WorldWideScience

Sample records for promethium 162

  1. Strontium-90 and promethium-147 recovery

    International Nuclear Information System (INIS)

    Hoisington, J.E.; McDonell, W.R.

    1982-01-01

    Strontium-90 and promethium-147 are fission product radionuclides with potential for use as heat source materials in high reliability, non-interruptible power supplies. Interest has recently been expressed in their utilization for Department of Defense (DOD) applications. This memorandum summarizes the current inventories, the annual production rates, and the possible recovery of Sr-90 and Pm-147 from nuclear materials production operations at Hanford and Savannah River. Recovery of these isotopes from LWR spend fuel utilizing the Barnwell Nuclear Fuels Plant (BNFP) is also considered. Unit recovery costs at each site are provided

  2. Physics of the missing atoms: technetium and promethium

    International Nuclear Information System (INIS)

    Aspden, H.

    1987-01-01

    Technetium (Z = 43) and promethium (Z = 61) are by far the least abundant of all atoms below the radioactive elements (Z = 84 onwards). Their scarcity confirms theoretical predictions emerging from a theory of the photon derived from synchronous lattice electrodynamics. This theory has given precise theoretical values for the fine-structure constant and the constant of gravitation G and is now shown in this paper to indicate resonant interactions between the vacuum lattice oscillations and technetium and promethium. In the case of promethium there is strong reason for believing that this atom can assume supergravitational or antigravitational properties, accounting for its scarcity. This paper not only adds support to the earlier theoretical work on the photon and gravitation, but suggests a research route that might lead to new technology based on controlled interactions with gravity fields

  3. 10 CFR 30.19 - Self-luminous products containing tritium, krypton-85, or promethium-147.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85, or..., krypton-85, or promethium-147. (a) Except for persons who manufacture, process, produce, or initially transfer for sale or distribution self-luminous products containing tritium, krypton-85, or promethium-147...

  4. A novel ion selective sensor for promethium determination

    International Nuclear Information System (INIS)

    Gupta, Vinod K.; Jain, Rajeev; Hamdan, A.J.; Agarwal, Shilpi; Bharti, Arvind K.

    2010-01-01

    This is a first promethium 145 ion-selective sensor based on the comparative study of two Schiff base ligands (X 1 and X 2 ) as neutral ionophores. Effect of various plasticizers: 2-nitrophenyloctylether (o-NPOE), dibutyl phosphonate (DBP), dioctylphthalate (DOP), tri-(2-ethylhexyl) phosphate (TEHP), dibutyl butylphosphonate (DBBP), chloronaphthalene (CN) and anion excluders: potassium tetrakis (p-chloropheny1) borate (KTpClPB), sodiumtetraphenylborate (NaTPB) and oleic acid (OA) have been studied. The membrane with a composition of ionophore (X 1 /X 2 ):KTpClPB:PVC:o-NPOE (w/w, %) in the ratio of 5:5:30:60 exhibited best performance. The best responsive membrane sensors (8 and 21) exhibited working concentration range of 4.5 x 10 -7 -1.0 x 10 -2 M and 3.5 x 10 -6 -1.0 x 10 -2 M with a detection limits of 3.2 x 10 -7 M and 2.3 x 10 -6 M and Nernstian slopes of 20.0 ± 0.5, 19.5 ± 0.5 mV decade -1 of activity, respectively. The sensor no. 8 works satisfactorily in partially non-aqueous media up to 10% (v/v) content of methanol, ethanol and acetonitrile. Analytical application of the proposed sensor has been demonstrated in determination of promethium (III) ions in spiked water samples.

  5. Techniques involved in the preparation of radioluminescent sources with promethium-147 and gaseous tritium radionuclides

    International Nuclear Information System (INIS)

    Seshadri, N.K.; Subramanian, T.K.; Ravi, S.; Mathew, K.M.; Chinnayan, C.

    2001-01-01

    Beta radiation emanating from promethium-147 and gaseous tritium in close proximity with zinc sulphide phosphor will provide self sustained light sources and are used for, nocturnal illumination of liquid crystal display digital watches and clocks, product advertisements, telephone numbers, exit signs etc. In this paper a procedure for activation of zinc sulphide phosphor with promethium-147 and development of gaseous tritium light sources with respect to thickness of phosphor coating and its effect on light output is described. A typical light source was constructed with promethium-147 activated zinc sulphide to find the overall efficiency of conversion of beta energy to visible light. (author)

  6. 10 CFR 32.22 - Self-luminous products containing tritium, krypton-85 or promethium-147: Requirements for license...

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85 or... containing tritium, krypton-85 or promethium-147: Requirements for license to manufacture, process, produce... self-luminous products containing tritium, krypton-85, or promethium-147, or to initially transfer such...

  7. An experimental study of odd mass promethium isotopes using proton stripping and pickup reactions

    International Nuclear Information System (INIS)

    Straume, O.

    1979-11-01

    Odd Pm isotopes have been studied by one proton pick-up and stripping reactions. Spin assignment and spectroscopic factors have been obtained for a number of energy levels. In the stripping reactions, the relative cross-sections have been measured with an unusually high precision by the use of a target of natural neodymium. The spectroscopic strengths have been extracted using standard distorted wave methods. The nuclear structures of these promethium isotopes fall into three categories. The spherical approach seems valid for 143 Pm and 145 Pm and the deformed regime covers 151 Pm and 153 Pm, while 147 Pm and 149 Pm remain as transitional nuclei. (Auth.)

  8. Penetration of radionuclides across the skin. Rat age dependent promethium permeation through skin in vitro

    International Nuclear Information System (INIS)

    Kassai, Z.; Kassai, A.; Bauerova, K.; Koprda, V.; Harangozo, M.; Bendova, P.; Bujnova, A.

    2003-01-01

    The composition and the permeation properties of the skin are dependent on age. In the animal models for permation studies, age affects the mechanical as well as the permeation properties significantly. The time dependence of permeation of 147 Pm 3+ from aqueous solution was established by the animal skin model and the age dependence of promethium permeation through the skin was examined. The aim was to find the optimum rat skin age model for radionuclide permeation studies and to assess the relative importance of the main permeation pathways: transepidermal and transfollicular permeation. The skin from 5-day-old rats (5DR) was found to represent the optimum animal model to study transepidermal permeation of ions. The skin from 9-day-old rats (9DR) was selected to study transfollicular permeation of ions. Comparison of the permeated amounts of promethium through the skin without hairs (3 DR to 6 DR) and with hairs (7DR to 12DR) showed that the additional permation mode via follicles significantly contributed to the permeation rate and extent. (author)

  9. Synthesis and Preliminary Biological Evaluations of Fluorescent or 149Promethium Labeled Trastuzumab-Polyethylenimine

    Directory of Open Access Journals (Sweden)

    Jonathan Fitzsimmons

    2015-12-01

    Full Text Available Background: Radioimmunotherapy utilize a targeting antibody coupled to a therapeutic isotope to target and treat a tumor or disease. In this study we examine the synthesis and cell binding of a polymer scaffold containing a radiotherapeutic isotope and a targeting antibody. Methods: The multistep synthesis of a fluorescent or 149Promethium-labeled Trastuzumab-polyethyleneimine (PEI, Trastuzumab, or PEI is described. In vitro uptake, internalization and/or the binding affinity to the Her2/neu expressing human breast adenocarcinoma SKBr3 cells was investigated with the labeled compounds. Results: Fluorescent-labeled Trastuzumab-PEI was internalized more into cells at 2 and 18 h than fluorescent-labeled Trastuzumab or PEI. The fluorescent-labeled Trastuzumab was concentrated on the cell surface at 2 and 18 h and the labeled PEI had minimal uptake. DOTA-PEI was prepared and contained an average of 16 chelates per PEI; the compound was radio-labeled with 149Promethium and conjugated to Trastuzumab. The purified 149Pm-DOTA-PEI-Trastuzumab had a radiochemical purity of 96.7% and a specific activity of 0.118 TBq/g. The compound demonstrated a dissociation constant for the Her2/neu receptor of 20.30 ± 6.91 nM. Conclusion: The results indicate the DOTA-PEI-Trastuzumab compound has potential as a targeted therapeutic carrier, and future in vivo studies should be performed.

  10. Method of fixing a luminous powder such as tritium-3 promethium-147 in a nuclear battery for wrist watches

    International Nuclear Information System (INIS)

    Atomachi, Tadaaki; Imai, Hiroshi.

    1969-01-01

    A method of adhering and fixing a luminous powder such as tritium-3 or promethium-147 onto a small semi-conductor element for use in nuclear batteries is disclosed in which a radio isotope such as tritium-3 or promethium-147 is coated onto the surface of a fluorescent material such as ZnS-Cu, CaS, (Ca, Sr)S, (Cd, Zn)S which is then suspended in a silver plating bath. A composite of silver and the luminous powder is electro-deposited onto the semi-conductor element. The deposited layer will not easily separate from the semi-conductor and long life is assured owing to the thickness of the layer. Small dimensions are obtainable without sacrificing capacity. (Owens, K.J.)

  11. Development of a diagnostic model for inhaled promethium-147 oxide. Animal studies

    International Nuclear Information System (INIS)

    Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.

    1976-01-01

    Rats and beagles were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare-earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in faecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (author)

  12. Development of a diagnostic model for inhaled promethium-147 oxide: animal studies

    International Nuclear Information System (INIS)

    Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.

    1975-01-01

    Rats and beagle dogs were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in fecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (auth)

  13. Contribution to the penetration of radionuclides across the skin. Age dependence of promethium through rat skin in vitro

    International Nuclear Information System (INIS)

    Kassai, Z.; Koprda, V.; Harangozo, M.; Bendova, P.; Bauerova, K.

