jurák, Pavel; Chládek, Jan; Chrastina, J.; Halámek, Josef; Bočková, M.; Goldemundová, S.; Říha, I.; Rektor, I.
2015-01-01
Roč. 56, S1 (2015), s. 162 ISSN 0013-9580. [International Epilepsy Congress /31./. 05.09.2015-09.09.2015, Istanbul] Institutional support: RVO:68081731 Keywords : anterior nuclei * thalamus * hippocampus * visual * verbal memory Subject RIV: BH - Optics, Masers, Lasers
KINETIC AND EQUILIBRIUM STUDIES OF Pb(II) AND Cd(II ...
African Journals Online (AJOL)
manual blender to smaller particles followed by grinding and then sieved with 300 µm sieve size. ... values of Qmax and b were calculated from the slope and intercept of the Langmuir plot of Ce versus Ce/Qe. .... Moisture content. 16.2.
design and development of a soap stamping and tableting machine
African Journals Online (AJOL)
2012-07-02
Jul 2, 2012 ... for these two operations. The manual ... chine, the cutting and stamping operations were done at different .... slack side belt tensions Tj were determined as 131.66N and 162.71N for the .... vironmental Management, Vol. 6, No.
Airborne Gravity: NGS' Gravity Data for MS02 (2016)
National Oceanic and Atmospheric Administration, Department of Commerce — Airborne gravity data over southern Arizona and New Mexico overlapping into Mexico collected in 2016 over 2 surveys, AZ16-1 and AZ16-2. This data set is part of the...
Blasfemie persifláž, mystifikace? Postmodernistické hříčky s klasiky
Czech Academy of Sciences Publication Activity Database
Filipský, Jan; Malina, J.
2011-01-01
Roč. 2, č. 1 (2011), s. 143-162 ISSN 1804-6657 Institutional research plan: CEZ:AV0Z90210515 Keywords : Postmodernism * science and art Subject RIV: AC - Archeology, Anthropology, Ethnology http://anthrop.sci.muni.cz/page.yhtml?id=532
2010-01-01
... dynamic load guides fabricated as shown in figure L, or an equivalent impact-testing machine. EC03OC91.029...-pound (4,448-newton) tensile capacity. Attach a 162-pound (73.5-kg) weight to this cable at least 4 feet...
Preventing perinatal HIV transmission in developing countries - do ...
African Journals Online (AJOL)
Survivors of Violence, reports that in 1995, 16.2% of HIV- positive people were reported to be .... very late in pregnancy, too late to receive the ACTG 076 regimen.3. 2. .... pharmaceutical companies and global institutional programmes such as ...
Health problems of children with disabilities with special reference to ...
African Journals Online (AJOL)
admin
Conclusion: Majority of CWDs were not enjoying the health care provisions available in the study area because of the .... justice offices, the health office, the labor and social .... reasons (25.4 %), accidents (16.2%), hereditary (1.7%) and other ...
Czech Academy of Sciences Publication Activity Database
Boccaccini, D. N.; Ševeček, O.; Frandsen, L. H.; Dlouhý, Ivo; Molin, S.; Cannio, M.; Hjelm, J.; Hendriksen, P. V.
2016-01-01
Roč. 162, č. 1 (2016), s. 250-253 ISSN 0167-577X Institutional support: RVO:68081723 Keywords : Metal-ceramic bond strength * Schwickerath crack-initiation test * SOC interfaces Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.572, year: 2016
Czech Academy of Sciences Publication Activity Database
Čechová, Dana
2001-01-01
Roč. 66, č. 2 (2001), s. 151-152 ISSN 0366-0486 R&D Projects: GA ČR GV524/96/K162 Institutional research plan: CEZ:AV0Z5052915 Keywords : gametes * sperm * eggs Subject RIV: EB - Genetics ; Molecular Biology
Spectroscopy of very neutron-deficient hafnium and tungsten isotopes
Energy Technology Data Exchange (ETDEWEB)
Dracoulis, G D; Fabricius, B; Davidson, P M [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics; Macchiavelli, A O; Oliviera, J; Burde, J; Stephens, F; Deleplanque, M A [Lawrence Berkeley Lab., CA (United States)
1992-08-01
Level schemes of the very neutron-deficient isotopes {sup 158}Hf and {sup 162}W have been identified, and that for {sup 164}W extended. Alignment of the H{sub 9/2} neutrons is suggested. (author). 12 refs., 7 figs.
Antibodies against Shigella flexneri adhesion molecule outer ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research February 2017; 16 (2): 255-261 ... Milliana et al. Trop J Pharm Res, February 2017; 16(2): 256 .... Significance level was set at p ˂. 0.05. ..... labile colonization factor antigen (CFA/II) produced by.
Specifika vegetace kolem silnic a dálnic - problematika začlenění dřevin do volné krajiny
Czech Academy of Sciences Publication Activity Database
Cimbůrková, Miroslava; Šerá, Božena
2011-01-01
Roč. 45, č. 3 (2011), s. 162-165 ISSN 0044-4863 R&D Projects: GA MŠk OC10032 Institutional research plan: CEZ:AV0Z60870520 Keywords : road * tree * planning Subject RIV: AP - Urban, Regional and Transport Planning
A general lexicographic model for a typological variety of ...
African Journals Online (AJOL)
user
model en die (leë) databasis met al die grafiese koppelvlakke wat ontwikkel is teen die middel van .... polysemous senses of a word — the above-mentioned disadvantages (see sec- ...... Nordic Journal of African Studies 16(2): 131-145. Bosch ...
Assessment of the effect of nanomaterials on sediment-dwelling invertebrate Chironomustentans larvae
CSIR Research Space (South Africa)
Oberholster, Paul J
2011-03-01
Full Text Available in Icttalurus melas under mercury exposure. Ecotoxicol. Environ. Saf. 55, 162?167. Everse, J., Johnson, M.C., Marini, M.A., 1990. Peroxidative activities of hemoglobin and hemoglobin derivatives. Methods Enzymol. 186, 547?561. Fortner, J.D., Lyon, D...
Odpadní pivovarské a vinařské kvasinky jako surovina pro biotechnologické výroby
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Palyzová, Andrea; Sigler, Karel
2017-01-01
Roč. 63, č. 4 (2017), s. 158-162 ISSN 0023-5830 R&D Projects: GA MŠk(CZ) LO1509 Institutional support: RVO:61388971 Keywords : waste brewery yeast * waste wine yeast Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology
Czech Academy of Sciences Publication Activity Database
Egea, J.; Křen, Vladimír; Valentová, Kateřina
2017-01-01
Roč. 13, OCT2017 (2017), s. 94-162 ISSN 2213-2317 Institutional support: RVO:61388971 Keywords : Reactive oxygen species * Reactive nitrogen species * Redox signaling Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.337, year: 2016
Kuidas kirjutatakse ajalugu? / Natalie Zemon Davis ; interv. Marek Tamm
Davis, Natalie Zemon
2007-01-01
Ülevaade Princentoni Ülikooli emeriitprofessori ja Ameerika Ajalooühingu endise presidendi N. Z. Davis'e teostest. Varem ilm.: Ajalugu, filmikunst ja heidikud : intervjuu Natalie Zemon Davisega // Davis, Natalie Zemon. Martin Guerre'i tagasitulek. - Tallinn, 2002. - Lk. 162-177
SwissProt search result: AK110194 [KOME
Lifescience Database Archive (English)
Full Text Available AK110194 002-162-A11 (Q13118) Transforming growth factor-beta-inducible early growth... response protein 1 (TGFB-inducible early growth response protein 1) (TIEG-1) (Krueppel-like factor 10) (EGRalpha) KLF10_HUMAN 2e-11 ...
SwissProt search result: AK110195 [KOME
Lifescience Database Archive (English)
Full Text Available AK110195 002-162-A12 (O14901) Transforming growth factor-beta-inducible early growth... response protein 2 (TGFB-inducible early growth response protein 2) (TIEG-2) (Krueppel-like factor 11) KLF11_HUMAN 3e-19 ...