    2001-01-01

    In this paper: - the time dependence of permeation of 147 Pm 3+ from aqueous solution through animal skin model was studied; - the age dependence of promethium through the skin was proved; - the optimum biological model of human skin was selected, and - the relative importance of the main diffusion pathways for 147 Pm 3+ the diffusion across the intact skin and the diffusion through the hair channels was assessed. Concluding it can be said, that: -it was proved, that the 5-day-old rats (5DR) represents the optimum animal model to the human skin; - in the case of 8DR to 11DR the dominant route of 147 Pm 3+ penetration is along the follicles; - the permeation resistance of the skin depends on the thickness and mechanical properties of the skin. Comparing amounts of penetrated ions of promethium through the skin without hairs (3DR to 6DR) and through the skin with hairs, it was showed that the additional diffusion along hair's follicles pronounced with animal skin can be important also in case of human skin where hair density is many times lower than in used animal models. (authors)

  14. The sequential separation of strontium-90, yttrium-90, promethium-147, and cerium-144 from urine and their subsequent estimation

    International Nuclear Information System (INIS)

    Kramer, G.H.; Davies, J.M.

    1981-04-01

    A method has been developed for separating low-level activities of the beta-emitting isotopes strontium-90, yttrium-90, promethium-147 and cerium-144 from urine and aqueous solutions. They are subsequently estimated by planchet or liquid scintillation counting. The radionuclides are separated from each other and from interfering elements by solvent extraction with HDEHP (di-2-ethylhexyl phosphoric acid) in n-heptane. It is possible to separate the elements with a minimum of cross-contamination by selecting appropriate pH's and solvent concentrations. Percentage recoveries for the radionuclides are: 90 Sr, 100 +- 12; 90 Y, 65 +- 4; 147 Pm, 90 +- 8; 144 Ce, 87 +- 11. The limits of detection are: 90 Sr, 0.6 pCi; 90 Y, 0.7 pCi; 147 Pm, 1.0 pCi; 144 Ce, 0.8 pCi. (author)

  15. 25 CFR 162.606 - Advertisement.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement. 162.606 Section 162.606 Indians BUREAU OF... § 162.606 Advertisement. Except as otherwise provided in this part, prior to granting a lease or permit.... Advertisements will call for sealed bids and will not offer preference rights. ...

  16. 29 CFR 1915.162 - Ship's boilers.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's boilers. 1915.162 Section 1915.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.162 Ship's boilers. (a) Before...

  17. 49 CFR 176.162 - Security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Security. 176.162 Section 176.162 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... Class 1 (Explosive) Materials Precautions During Loading and Unloading § 176.162 Security. A responsible...

  18. 29 CFR 500.162 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Reports. 500.162 Section 500.162 Labor Regulations Relating... AGRICULTURAL WORKER PROTECTION Enforcement Agreements with Federal and State Agencies § 500.162 Reports. The Secretary shall require such reports as he deems necessary of activities conducted pursuant to State plans...

  19. 7 CFR 956.162 - Container markings.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Container markings. 956.162 Section 956.162... WALLA VALLEY OF SOUTHEAST WASHINGTON AND NORTHEAST OREGON Rules and Regulations § 956.162 Container markings. Effective April 15, 1997, no handler shall ship any container of Walla Walla Sweet Onions except...

  20. 46 CFR 162.039-2 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 162.039-2 Section 162.039-2 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. (a) Every semiportable fire extinguisher shall be classified as to type and size as specified in...

  1. 46 CFR 162.028-2 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 162.028-2 Section 162.028-2 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. (a) Every portable fire extinguisher shall be classified as to type and size as specified in § 76...

  2. 40 CFR 16.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 16.2 Section 16.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL IMPLEMENTATION OF PRIVACY ACT OF 1974 § 16... records have the same meanings as specified in 5 U.S.C. 552a. (b) EPA means the Environmental Protection...

  3. 40 CFR 162.151 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 162.151 Section 162.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS STATE REGISTRATION... registered product. Pest problem means: (1) A pest infestation and its consequences, or (2) Any condition for...

  4. 31 CFR 16.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 16.2 Section 16.2 Money and Finance: Treasury Office of the Secretary of the Treasury REGULATIONS IMPLEMENTING THE PROGRAM... a position for which the rate of basic pay is not less than the minimum rate of basic pay for grade...

  5. 10 CFR 72.162 - Test control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 72.162 Section 72.162 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL... Test control. The licensee, applicant for a license, certificate holder, and applicant for a CoC shall...

  6. 7 CFR 28.162 - Procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Procedure. 28.162 Section 28.162 Agriculture..., TESTING, AND STANDARDS Regulations Under the United States Cotton Standards Act Adjustment of Contract... and in instituting and conducting arbitrations and appeals shall be as prescribed in the articles...

  7. 32 CFR 162.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... ENHANCING CAPITAL INVESTMENT (PECI) § 162.5 Responsibilities. (a) The Assistant Secretary of Defense (Force... project applicability when reasonable, applies off-the-shelf technology, and integrates capital investment...

  8. Nuclear spectroscopic studies in 162Yb

    International Nuclear Information System (INIS)

    Behrens, H.

    1980-01-01

    The decay of the highly excited 162 Yb nuclei formed in the reaction 150 Sm( 16 O,4n) 162 Yb to the ground state was studied using different gamma detectors and an electron spectrometer, a so called mini-orange. The isotope 162 Yb was moreover produced and spectroscoped by the beta-decay of 162 Lu. For the identification of decay cascades, which were passed after the fusion, and for the determination of the multipolarity of the contributing energy transitions a series of experiments took place: The excitation functions and the angular distributions of the emitted gamma radiation was measured, the conversion coefficients of important transitions were determined, and coincidence events between two detectors occasionally were registrated and analyzed. In the beta decay measurement an assignment of gamma transitions to 162 Yb followed due to the lifetime, under which they occured. The found states of 162 Yb upto spins of 22 h/2π and excitation energies above 5 MeV belong to five rotational bands. The yrast band shows a weak backbending. Corresponding to their spins and parities the bands can be reduced to intrinsic excitation of two quasineutrons. The analysis of the beta-decay of 162 Lu, which takes place from three states in 162 Lu, leads to the lowest levels of the gamma-vibrational band and the band head of the beta band. The microscopic interpretation of the rotational bands and the description of the backbending behaviour are as the interpretation of the states involved at the beta decay in agreement with experimental and theoretical results for neighbouring ytterbium isotopes. (orig.) [de

  9. 7 CFR 930.162 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... MICHIGAN, NEW YORK, PENNSYLVANIA, OREGON, UTAH, WASHINGTON, AND WISCONSIN Administrative Rules and Regulations § 930.162 Exemptions. (a) General. Tart cherries which are used for the purpose of new product... and/or new markets for tart cherry products. Any exemption for experimental work shall be limited in...

  10. 46 CFR 162.039-3 - Requirements.

    Science.gov (United States)

    2010-10-01

    ...: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Extinguishers, Fire, Semiportable, Marine Type § 162.039-3... parts, except those used for inversion mechanism or similar purposes, shall be corrosion-resistant to... shall be protected by a suitable corrosion-resistant coating. (1) Corrosion-resistant materials. The...

  11. 32 CFR 162.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING PRODUCTIVITY ENHANCING CAPITAL INVESTMENT (PECI) § 162.6 Procedures. The following procedures shall be followed by the DoD Components in the... documentation, pre-investment analysis, financing, and post-investment accountability of PECI projects, when DoD...

  12. 32 CFR 162.3 - Definition.

    Science.gov (United States)

    2010-07-01

    ... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING PRODUCTIVITY ENHANCING CAPITAL INVESTMENT (PECI) § 162.3 Definition. (a) Capital Investment. The acquisition, installation, transportation... timeliness. (l) Productivity Enhancing Capital Investment (PECI). Equipment or facility funding that shall...

  13. 32 CFR Appendix to Part 162 - Reporting Procedures

    Science.gov (United States)

    2010-07-01

    ... ENHANCING CAPITAL INVESTMENT (PECI) Pt. 162, App. A Appendix to Part 162—Reporting Procedures A. General The.... Total Projected Life-Cycle Cost Avoidance. 4. PIA Post-Investment assessments, articles, pictures, and...

  14. 26 CFR 1.162-6 - Professional expenses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Professional expenses. 1.162-6 Section 1.162-6...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.162-6 Professional expenses. A professional man may claim as deductions the cost of supplies used by him in the practice of...

  15. 45 CFR 162.915 - Trading partner agreements.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Trading partner agreements. 162.915 Section 162... REQUIREMENTS ADMINISTRATIVE REQUIREMENTS General Provisions for Transactions § 162.915 Trading partner agreements. A covered entity must not enter into a trading partner agreement that would do any of the...

  16. 19 CFR 162.63 - Arrests and seizures.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Arrests and seizures. 162.63 Section 162.63 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Controlled Substances, Narcotics, and Marihuana § 162...

  17. 45 CFR 162.1002 - Medical data code sets.

    Science.gov (United States)

    2010-10-01

    ... Terminology, Fourth Edition (CPT-4), as maintained and distributed by the American Medical Association, for... 45 Public Welfare 1 2010-10-01 2010-10-01 false Medical data code sets. 162.1002 Section 162.1002... REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Code Sets § 162.1002 Medical data code sets. The Secretary adopts the...

  18. 46 CFR 162.050-37 - Vibration test.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Vibration test. 162.050-37 Section 162.050-37 Shipping...: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Pollution Prevention Equipment § 162.050-37 Vibration test. (a... paragraph (b) of this section. The test must be performed at an independent laboratory that has the...

  19. 45 CFR 162.1011 - Valid code sets.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Valid code sets. 162.1011 Section 162.1011 Public... ADMINISTRATIVE REQUIREMENTS Code Sets § 162.1011 Valid code sets. Each code set is valid within the dates specified by the organization responsible for maintaining that code set. ...