2016-06-10
officer, it is necessary, both for the researcher and for its readers, to opt for a position of cultural relativism .96 Moreover, national culture...also sometimes to ethical fade, in which dishonesty to answer an allegedly meaningless 162 Richard D
Lygidakis, N A; Dimou, G; Marinou, D
2008-12-01
This was to examine the potential medical aetiological factors involved in the development of MIH. During the years 2003--2005, all MIH cases diagnosed according to set criteria were selected from the new patients clinic of a Community Dental Centre for Children (Athens). The age, gender and teeth involved were recorded. A control group of socio-demographically matched controls was also identified. The potential aetiological factors were retrieved through personal interview with the parents and from each child and mother's medical book. Only verified aetiological factors were recorded. Evaluation of the correlation of affected teeth and the timing of the insult was performed in a separate group of 225 affected children aged 8-12 with their entire 12 'index' teeth erupted. From the 3,518, 5.5 to 12 years old children examined, 360 (10.2%) had MIH. Aetiology of MIH: 44 children (12.2%), presented without any relevant medical history, the remaining 316 (87.8%) recorded various medical problems associated with MIH, compared with 18.9% for controls. Perinatal (163, 33.6%) and postnatal (162, 33.9%) problems were the most frequently found and prenatal the least (33, 8.6%). For 42 children (11.7%) problems occurred in more than one chronological period, mainly during both the perinatal and postnatal period (11.1%). The most common prenatal problem was repeated episodes of high fever (12/33), in the perinatal period birth by Caesarean section (92/163) and other birth complications (34/163). Various respiratory conditions (88/162), repeated episodes of high fever (31/162) and neonatal illness (28/162) were the commonly reported problems in the postnatal period. Many MIH cases presented with more than one medical problem during the peri-and postnatal period. Children with MIH recorded 68.9% more frequent medical problems than controls (pMIH children with all their 'index' teeth erupted. Children with MIH present with more medical problems than controls during their prenatal
Hein, Jonas; Guarin, Alejandro; Frommé, Ezra; Pauw, W.P.
2018-01-01
More than ten years after REDD + (Reducing Emissions from Deforestation and forest Degradation) entered the UN climate negotiations, its current state and future direction are a matter of contention. This paper analyses 162 INDCs (Intended National Determined Contributions), or climate action plans,
Innovative haematological parameters in clinical practice
Schoorl, M.
2015-01-01
Anaemia is a global public health problem affecting populations in both developing and developed countries. According to the World Health Organisation (WHO) anaemia affects 1.62 billion people, which corresponds to 25% of the world population. In case of anaemia microcytic erythropoiesis is
African Journals Online (AJOL)
PROF. EZECHUKWU
2014-02-11
Feb 11, 2014 ... compared with non-infants (21.1% [8/38] vs. 8.6%. [14/162]; odds .... formulated in tablet form, does not achieve optimal blood levels,2 and .... school children in Enugu. Orient J. Med 2005 ... Nelson Textbook of. Paediatrics ...
Comparative physico-chemical and proximate analysis of oils of ...
African Journals Online (AJOL)
shyn
2015-08-05
Aug 5, 2015 ... of oils of Shea nut, Sesamum indicum, Cucurbita pepo,. Cucumis melo ..... 1.62 mgKOH/g) which is lower than that of olive oil 17. mgKOH/g (Oyedele ..... Oyedele AO (2002). The Skin Tolerance of Shea Fat Employed as.
Taxonomic revision of Sorbus subgenus Aria occurring in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Lepší, M.; Lepší, P.; Koutecký, P.; Bílá, J.; Vít, Petr
2015-01-01
Roč. 87, č. 2 (2015), s. 109-162 ISSN 0032-7786 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : apomixis * DAPI flow cytometry * hybridization Subject RIV: EF - Botanics Impact factor: 2.711, year: 2015
Mayer, Richard E.; Sims, Valerie K.
1994-01-01
In 2 experiments, 162 high- and low-spatial ability students viewed a computer-generated animation and heard a concurrent or successive explanation. The concurrent group generated more creative solutions to transfer problems and demonstrated a contiguity effect consistent with dual-coding theory. (SLD)
Czech Academy of Sciences Publication Activity Database
Baruš, Vlastimil; Foitová, I.; Koubková, B.; Hodová, I.; Šimková, A.; Nurcahyo, W.
2007-01-01
Roč. 44, č. 4 (2007), s. 162-169 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : Pongobius hugoti * Nematoda * Pongo abelii * orangutan * Sumatra * morphometric and molecular analyses Subject RIV: EG - Zoology Impact factor: 0.373, year: 2007
Prior art relevant to active beads patent application
CSIR Research Space (South Africa)
Moolman, S
2002-06-01
Full Text Available -extrusion of shell (gelatin) and core (oral refrigerant or spice condiment) US 4,332,790 Nestlé patent on manufacturing fat microcapsules containing micro-organisms Patents cited by International Search Report on previous application US 5,543,162 Polymeric...
Maize cob losses and their effects on the poverty status of maize
African Journals Online (AJOL)
This study analysed fresh maize cob losses and its effect on the poverty status of maize farmers in Edo State,. Nigeria. The specific .... is the poverty gap for ... Total cost. 162,367.48. 100.00. Returns. Total expected yield (N). 327,966.63. _.
Average biomass of four Northwest shrubs by fuel size class and crown cover.