  20. 26 CFR 1.162-1 - Business expenses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Business expenses. 1.162-1 Section 1.162-1...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.162-1 Business expenses. (a) In general. Business expenses deductible from gross income include the ordinary and necessary...

  1. 16 CFR 1.62 - Ancillary court orders pending review.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Ancillary court orders pending review. 1.62 Section 1.62 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES Injunctive and Condemnation Proceedings § 1.62 Ancillary court orders pending review...

  2. 19 CFR 162.11 - Authority to procure warrants.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority to procure warrants. 162.11 Section 162.11 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Search Warrants § 162.11 Authority to procure...

  3. 19 CFR 162.92 - Notice of seizure.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Notice of seizure. 162.92 Section 162.92 Customs... (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Civil Asset Forfeiture Reform Act § 162.92 Notice of seizure. (a) Generally. Customs will send written notice of seizure as provided in this section to all known interested...

  4. 19 CFR 162.22 - Seizure of conveyances.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure of conveyances. 162.22 Section 162.22... TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Seizures § 162.22 Seizure of conveyances. (a) General applicability. If it shall appear to any officer authorized to board conveyances and make seizures that there...

  5. 25 CFR 162.605 - Negotiation of leases.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Negotiation of leases. 162.605 Section 162.605 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER LEASES AND PERMITS Non-Agricultural Leases § 162.605 Negotiation of leases. (a) Leases of individually owned land or tribal land may be negotiated by those owners or their...

  6. Brain abscess: surgical experiences of 162 cases

    Directory of Open Access Journals (Sweden)

    Forhad Hossain Chowdhury

    2015-01-01

    Full Text Available Aim: Brain abscess still poses a public health challenge in spite of the advent of modern neurosurgical techniques and antibiotics. Here, we present our surgical experiences and ultimate outcome in the management of brain abscess. Methods: Totally, 162 patients with proved brain abscess who underwent surgical treatment were included in this study. The prospectively recorded data of surgical management of brain abscess and the ultimate outcome (by Glasgow outcome scale were studied retrospectively. Results: Total number of cases was 162, of which 113 were acute pyogenic abscess while 49 were chronic abscess. Among the chronic abscess, 29 were chronic pyogenic abscess, 14 were tubercular, 3 aspergillus, and 3 abscesses were in malignant brain metastases. In acute cases, common clinical features were headache, fever, vomiting, focal deficit and seizure. In chronic abscesses, common clinical features were mild to moderate headache and progressive focal deficit. Seventy-three (45.06% patients had adjacent localized sinus, middle ear or cranial infection. The common predisposing factors included postneurosurgery, postpenetrating injury to brain, chronic suppurative otitis media, and congenital heart disease, infective endocarditis, sinusitis and sub optimum immuno-status. Frontal lobe involved in 30.2% cases, temporal lobe is next to involved. Single time burr hole aspiration in 111 (68.5% cases, two or more times burr hole aspiration were done in 34 (21% cases. Pus culture was negative in 129 (79.62% cases. Total number of death was 22 (13.58% cases. Complete resolution of abscess with complete recovery of preoperative neuro-deficit was seen in 80.86% cases and recovery with major neuro-deficit was observed in 5.55% cases. There is a significant association between Glasgow coma scale (GCS on admission and mortality in brain abscess. Conclusion: In most of the cases, pus culture did not yield growth of any causative organism. Mortality was not

  7. 19 CFR 162.3 - Boarding and search of vessels.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Boarding and search of vessels. 162.3 Section 162.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Boarding and search of vessels. (a) General authority. A Customs officer, for the purpose of examining the...

  8. 42 CFR 423.162 - Quality improvement organization activities.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Quality improvement organization activities. 423.162 Section 423.162 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control...

  9. 45 CFR 162.1901 - Medicaid pharmacy subrogation transaction.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Medicaid pharmacy subrogation transaction. 162... STANDARDS AND RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Medicaid Pharmacy Subrogation § 162.1901 Medicaid pharmacy subrogation transaction. The Medicaid pharmacy subrogation transaction is the...

  10. 26 CFR 1.162-5 - Expenses for education.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses for education. 1.162-5 Section 1.162-5... education. (a) General rule. Expenditures made by an individual for education (including research undertaken... the education may lead to a degree) if the education— (1) Maintains or improves skills required by the...

  11. 26 CFR 1.162-12 - Expenses of farmers.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses of farmers. 1.162-12 Section 1.162-12... farmers. (a) Farms engaged in for profit. A farmer who operates a farm for profit is entitled to deduct... 263A and the regulations thereunder. For taxable years beginning after July 12, 1972, where a farmer is...

  12. 28 CFR 16.2 - Public reading rooms.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Public reading rooms. 16.2 Section 16.2 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION... Relations Service—in Suite 2000, 600 E Street, NW., Washington, DC; (4) Drug Enforcement Administration—in...

  13. 46 CFR 162.028-4 - Marine type label.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Marine type label. 162.028-4 Section 162.028-4 Shipping... type label. (a) In addition to all other marking, every portable extinguisher shall bear a label containing the “marine type” listing manifest issued by a recognized laboratory. This label will include the...

  14. 19 CFR 162.21 - Responsibility and authority for seizures.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Responsibility and authority for seizures. 162.21 Section 162.21 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... authority for seizures. (a) Seizures by Customs officers. Property may be seized, if available, by any...

  15. 26 CFR 1.162-7 - Compensation for personal services.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Compensation for personal services. 1.162-7 Section 1.162-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME... a flat rate. Generally speaking, if contingent compensation is paid pursuant to a free bargain...

  16. 7 CFR 457.162 - Nursery crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery crop insurance provisions. 457.162 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.162 Nursery crop insurance provisions. The Nursery Crop Insurance Provisions for the 2006 and succeeding crop years are as follows: FCIC...

  17. 46 CFR 162.017-3 - Materials, construction, and workmanship.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials, construction, and workmanship. 162.017-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Valves, Pressure-Vacuum Relief, for Tank Vessels § 162.017-3 Materials, construction, and workmanship. (a) The valves shall be of...

  18. High spin states in 162Lu

    International Nuclear Information System (INIS)

    Gupta, S.L.; Pancholi, S.C.; Juneja, P.; Mehta, D.; Kumar, A.; Bhowmik, R.K.; Muralithar, S.; Rodrigues, G.; Singh, R.P.

    1997-01-01

    An experimental investigation of the odd-odd 162 Lu nucleus, following the 148 Sm( 19 F,5n) reaction at beam energy E lab =112MeV, has been performed through in-beam gamma-ray spectroscopy. It revealed three signature-split bands. The yrast band based on πh 11/2 circle-times νi 13/2 configuration exhibits anomalous signature splitting (the unfavored signature Routhian lying lower than the favored one) whose magnitude Δe ' ∼25keV, is considerably reduced in contrast to sizable normal signature splitting Δe ' ∼125 and 60 keV observed in the yrast πh 11/2 bands of the neighboring odd-A 161,163 Lu nuclei, respectively. The signature inversion in this band occurs at spin ∼20ℎ (frequency=0.37MeV). The second signature-split band, observed above the band crossing associated with the alignment of a pair of i 13/2 quasineutrons, is a band based on the four-quasiparticle [πh 11/2 [523]7/2 - times νh 9/2 [521]3/2 - times(νi 13/2 ) 2 ], i.e., EABA p (B p ), configuration. The third signature-split band is also likely to be a four-quasiparticle band with configuration similar to the second band but involving F quasineutron, i.e., FABA p (B p ). The experimental results are discussed in comparison with the existing data in the neighboring nuclei and in the framework of the cranking shell model. copyright 1997 The American Physical Society

  19. 45 CFR 162.925 - Additional requirements for health plans.

    Science.gov (United States)

    2010-10-01

    ... clearinghouse to receive, process, or transmit a standard transaction may not charge fees or costs in excess of... RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS General Provisions for Transactions § 162.925 Additional... transaction as a standard transaction, the health plan must do so. (2) A health plan may not delay or reject a...

  20. 26 CFR 1.162-10 - Certain employee benefits.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Certain employee benefits. 1.162-10 Section 1... employee benefits. (a) In general. Amounts paid or accrued by a taxpayer on account of injuries received by...) for the benefit of employees, their families, and dependents, at least medical or hospital care, and...

  1. 7 CFR 905.162 - Repacking certificate of privilege.

    Science.gov (United States)

    2010-01-01

    ... 905.162 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE ORANGES..., address and Florida citrus fruit dealer license number of the applicant; approximate number of boxes to be...

  2. 40 CFR 35.162 - Basis for allotment.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL ASSISTANCE Environmental Program Grants Water Pollution Control (section 106) § 35.162... are presented in Table 1 of this section, with their associated elements, sub-elements, and supporting... made on the basis of the cumulative change in the Consumer Price Index (CPI), published by the U.S...

  3. 21 CFR 131.162 - Acidified sour cream.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.162.... (c) Methods of analysis. Referenced methods in paragraphs (c) (1) and (2) of this section are from “Official Methods of Analysis of the Association of Official Analytical Chemists,” 13th Ed. (1980), which is...

  4. 26 CFR 1.162-18 - Illegal bribes and kickbacks.

    Science.gov (United States)

    2010-04-01

    ... bribe (whether or not illegal) made on or after December 10, 1971, by any provider of services, supplier... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Illegal bribes and kickbacks. 1.162-18 Section 1... bribes and kickbacks. (a) Illegal payments to government officials or employees—(1) In general. No...

  5. 27 CFR 9.162 - Sta. Rita Hills.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Sta. Rita Hills. 9.162.... Rita Hills. (a) Name. The name of the viticultural area described in this section is “Sta. Rita Hills”. For purposes of part 4 of this chapter, “Sta. Rita Hills” is a term of viticultural significance. (b...