Robert E. Martin; David W. Frewing; James L. McClanahan
1981-01-01
The average biomass of big sagebrush (Artemisia tridentata Nutt.), antelope bitterbrush (Purshia tridentata (Pursh) DC.), snowbrush ceanothus (Ceanothus velutinus Dougl. ex Hook.), and greenleaf manzanita (Arctostaphylos patula Greene) was 6.1, 5.1, 10.7, and 16.2 tons per acre (13.9,...
Search Results | Page 9 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 81 - 90 of 162 ... It was recommended that national teams meet to develop a publications ... Panafrican Research Agenda on the Pedagogical Integration of Information and Communication ... of concern influences lecturers rate of adoption of e-learning ... AFRICA CURRICULUM DEVELOPMENT TEACHER TRAINING ...
Degree-regular triangulations of torus and Klein bottle
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
. E-mail: dattab@math.iisc.ernet.in; upadhyay@math.iisc.ernet.in. MS received 26 August 2004; revised 10 May ...... Comb. Th. (A) 75 (1996) 148–162. [4] Bagchi B and Datta B, A structure theorem for pseudomanifolds, Discrete Math. 168.
L. Harrison: Mass (to St. Anthony); A. Pärt: Berliner Messe / Robert Cowan
Cowan, Robert
1994-01-01
Uuest heliplaadist "L. Harrison: Mass (to St. Anthony); A. Pärt: Berliner Messe. Oregon Repertory Singers / Gilbert Seeley. Koch International Classics CD 37 177-2; Pärt - comparative version: Estonian Phil. Chbr. Ch., Tallinn CO / Kaljuste" (11/93)(ECM) 439 162-2
Search Results | Page 686 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 6851 - 6860 of 9602 ... ... WOMEN'S RIGHTS (162) Apply WOMEN'S RIGHTS filter .... Toward Improved Market Access for ASEAN Agricultural Commodities ... in Agriculture and Water Resources in the Greater Horn of Africa ... Tunisia is an arid country, where water scarcity significantly limits agricultural production.
Fast blood plasma separation device for point-of-care applications
Czech Academy of Sciences Publication Activity Database
Ďurč, P.; Foret, František; Kubáň, Petr
2018-01-01
Roč. 183, JUN (2018), s. 55-60 ISSN 0039-9140 Institutional support: RVO:68081715 Keywords : blood plasma separation * capillary electrophoresis * point of care analysis * methanol * metabolites Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 4.162, year: 2016
Hazardous Waste Cleanup: AGFA Corporation - Peerless Photo Products in Shoreham, New York
The site is located on approximately 16.2 acres in a predominantly residential area. The site was originally developed in 1903 when Nikola Tesla constructed a building that served as a residence and a laboratory. Mr. Tesla also constructed a radio tower on
Evaluation of Irvingia ( I. gabonensis and I. wombulu .Bail) Trade; a ...
African Journals Online (AJOL)
Journal Home > Vol 3, No 1 (2010) > ... differences in product quantities within and between zones and the seasons at p<0.05 level. ... valued at about 2,364,385,162 F (CFA) equivalent to US$ 4,728,770.34 Internally Generated Revenue ...
485 assessment of the problems of manual automobile tyre bead
African Journals Online (AJOL)
eobe
rim bead bond must be broken to carry out repairs on a failed automobile tyre. ... engine will not be transformed into the motion of the vehicle. It provides the only point of contact between ..... Popular Mechanic 162 (6): 62. http://books.google.
The South African Traditional Belief Scale as an instrument to aid ...
African Journals Online (AJOL)
Medical and psychological health care professionals are becoming increasingly aware that effective treatment in culturally diverse societies requires sensitivity to the patient's cultural beliefs and customs (Davidhizar & Giger, 2001:2; Foley & Wurmser, 2004:2; Hickson & Christie, 1989:162; Mkize, 2003:4; Narayanasamy, ...
„Parallel“ und „unabhängig“ – Erich von Tschermak-Seyseneggs Darstellung der „Wiederentdeckung“
Czech Academy of Sciences Publication Activity Database
Šimůnek, Michal V.; Hossfeld, U.; Mielewczik, M.
-, č. 413 (2017), s. 155-162 ISSN 0369-5034 Institutional support: RVO:68378114 Keywords : Mendel * genetics * history Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)
Stouten, Luyken H.; Veling, Wim; Laan, Winfried; van der Helm, Mischa; van der Gaag, Mark
2017-01-01
Aim: Most studies on the determinants of psychosocial functioning in first-episode psychosis used few predictors. This study examines the effects of multiple cognitive domains and multiple symptoms on psychosocial functioning. Methods: A total of 162 patients with a first-episode psychosis were