  6. Moments of inertia in 162Yb at very high spins

    International Nuclear Information System (INIS)

    Simon, R.S.; Banaschik, M.V.; Colombani, P.; Soroka, D.P.; Stephens, F.S.; Diamond, R.M.

    1976-01-01

    Two methods have been used to obtain values of the effective moment of inertia of very-high-spin (20h-bar--50h-bar) states populated in heavy-ion compound-nucleus reactions. The 162 Yb nucleus studied has effective moments of inertia smaller than, but approaching, the rigid-body estimate

  7. 40 CFR 80.162 - Additive compositional data.

    Science.gov (United States)

    2010-07-01

    ... detergent production quality control. EPA will respond to such requests in writing; the additional... variability is required, and provide evidence that the production detergent will perform adequately throughout... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.162 Additive compositional data...

  8. Lifetimes of high-spin states in {sup 162}Yb

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Janssens, R.V.F.; Henry, R.G. [and others

    1995-08-01

    A measurement on lifetimes of high-spin states in the yrast and near-yrast rotational bands in {sup 162}Yb was carried out at ATLAS in order to determine the evolution of collectivity as a function of angular momentum using the {sup 126}Te({sup 40}Ar,4n){sup 162}Yb reaction at 170 MeV. Previous lifetime measurements in the {sup 164,166,168}Yb isotopes showed a dramatic decrease in the transition quadrupole moment Q{sub t} with increasing spin. It was suggested that this decrease in Q{sub t} is brought about by the rotationally-induced deoccupation of high-j configurations, mainly i{sub 13/2} neutrons. If this interpretation is correct, the heavier isotopes should have a larger decrease in Q{sub t} than the lighter mass nuclides due to the position of the Fermi surface in the i{sub 13/2} subshell. Indeed, {sup 160}Yb does not show a clear decrease in Q{sub t} at high spin. No high spin lifetime information exists for {sup 162}Yb, thus this experiment fills the gap of measured Q{sub t}`s in the light Yb series. The data is currently being analyzed.

  9. 42 CFR 415.162 - Determining payment for physician services furnished to beneficiaries in teaching hospitals.

    Science.gov (United States)

    2010-10-01

    ... furnished to beneficiaries in teaching hospitals. 415.162 Section 415.162 Public Health CENTERS FOR MEDICARE... BY PHYSICIANS IN PROVIDERS, SUPERVISING PHYSICIANS IN TEACHING SETTINGS, AND RESIDENTS IN CERTAIN SETTINGS Physician Services in Teaching Settings § 415.162 Determining payment for physician services...

  10. 33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

  11. 33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...

  12. 33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...

  13. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  14. 33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...

  15. 33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...

  16. 27 CFR 70.162 - Levy and distraint on salary and wages.

    Science.gov (United States)

    2010-04-01

    ... salary and wages. 70.162 Section 70.162 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... § 70.162 Levy and distraint on salary and wages. (a) Notice of intent to levy. Levy may be made for any... salary or wages. A levy on salary or wages is continuous from the time of the levy until the liability...

  17. 33 CFR 165.162 - Safety Zone: New York Super Boat Race, Hudson River, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: New York Super Boat Race, Hudson River, New York. 165.162 Section 165.162 Navigation and Navigable Waters COAST GUARD... § 165.162 Safety Zone: New York Super Boat Race, Hudson River, New York. (a) Regulated area. The...

  18. 33 CFR 162.125 - Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc. 162.125 Section 162.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.125 Sturgeon Bay and the Sturgeon Bay Ship...

  19. 19 CFR 162.65 - Penalties for failure to manifest narcotic drugs or marihuana.

    Science.gov (United States)

    2010-04-01

    ... or marihuana. 162.65 Section 162.65 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Substances, Narcotics, and Marihuana § 162.65 Penalties for failure to manifest narcotic drugs or marihuana. (a) Cargo or baggage containing unmanifested narcotic drugs or marihuana. When a package of regular...

  20. 28 CFR 0.162 - Offers which may be rejected by Assistant Attorneys General.

    Science.gov (United States)

    2010-07-01

    ... Attorneys General. 0.162 Section 0.162 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE..., Penalties, and Forfeitures § 0.162 Offers which may be rejected by Assistant Attorneys General. Each Assistant Attorney General is authorized, with respect to matters assigned to his division or office, to...

  1. 40 CFR 82.162 - Certification by owners of recovery and recycling equipment.

    Science.gov (United States)

    2010-07-01

    ... and recycling equipment. 82.162 Section 82.162 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PROTECTION OF STRATOSPHERIC OZONE Recycling and Emissions Reduction § 82.162 Certification by owners of recovery and recycling equipment. (a) No later than August 12...

  2. Identification, expression and phylogenetic analysis of EgG1Y162 from Echinococcus granulosus

    Science.gov (United States)

    Zhang, Fengbo; Ma, Xiumin; Zhu, Yuejie; Wang, Hongying; Liu, Xianfei; Zhu, Min; Ma, Haimei; Wen, Hao; Fan, Haining; Ding, Jianbing

    2014-01-01

    Objective: This study was to clone, identify and analyze the characteristics of egG1Y162 gene from Echinococcus granulosus. Methods: Genomic DNA and total RNAs were extracted from four different developmental stages of protoscolex, germinal layer, adult and egg of Echinococcus granulosus, respectively. Fluorescent quantitative PCR was used for analyzing the expression of egG1Y162 gene. Prokaryotic expression plasmid of pET41a-EgG1Y162 was constructed to express recombinant His-EgG1Y162 antigen. Western blot analysis was performed to detect antigenicity of EgG1Y162 antigen. Gene sequence, amino acid alignment and phylogenetic tree of EgG1Y162 were analyzed by BLAST, online Spidey and MEGA4 software, respectively. Results: EgG1Y162 gene was expressed in four developmental stages of Echinococcus granulosus. And, egG1Y162 gene expression was the highest in the adult stage, with the relative value of 19.526, significantly higher than other three stages. Additionally, Western blot analysis revealed that EgG1Y162 recombinant protein had good reaction with serum samples from Echinococcus granulosus infected human and dog. Moreover, EgG1Y162 antigen was phylogenetically closest to EmY162 antigen, with the similarity over 90%. Conclusion: Our study identified EgG1Y162 antigen in Echinococcus granulosus for the first time. EgG1Y162 antigen had a high similarity with EmY162 antigen, with the genetic differences mainly existing in the intron region. And, EgG1Y162 recombinant protein showed good antigenicity. PMID:25337206

  3. Identification, expression and phylogenetic analysis of EgG1Y162 from Echinococcus granulosus.

    Science.gov (United States)

    Zhang, Fengbo; Ma, Xiumin; Zhu, Yuejie; Wang, Hongying; Liu, Xianfei; Zhu, Min; Ma, Haimei; Wen, Hao; Fan, Haining; Ding, Jianbing

    2014-01-01

    This study was to clone, identify and analyze the characteristics of egG1Y162 gene from Echinococcus granulosus. Genomic DNA and total RNAs were extracted from four different developmental stages of protoscolex, germinal layer, adult and egg of Echinococcus granulosus, respectively. Fluorescent quantitative PCR was used for analyzing the expression of egG1Y162 gene. Prokaryotic expression plasmid of pET41a-EgG1Y162 was constructed to express recombinant His-EgG1Y162 antigen. Western blot analysis was performed to detect antigenicity of EgG1Y162 antigen. Gene sequence, amino acid alignment and phylogenetic tree of EgG1Y162 were analyzed by BLAST, online Spidey and MEGA4 software, respectively. EgG1Y162 gene was expressed in four developmental stages of Echinococcus granulosus. And, egG1Y162 gene expression was the highest in the adult stage, with the relative value of 19.526, significantly higher than other three stages. Additionally, Western blot analysis revealed that EgG1Y162 recombinant protein had good reaction with serum samples from Echinococcus granulosus infected human and dog. Moreover, EgG1Y162 antigen was phylogenetically closest to EmY162 antigen, with the similarity over 90%. Our study identified EgG1Y162 antigen in Echinococcus granulosus for the first time. EgG1Y162 antigen had a high similarity with EmY162 antigen, with the genetic differences mainly existing in the intron region. And, EgG1Y162 recombinant protein showed good antigenicity.

  4. 25 CFR 1000.162 - What is included in a self-governance compact?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What is included in a self-governance compact? 1000.162...-DETERMINATION AND EDUCATION ACT Negotiation Process for Annual Funding Agreements Negotiating A Self-Governance Compact § 1000.162 What is included in a self-governance compact? A model format for self-governance...

  5. 33 CFR 162.175 - Black Rock Canal and Lock at Buffalo, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Black Rock Canal and Lock at Buffalo, New York. 162.175 Section 162.175 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Black Rock Canal and Lock at Buffalo, New York. In the Black Rock Canal and Lock, no vessel may exceed 6...

  6. 33 CFR 162.165 - Buffalo and Rochester Harbors, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Buffalo and Rochester Harbors, New York. 162.165 Section 162.165 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... and Rochester Harbors, New York. In Buffalo and Rochester Harbors, no vessel may exceed 6 miles per...

  7. 29 CFR 1952.162 - Completion of developmental steps and certification.

    Science.gov (United States)

    2010-07-01

    ... occupational safety and health issues specified in the plan on or before July 20, 1976. (n) Amendment to....162 Section 1952.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH...) In accordance with the requirements of § 1952.163(b), the Iowa Occupational Safety and Health Act of...

  8. 25 CFR 162.229 - How long can the term of an agricultural lease run?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How long can the term of an agricultural lease run? 162... AND PERMITS Agricultural Leases Lease Requirements § 162.229 How long can the term of an agricultural lease run? (a) An agricultural lease must provide for a definite lease term, specifying the commencement...

  9. 29 CFR 4.162 - Fringe benefits under contracts exceeding $2,500.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Fringe benefits under contracts exceeding $2,500. 4.162... Compensation Standards § 4.162 Fringe benefits under contracts exceeding $2,500. (a) Pursuant to the statutory... contain a provision specifying the fringe benefits to be furnished the various classes of service...

  10. 75 FR 27855 - Certifications Pursuant to Section 609 of Public Law 101-162

    Science.gov (United States)

    2010-05-18

    ... DEPARTMENT OF STATE [Public Notice 7013] Certifications Pursuant to Section 609 of Public Law 101... Law 101-162 (``Section 609''), that 13 nations have adopted programs to reduce the incidental capture... 609 of Public Law 101-162 prohibits imports of certain categories of shrimp unless the President...

  11. β-decay spectroscopy of neutron-rich 160,161,162Sm isotopes

    Directory of Open Access Journals (Sweden)

    Patel Z.

    2016-01-01

    Full Text Available Neutron-rich 160,161,162Sm isotopes have been populated at the RIBF, RIKEN via β first time. β-coincident γ rays were observed in all three isotopes including γ rays from the isomeric decay of 160Sm and 162Sm. The isomers in 160Sm and 162Sm have previously been observed but have been populated via β decay for the first time. The isomeric state in 162Sm is assigned a 4−v72+[ 633 ]⊗v12−[ 521 ]${4^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes v{{1 \\over 2}^ - }\\left[ {521} \\right]$ configuration based on the decay pattern. The level schemes of 160Sm and 162Sm are presented. The ground states in the parent nuclei 160Pm and 162Pm are both assigned a 6−v72+[633]⊗π52−[532]${6^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes \\pi {{5 \\over 2}^ - }\\left[ {532} \\right]$ configuration based on the population of states in the daughter nuclei. Blocked BCS calculations were performed to further investigate the spin-parities of the ground states in 160Pm, 161Pm, and 162Pm, and the isomeric state in 162Sm

  12. 19 CFR 162.93 - Failure to issue notice of seizure.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Failure to issue notice of seizure. 162.93 Section... OF THE TREASURY (CONTINUED) INSPECTION, SEARCH, AND SEIZURE Civil Asset Forfeiture Reform Act § 162.93 Failure to issue notice of seizure. If Customs does not send notice of a seizure of property in...

  13. 25 CFR 162.212 - When will the BIA advertise Indian land for agricultural leases?

    Science.gov (United States)

    2010-04-01

    ... laws and leasing policies that have been made applicable to the land under §§ 162.109 and 162.203 of..., unless a preference in favor of individual Indians is required by a superseding tribal law or leasing policy. (c) Advertisements will require sealed bids, and they may also provide for further competitive...

  14. Epidemiology and mortality of 162 major burns in Kuwait.

    Science.gov (United States)

    Bang, R L; Ghoneim, I E

    1996-09-01

    The burns intensive care unit at IBN Sina Hospital reopened in July 1991, following the Iraqi occupation of Kuwait and the Gulf War. Epidemiology and mortality of 162 burn patients with 30 per cent and over total body surface area (TBSA) burns, treated from July 1991 to December 1994, is presented. There were 91 males and 71 females with a ratio of 1.3 to 1. The median age was 30 years (range 4 months to 93 years) and 44 per cent of the patients were 15-40 years of age. 124 (76.5 per cent) accidents occurred at home and the flame burn was the commonest involving 131 (80.9 per cent) patients. The median burn surface area was 45.5 per cent and the majority of them sustained deep burns. The hospital stay of the surviving patients ranged from 11 to 174 days (median 38 days), while the day of the death was from 1 to 134 days. Forty-six deaths represent an overall mortality rate of 28.4 per cent amongst our patients. All the patients whose Baux score was 130 and above died. Burn shock was responsible for 10 deaths, and out of them eight were not actively resuscitated due to high Baux score. Sixteen deaths occurred within 48 h postburn. Septicaemia and its related effects were responsible for the majority of the deaths.

  15. Observation of enhanced nuclear stability near the 162 neutron shell

    Energy Technology Data Exchange (ETDEWEB)

    Lougheed, R.W.; Moody, K.J.; Wild, J.F.; Hulet, E.K.; McQuaid, J.H. [Lawrence Livermore National Lab., CA (United States); Lazarev, Yu.A.; Lobanov, Yu.V.; Oganessian, Yu.Ts.; Utyonkov, V.K.; Abdullin, F.Sh.; Buklanov, G.V.; Gikal, B.N.; Iliev, S.; Mezentsev, A.N.; Polyakov, A.N.; Sedykh, I.M.; Shirokovsky, I.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Yu.S.; Zhuchko, V.E. [Joint Inst. for Nuclear Research, Dubna (Russian Federation)

    1993-09-22

    In bombardments of {sup 248}Cm with {sup 22}Ne the authors discovered two new isotopes, {sup 265}106 and {sup 266}106, by establishing genetic links between {alpha} decays of the 106 nuclides and SF or {alpha} decays of the daughter (grand-daughter) nuclides. For {sup 266}106 they measured E{sub {alpha}}=8.62{+-}0.06 MeV followed by the SF decay of {sup 262}104 for which they measured a half-life value of 1.2{sup +1.0}{sub {minus}0.5} s. For {sup 265}106 they measured E{sub {alpha}}=8.82{+-}0.06 MeV. They estimated {alpha} half-lives of 10-30 s for {sup 266}106 and 2-30 s for {sup 265}106 with SF branches of {approximately}50% or less. The decay properties of {sup 266}106 indicate a large enhancement in the SF stability of this N=160 nuclide and confirm the existence of the predicted neutron-deformed shell N=162.

  16. Three band crossings in the yrast structure of 162Hf

    International Nuclear Information System (INIS)

    Bingham, C.R.; Riedinger, L.L.; Courtney, L.H.

    1988-01-01

    The yrast sequence of 162 Hf has been observed up to a level tentatively assigned as 38 + and reveals a continuing rotational character up to that spin. Sharp backbends at rotational frequencies of 0.27 and 0.42 MeV/ℎ are attributed to isub(13/2) neutron and hsub(11/2) proton alignments, respectively. A gradual increase in the aligned angular momentum of the yrast levels between these two sharp backbends is attributed to the rotational alignment of a pair of negative parity quasineutrons (mostly hsub(9/2) in character). The interpretation of this effect is supported by the failure of the negative parity bands, which already contain this aligned hsub(9/2) neutron, to gain alignment in the same rotational frequency range. While the alignment of the hsub(9/2) quasineutrons has been predicted in the cranked shell model to occur in the rare-earth region with a large interaction strength, this represents the first clear observation of such a band crossing. (author)

  17. Time-resolved photodissociation of oxygen at 162 nm

    International Nuclear Information System (INIS)

    Trushin, Sergei A; Schmid, Wolfram E; Fuss, Werner

    2011-01-01

    Oxygen was excited by 10 fs pulses in the Schumann-Runge continuum at 162 nm, which is by 0.57 eV above the dissociation limit. It was probed by high-intensity ionization at 810 nm with 10 14 W cm -2 , measuring the ion yields. The O 2 + signal decays in 4.3 fs, which is much shorter than the expected time for dissociation. It is ascribed to a rapid decay of the ionization probability. In a similar time, the ion in the second excited state (with excess energy taken over from the neutral) reaches the dissociation limit, whereas this time would be much longer from the two lower ion states. In fact, the O + signal rises to a (first) maximum at 6 fs. The preference for the higher ion state is rationalized by an intermediate resonance in the neutral molecule for which the polarization dependence also provides evidence. But the shape of the O + signal is very odd: it exhibits three maxima (at 6, 29 and 53 fs) of increasing intensity, before decaying rapidly (≤3.5 fs) to a pedestal. In contrast to the first maximum, the others appear at times when there is practically no interatomic force left in the excited state. We postulate a highly repulsive doubly excited state as a resonance for interpreting the second maximum, and for the third an ion-pair state lying further outside. Comparison is made with enhanced ionization, which has often been found at large interatomic distances on multiple ionization in strong laser fields. Consistent with this mechanism is the absence of similar observations at negative delay times, where five fundamental photons act as a pump and the fifth harmonic as a probe.

  18. First observation of yrast band in odd-odd 162Lu

    International Nuclear Information System (INIS)

    Zhang, Y.H.; Yuan, G.J.; Liu, X.A.

    1996-01-01

    High spin states of the odd-odd 162 Lu nucleus have been studied via 147 Sm( 19 F, 4nγ) 162 Lu reaction at 95MeV beam energy. Level scheme for yrast band based on π[h 11/2 ] υ[i 13/2 ] quasiparticle configuration was established up to I π =(23 - ) for the first time. This band shows the signature inversion in energy before backbending generally appeared in this mass region. It is stressed that the signature splitting in 162 Lu is larger than that in the 160 Tm nucleus. (orig.)

  19. A study of the structure of 162Dy through the (n,γ) and (n,e-) reactions

    International Nuclear Information System (INIS)

    Warner, D.D.; Shi, Z.R.; Gelletly, W.; Borner, H.G.; Hoyler, F.; Schreckenbach, K.; van Isacker, P.

    1987-01-01

    The level structure below 2 MeV in 162 Dy has been investigated using the 161 Dy(n,γ) 162 Dy and 161 Dy(n,e - ) 162 Dy reactions. The results for the positive parity excitations are discussed within the framework of an Interacting Boson Approximation (IBA-2) calculation. 7 refs., 1 fig., 1 tab

  20. 33 CFR 162.20 - Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. 162.20 Section 162.20 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.20 Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. (a...

  1. 33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Channel leading to San Juan Harbor, P.R.; use, administration, and navigation. 162.260 Section 162.260 Navigation and Navigable... WATERWAYS NAVIGATION REGULATIONS § 162.260 Channel leading to San Juan Harbor, P.R.; use, administration...

  2. Psoriatic arthritis: A retrospective study of 162 patients

    Directory of Open Access Journals (Sweden)

    Pavlica Ljiljana

    2005-01-01

    Full Text Available Aim. The aim of our study was to determine the prevalence of psoriatic arthritis in the patients with psoriasis and to analyze retrospectively the results of a 34-year multidisciplinary management of the patients with psoriatic arthritis. Methods. The study included 162 out of 183 treated patients with psoriatic arthritis, aged 48 ± 15 years. All the patients satisfied the current diagnostic criteria for psoriasis and psoriatic arthritis according to the American College of Rheumatology. Results. Psoriatic arthritis developed in 183 (9.3% out of 1976 patients with psoriasis. Time interval for establishing the diagnosis was 4 years. A positive family history of the disease had 15.0% of the studied patients. Its onset was most often at 42 years of age in 70.4% of the cases, and 2 months to 59 years after the appearance of psoriasis. Psoriatic arthritis without psoriasis appeared in 1.8% of the patients. A severe form of arthritis had 64.2% of the patients, mainly the patients with scalp psoriasis (χ2=3.2; p<0.05. Nail changes had 35% of the patients. Distal interphalangeal joints were involved in 63.6%, axial skeleton in 36.4%, oligoarthritis in 45.0%, polyarthritis in 55.0%, and mutilating form in 6.8% of the patients. Elevated Erythrocyte Sedimentation Rate was reveald in 61.7% of the patients. Immunoglobulin M (IgM rheumatoid factor was altered in 4.3% of the patients. The human leukocyte antigen (HLA typing in the 28 patients were: A2 32.0%, A3 18.0%, Al and A9 14.0%, A28 and A29 3.5%, B8 and B16 14.0%, B5 and B12 11.0%, B13,B15, B18, B27 and B35 7.0%. Radiologic changes were most often in hand and foot joints, less frequently in the knees and quite infrequently in hips and shoulders joints. Sacroiliitis was found in 46.4% of the patients. Psoriasis was treated with topical corticosteroids and salicylic ointments in all the patients, ultraviolet (PUVA therapy in 5.6% and retinoids in 4.3% of them. Artrithis was treated with nonsteroidal anti

  3. Study of 162Er via the (p , t) and (p ,p') reactions

    Science.gov (United States)

    Kisliuk, D.; Garrett, P. E.; Finlay, A.; Bianco, L.; Bildstein, V.; Burbadge, C.; Chagnon-Lessard, S.; Diaz Varela, A.; Dunlop, M. R.; Dunlop, R.; Finlay, P.; Jamieson, D.; Jigmeddorj, B.; Maclean, A. D.; Michetti-Wilson, J.; Leach, K. G.; Radich, A. J.; Rand, E.; Svensson, C. E.; Wong, J.; Ball, G. C.; Triambak, S.; Faestermann, T.; Hertenberger, R.; Wirth, H.-F.

    2015-10-01

    The nature of excited states in well-deformed nuclei pose a challenge in nuclear structure. In light of this, the study of 162Er via the 164Er (p , t) and 162Er (p ,p') reactions has been initiated to shed light on the structure of these excited states. The experiments were performed at the Maier-Leibnitz Laboratory using a 22 MeV proton beam on highly-enriched targets of 162,164Er and the reaction was analyzed with the Q3D spectrograph. Strong population in the (p , t) reaction of the 02+ state, far greater than other 0+ states, has been observed. Transition matrix elements for population of low-lying states in the (p ,p') reaction have also been extracted. Initial results from these experiments will be presented.

  4. 25 CFR 162.101 - What key terms do I need to know?

    Science.gov (United States)

    2010-04-01

    ... Agricultural Resources Management Act of December 3, 1993 (107 Stat. 2011, 25 U.S.C. 3701 et seq.), as amended... tribe acting on behalf of BIA under § 162.109 of this part. Bond means security for the performance of... uncertain in duration, including a life estate. Lease means a written agreement between Indian landowners...

  5. 33 CFR 162.225 - Columbia and Willamette Rivers, Washington and Oregon; administration and navigation.

    Science.gov (United States)

    2010-07-01

    ... the river as appropriate such temporary speed regulations as he may deem necessary to protect the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Columbia and Willamette Rivers... NAVIGATION REGULATIONS § 162.225 Columbia and Willamette Rivers, Washington and Oregon; administration and...

  6. 26 CFR 1.162-14 - Expenditures for advertising or promotion of good will.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenditures for advertising or promotion of... and Corporations § 1.162-14 Expenditures for advertising or promotion of good will. A corporation... expenditures for advertising or the promotion of good will which it seeks to deduct in the taxable year may not...

  7. Measurements of np scattering at 96 and 162 MeV

    International Nuclear Information System (INIS)

    Olsson, N.; Rahm, J.; Blomgren, J.; Conde, H.; Dangtip, S.; Elmgren, K.; Roennqvist, T.; Zorro, R.; Ringbom, A.; Tibell, G.

    1998-01-01

    This paper presents new, precise measurements of differential cross sections for np scattering at 96 and 162 MeV. The data are steeper at backward angles than most previous data, and point to the classical value for the charged πNN coupling constant. (orig.)

  8. 46 CFR 162.050-20 - Separator and bilge alarm test fluids.

    Science.gov (United States)

    2010-10-01

    ... residual fuel oil in accordance with ISO 8217 (incorporated by reference, see § 162.050-4), type RMG 380... water; (ii) 25.0 g of Test Fluid A; (iii) 25.0 g of Test Fluid B; (iv) 0.5 g of surfactant (sodium salt...

  9. 19 CFR 162.66 - Penalties for unlading narcotic drugs or marihuana without a permit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Penalties for unlading narcotic drugs or marihuana... Substances, Narcotics, and Marihuana § 162.66 Penalties for unlading narcotic drugs or marihuana without a permit. In every case where a narcotic drug or marihuana is unladen without a permit, the penalties...

  10. 26 CFR 1.162-22 - Treble damage payments under the antitrust laws.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Treble damage payments under the antitrust laws... Corporations § 1.162-22 Treble damage payments under the antitrust laws. (a) In general. In the case of a... Federal antitrust laws or enters a plea of guilty or nolo contendere to an indictment or information...

  11. 19 CFR 162.96 - Remission of forfeitures and payment of fees, costs or interest.

    Science.gov (United States)

    2010-04-01

    ... Asset Forfeiture Reform Act § 162.96 Remission of forfeitures and payment of fees, costs or interest... for purposes of collection of any fees, costs or interest from the Government. ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Remission of forfeitures and payment of fees...

  12. RAF V Sweatman (162/2014) [2015] ZASCA 22 (20 march 2015) A ...

    African Journals Online (AJOL)

    RAF V Sweatman (162/2014) [2015] ZASCA 22 (20 march 2015) A simple illustration of the SCA's statutory ... Log in or Register to get access to full text downloads. ... The effect is that one of the primary purposes of the Amendment Act is ...

  13. 45 CFR 162.1902 - Standard for Medicaid pharmacy subrogation transaction.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Standard for Medicaid pharmacy subrogation... DATA STANDARDS AND RELATED REQUIREMENTS ADMINISTRATIVE REQUIREMENTS Medicaid Pharmacy Subrogation § 162.1902 Standard for Medicaid pharmacy subrogation transaction. The Secretary adopts the Batch Standard...

  14. 26 CFR 1.162-25T - Deductions with respect to noncash fringe benefits (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deductions with respect to noncash fringe... Individuals and Corporations § 1.162-25T Deductions with respect to noncash fringe benefits (temporary). (a) Employer. If an employer includes the value of a noncash fringe benefit in an employee's gross income, the...

  15. 26 CFR 1.162-25 - Deductions with respect to noncash fringe benefits.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deductions with respect to noncash fringe... Corporations § 1.162-25 Deductions with respect to noncash fringe benefits. (a) [Reserved] (b) Employee. If an employer provides the use of a vehicle (as defined in § 1.61-21(e)(2)) to an employee as a noncash fringe...

  16. 47 CFR 1.62 - Operation pending action on renewal application.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Operation pending action on renewal application... General Rules of Practice and Procedure General Application Procedures § 1.62 Operation pending action on renewal application. (a)(1) Where there is pending before the Commission at the time of expiration of...

  17. 40 CFR 81.162 - Northeast Plateau Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Plateau Intrastate Air... Air Quality Control Regions § 81.162 Northeast Plateau Intrastate Air Quality Control Region. The Northeast Plateau Intrastate Air Quality Control Region (California) consists of the territorial area...

  18. 26 CFR 1.162-17 - Reporting and substantiation of certain business expenses of employees.

    Science.gov (United States)

    2010-04-01

    ... Individuals and Corporations § 1.162-17 Reporting and substantiation of certain business expenses of employees.... The term “ordinary and necessary business expenses” means only those expenses which are ordinary and..., reimbursements, or otherwise, exceeds the ordinary and necessary business expenses paid or incurred by the...

  19. Kinetics of promethium-147 in a simulated pond

    International Nuclear Information System (INIS)

    Shang Zhaorong

    1995-03-01

    The dynamic behaviour of 147 Pm in a simulated aquatic ecosystem which consists of water, soil and aquatic lives. The results are as follows: The accumulation of 147 Pm in the ecosystem can be expressed by an exponential function; the aquatic plants have the highest capacity of concentration of 147 Pm, they can be used as bio-monitors and cleaning agents of contamination of 147 Pm in water; the absorption of 147 Pm by cardio is few, and the most of it accumulates in bone; 147 Pm in soil has little penetrability, and about 80% of it accumulates within 1 cm of top soil. (10 refs., 1 fig., 5 tabs.)

  20. 33 CFR 162.85 - Yazoo Diversion Canal, Vicksburg, Miss., from its mouth at Kleinston Landing to Fisher Street...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Yazoo Diversion Canal, Vicksburg, Miss., from its mouth at Kleinston Landing to Fisher Street; navigation. 162.85 Section 162.85... mouth at Kleinston Landing to Fisher Street; navigation. (a) Speed. Excessive speeding is prohibited. A...

  1. 25 CFR 162.201 - Must agricultural land be managed in accordance with a tribe's agricultural resource management...

    Science.gov (United States)

    2010-04-01

    ... identify holistic management objectives; and (5) Identify actions to be taken to reach established... tribe's agricultural resource management plan? 162.201 Section 162.201 Indians BUREAU OF INDIAN AFFAIRS... Must agricultural land be managed in accordance with a tribe's agricultural resource management plan...

  2. 40 CFR 429.162 - Effluent limitations representing the degree of effluent reduction attainable by the application...

    Science.gov (United States)

    2010-07-01

    ... technology (BCT). [Reserved] 429.162 Section 429.162 Protection of Environment ENVIRONMENTAL PROTECTION... Wood Furniture and Fixture Production Without Water Wash Spray Booth(s) or Without Laundry Facilities... application of the best conventional pollutant control technology (BCT). [Reserved] ...

  3. 27 CFR 1.62 - Use of distilled spirits or wine for experimental purposes and in manufacture of nonbeverage...

    Science.gov (United States)

    2010-04-01

    ... or wine for experimental purposes and in manufacture of nonbeverage products. 1.62 Section 1.62... experimental purposes and in manufacture of nonbeverage products. The use of distilled spirits or wine for experimental purposes and in the manufacture of (a) medicinal, pharmaceutical, or antiseptic products...

  4. The unpaired spectroscopy of sup 161,162 Er at spins up to 50 Dirac h

    Energy Technology Data Exchange (ETDEWEB)

    Riley, M.A.; Roberts, J.W.; Alderson, A.; Ali, I.; Cullen, D.M.; Fallon, P.; Forsyth, P.D.; Sharpey-Schafer, J.F. (Liverpool Univ. (UK). Oliver Lodge Lab.); Simpson, J.; Bentley, M.A.; Bruce, A.M. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Chapman, R.; Lisle, J.C.; Mo, J.N. (Manchester Univ. (UK). Schuster Lab.)

    1990-12-24

    High spin states in {sup 161}Er and {sup 162}Er have been populated using the {sup 130}Te+{sup 36}S reaction at a bombarding energy of 170 MeV. In {sup 161}Er, three rotational bands were extended from I {approx equal} 35{Dirac h} to I {approx equal} 50{Dirac h}. In {sup 162}Er the positive parity yrast band was observed to I=44{Dirac h}. These rotational sequences are compared to a simple unpaired model which was successful in predicting the behaviour of similar high spin data on {sup 159,160}Er. These studies of the light Er isotopes constitute the highest spins observed in normal deformed nuclei and yield direct and specific information on the single-neutron spectrum of states. (orig.).

  5. Identification of 162Gd and a new type of identical bands

    International Nuclear Information System (INIS)

    Jones, E. F.; Gore, P. M.; Hamilton, J. H.; Ramayya, A. V.; Dodder, R. S.; Beyer, C. J.; Hwang, J. K.; Zhang, X. Q.; Kormicki, J.; Zhu, S. J.; Lima, A. P. de; Cole, J. D.; Aryaeinejad, R.; Ma, W. C.; Ter-Akopian, G. M.; Daniel, A. V.; Oganessian, Yu. Ts.; Rasmussen, J. O.; Asztalos, S. J.; Lee, I. Y.

    1998-01-01

    From γ-γ-γ coincidence measurements in spontaneous fission of 252 Cf, level energies were established to spins 14 + to 20 + in many neutron-rich nuclei. New isotope 162 Gd was identified. Yrast bands of 152,154,156 Nd, 156,158,160 Sm, and 160,162 Gd exhibit near-identical transition energies and moments of inertia (MOI) shifted by the same constant amounts for every spin state from 2 + to 12 + or 14 + for nuclei differing by 2n, 4n, 2p, 4p, α, α+2p, and α+2n. These shifted identical bands (SIB) are a new phenomenon. Analysis of all known even-even proton- to neutron-rich nuclei from Ba(Z=56) to Os(Z=76) reveal no SIB for proton-rich nuclei and few cases of SIB for the most neutron-rich pairs around N=98-102 separated by 2n and 2p

  6. Microscopic analysis of wobbling excitations in 156Dy and 162Yb

    International Nuclear Information System (INIS)

    Nazmitdinov, R. G.; Kvasil, J.

    2007-01-01

    In the cranked Nilsson-plus-random-phase approximation, we study low-lying quadrupole excitations of positive parity and negative signature in 156 Dy and 162 Yb at high spins. Special attention is paid to a consistent description of wobbling excitations and their identification among excited states. A good agreement between the available experimental data and the results of calculations is obtained. We find that the lowest odd-spin γ-vibrational states in 156 Dy transform into wobbling excitations after the backbending associated with the transition from an axially symmetric shape to a nonaxial shape. Similar results are predicted for 162 Yb. The analysis of electromagnetic transitions uniquely determines the sign of the γ deformation in both nuclei after the transition point

  7. Yrast bands and signature inversion in double odd 162,164Lu

    International Nuclear Information System (INIS)

    Cardona, M.A.; Hojman, D.; Kreiner, A.J.; Somacal, H.; Davidson, J.; Davidson, M.; Acuna, D. de; Napoli, D.R.; Rico, J.; Burch, R.; Bazzacco, D.; Lenzi, S.M.; Rossi Alvarez, C.; Blasi, N.; Lo Bianco, G.

    1996-01-01

    High spin rotational bands in 162 Lu and 164 Lu have been studied by means of the 139 La( 28 Si,5n) and 139 La( 29(30) Si,4(5)n) reactions respectively. For both nuclei the yrast sequence which is associated with the πh 11/2 x νi 13/2 configuration shows the signature inversion feature. (orig.)

  8. The πNN coupling from high precision np charge exchange at 162 MeV

    International Nuclear Information System (INIS)

    Nilsson, J.; Blomgren, J.; Conde, H.; Elmgren, K.; Olsson, N.; Ericson, T.E.O.; Uppsala Univ.; Jonsson, O.; Nilsson, L.; Loiseau, B.; Ringbom, A.

    1995-02-01

    Differential cross sections for unpolarized neutrons of 162 MeV have been measured to high precision with particular attention to the absolute normalisation. These data can be extrapolated precisely and model-independently to the pion pole and give a πNN coupling constant g 2 =14.6±0.3 or f 2 =0.0808±0.0017. This is higher than recently suggested values. (author) 24 refs.; 3 figs.; 1 tab

  9. Internal motions in H II regions. XII S162 and NGC 7635

    Energy Technology Data Exchange (ETDEWEB)

    Pismis, P; Moreno, M A; Hasse, I [Universidad Nacional Autonoma de Mexico, Mexico City

    1983-01-01

    The apparent structure of S162 and of the bubble nebula (NGC 7635) associated with it is discussed using a number of direct images taken through narrow band (10 A/sup 0/) interference filters in H..cap alpha.., (N II) and in the continuum at lambda6607. The results are discussed together with the radial velocity field of S162 and in particular of the bubble nebula as obtained from photographic Fabry-Perot interferometry. The bubble nebula is shown to be composed of distinct and amorphous very regularly curving arcs, all inscribed on a tenuous slightly ellipsoidal shell of gas expanding at velocity of about 4 km s/sup -1/. The arcs are probably genetically related to the globules which form the caracteristic comet like feature within the bubble nebula. The ionization source of S162 is BD + 60/sup 0/2522 and 071Isub(b)f star classified from our high dispersion spectrum. Our very tentative suggestion is that the brightest globule may be an offshoot fo this star and that the globule has generated the next globule which in turn may have generated the third one. The configuration of NGC 7635 suggests that magnetic fields are likely to be operative in the region. Polarimetry in the optical and in the radio range as well as high resolution infrared studies, high resolution velocity fields are desirable to find a satisfactory model for this nebula.

  10. 40 CFR 417.162 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417.162 Effluent limitations guidelines... available (BPT): (a) For normal liquid detergent operations the following values pertain: Effluent...

  11. Activity in mice of recombinant BCG-EgG1Y162 vaccine for Echinococcus granulosus infection.

    Science.gov (United States)

    Ma, Xiumin; Zhao, Hui; Zhang, Fengbo; Zhu, Yuejie; Peng, Shanshan; Ma, Haimei; Cao, Chunbao; Xin, Yan; Yimiti, Delixiati; Wen, Hao; Ding, Jianbing

    2016-01-01

    Cystic hydatid disease is a zoonotic parasitic disease caused by Echinococcus granulosus which is distributed worldwide. The disease is difficult to treat with surgery removal is the only cure treatment. In the high endemic areas, vaccination of humans is believed a way to protect communities from the disease. In this study we vaccinated BALB/c mice with rBCG-EgG1Y162, and then detected the level of IgG and IgE specifically against the recombinant protein by ELISA, rBCG-EgG1Y162 induced strong and specific cellular and humoral immune responses. In vitro study showed that rBCG-EgG1Y162 vaccine not only promote splenocytes proliferation but also active T cell. In addition, the rBCG-EgG1Y162 induced a protection in the mice against secondary infection of Echinococcus granulosus.

  12. Mechanical analysis of a $\\beta=0.09 $ 162.5MHz taper HWR cavity

    OpenAIRE

    Fan, Peiliang; Zhu, Feng; Zhong, Hutianxiang; Quan, Shengwen; Liu, Kexin

    2015-01-01

    One superconducting taper-type half-wave resonator (HWR) with frequency of 162.5MHz, \\b{eta} of 0.09 has been developed at Peking University, which is used to accelerate high current proton ($\\sim$ 100mA) and $D^{+}$($\\sim$ 50mA). The radio frequency (RF) design of the cavity has been accomplished. Herein, we present the mechanical analysis of the cavity which is also an important aspect in superconducting cavity design. The frequency shift caused by bath helium pressure and Lorenz force, and...

  13. Report of AAPM Task Group 162: Software for planar image quality metrology.

    Science.gov (United States)

    Samei, Ehsan; Ikejimba, Lynda C; Harrawood, Brian P; Rong, John; Cunningham, Ian A; Flynn, Michael J

    2018-02-01

    The AAPM Task Group 162 aimed to provide a standardized approach for the assessment of image quality in planar imaging systems. This report offers a description of the approach as well as the details of the resultant software bundle to measure detective quantum efficiency (DQE) as well as its basis components and derivatives. The methodology and the associated software include the characterization of the noise power spectrum (NPS) from planar images acquired under specific acquisition conditions, modulation transfer function (MTF) using an edge test object, the DQE, and effective DQE (eDQE). First, a methodological framework is provided to highlight the theoretical basis of the work. Then, a step-by-step guide is included to assist in proper execution of each component of the code. Lastly, an evaluation of the method is included to validate its accuracy against model-based and experimental data. The code was built using a Macintosh OSX operating system. The software package contains all the source codes to permit an experienced user to build the suite on a Linux or other *nix type system. The package further includes manuals and sample images and scripts to demonstrate use of the software for new users. The results of the code are in close alignment with theoretical expectations and published results of experimental data. The methodology and the software package offered in AAPM TG162 can be used as baseline for characterization of inherent image quality attributes of planar imaging systems. © 2017 American Association of Physicists in Medicine.

  14. Ocular Toxicity Profile of ST-162 and ST-168 as Novel Bifunctional MEK/PI3K Inhibitors.

    Science.gov (United States)

    Smith, Andrew; Pawar, Mercy; Van Dort, Marcian E; Galbán, Stefanie; Welton, Amanda R; Thurber, Greg M; Ross, Brian D; Besirli, Cagri G

    2018-04-30

    ST-162 and ST-168 are small-molecule bifunctional inhibitors of MEK and PI3K signaling pathways that are being developed as novel antitumor agents. Previous small-molecule and biologic MEK inhibitors demonstrated ocular toxicity events that were dose limiting in clinical studies. We evaluated in vitro and in vivo ocular toxicity profiles of ST-162 and ST-168. Photoreceptor cell line 661W and adult retinal pigment epithelium cell line ARPE-19 were treated with increasing concentrations of bifunctional inhibitors. Western blots, cell viability, and caspase activity assays were performed to evaluate MEK and PI3K inhibition and dose-dependent in vitro toxicity, and compared with monotherapy. In vivo toxicity profile was assessed by intravitreal injection of ST-162 and ST-168 in Dutch-Belted rabbits, followed by ocular examination and histological analysis of enucleated eyes. Retinal cell lines treated with ST-162 or ST-168 exhibited dose-dependent inhibition of MEK and PI3K signaling. Compared with inhibition by monotherapies and their combinations, bifunctional inhibitors demonstrated reduced cell death and caspase activity. In vivo, both bifunctional inhibitors exhibited a more favorable toxicity profile when compared with MEK inhibitor PD0325901. Novel MEK and PI3K bifunctional inhibitors ST-162 and ST-168 demonstrate favorable in vitro and in vivo ocular toxicity profiles, supporting their further development as potential therapeutic agents targeting multiple aggressive tumors.

  15. On the relation between the statistical γ-decay and the level density in 162Dy

    International Nuclear Information System (INIS)

    Henden, L.; Bergholt, L.; Guttormsen, M.; Rekstad, J.; Tveter, T.S.

    1994-12-01

    The level density of low-spin states (0-10ℎ) in 162 Dy has been determined from the ground state up to approximately 6 MeV of excitation energy. Levels in the excitation region up to 8 MeV were populated by means of the 163 Dy( 3 He, α) reaction, and the first-generation γ-rays in the decay of these states has been isolated. The energy distribution of the first-generation γ-rays provides a new source of information about the nuclear level density over a wide energy region. A broad peak is observed in the first-generation spectra, and the authors suggest an interpretation in terms of enhanced M1 transitions between different high-j Nilsson orbitals. 30 refs., 9 figs., 2 tabs

  16. np scattering measurements at 162 MeV and the πNN coupling constant

    International Nuclear Information System (INIS)

    Rahm, J.; Blomgren, J.; Conde, H.; Dangtip, S.; Elmgren, K.; Olsson, N.; Roennqvist, T.; Zorro, R.; Ringbom, A.; Tibell, G.; Jonsson, O.; Nilsson, L.; Renberg, P.U.; Ericson, T.E.O.; Loiseau, B.

    1999-01-01

    The differential np scattering cross sections has been measured at 162 MeV in the angular range θ c.m. = 72 angle - 180 angle, using the neutron beam facility at the Svedberg Laboratory in Uppsala. Special attention was paid to the absolute normalization of the data. In the angular range 150 angle - 180 angle, the data are steeper then those of most previous measurements and predictions from energy-dependent partial-wave analyses, or nucleon-nucleon potentials. Moreover, a value of the charged πNN coupling constant, g π± 2 = 14.52 ± 0.26 (f π± 2 = 0.0803 ± 0.0014), is deduced from the data, using a novel extrapolation method. This is in good agreement with the classical text book value, but higher than those determined in recent partial-wave analyses of the nucleon-nucleon data base. (authors)

  17. Pregnancy outcome in 162 women with rheumatic diseases: experience of a university hospital in Turkey.

    Science.gov (United States)

    Davutoğlu, Ebru Alici; Ozel, Aysegul; Yılmaz, Nevin; Madazli, Riza

    2017-12-01

    To evaluate the distribution and the obstetric outcomes of pregnancies with different types of rheumatic diseases managed in our unit. Pregnancies of 162 women with rheumatic diseases, seen for their antenatal care at our department for the period between 2013 and 2017 were included in this retrospective clinical study. Obstetric and perinatal outcomes were main outcome measures. The most encountered rheumatic diseases were SLE (37.7%) followed by Behcet's disease (20.4%) and rheumatoid arthritis (17.3%) in our series. The mean maternal age was 30.6 ± 5.3 and the rate of nulliparity was 38.3% in the overall group. Disease activation occurred in 14.1% of patients. Mean gestational age at delivery was 37.4 ± 3.1 and mean birth weight was 3004 ± 762 g. Stillbirth, neonatal death, fetal growth restriction, preeclampsia and preterm delivery rates were 1.2, 2.4, 17.3, 7.4 and 17.9%, respectively. Antiphospholipid syndrome had the highest incidences for fetal growth restriction (42.9%), preeclampsia (28.6%) and delivery ≤ 34 gestational weeks (42.9%). Pathologic uterine artery Doppler velocimetry was identified in 15 cases (15/162, 9.3%) in which 10 (66.7%) developed preeclampsia and/or fetal growth restriction during follow-up. A majority of women with rheumatic diseases have successful pregnancies and deliver healthy babies, with the close and appropriate rheumatological, obstetric and neonatal monitoring.

  18. CAUGHT IN THE ACT: THE ASSEMBLY OF MASSIVE CLUSTER GALAXIES AT z = 1.62

    International Nuclear Information System (INIS)

    Lotz, Jennifer M.; Ferguson, Henry C.; Grogin, Norman; Koekemoer, Anton M.; Papovich, Casey; Tran, Kim-Vy; Faber, S. M.; Guo Yicheng; Kocevski, Dale; Lee, Kyoung-Soo; McIntosh, Daniel; Momcheva, Ivelina; Rudnick, Gregory; Saintonge, Amelie; Van der Wel, Arjen; Willmer, Christopher

    2013-01-01

    We present the recent merger history of massive galaxies in a spectroscopically confirmed proto-cluster at z = 1.62. Using Hubble Space Telescope WFC3 near-infrared imaging from the Cosmic Assembly Near-infrared Deep Extragalactic Legacy Survey, we select cluster and z ∼ 1.6 field galaxies with M star ≥ 3 × 10 10 M ☉ , to determine the frequency of double nuclei or close companions within projected separations less than 20 kpc co-moving. We find that four out of five spectroscopically confirmed massive proto-cluster galaxies have double nuclei, and 57 +13 -14 % of all M star ≥ 3 × 10 10 M ☉ cluster candidates are observed in either close pair systems or have double nuclei. In contrast, only 11% ± 3% of the field galaxies are observed in close pair/double nuclei systems. After correcting for the contribution from random projections, the implied merger rate per massive galaxy in the proto-cluster is ∼3-10 times higher than the merger rate of massive field galaxies at z ∼ 1.6. Close pairs in the cluster have minor merger stellar mass ratios (M primary : M satellite ≥ 4), while the field pairs consist of both major and minor mergers. At least half of the cluster mergers are gas-poor, as indicated by their red colors and low 24 μm fluxes. Two of the double-nucleated cluster members have X-ray detected active galactic nuclei with L x > 10 43 erg s –1 , and are strong candidates for dual or offset super-massive black holes. We conclude that the massive z = 1.62 proto-cluster galaxies are undergoing accelerated assembly via minor mergers, and discuss the implications for galaxy evolution in proto-cluster environments

  19. Pathologic features of lower extremity arterial lesions in diabetes mellitus:an analysis of 162 patients

    International Nuclear Information System (INIS)

    Guo Xiangjiang; Zhang Jiwei

    2010-01-01

    Objective: To investigate the angiographic manifestations of lower extremity atherosclerotic occlusion in patients with diabetes mellitus. Methods: The angiographic findings of lower extremity in 162 patients with diabetes mellitus were retrospectively analyzed. (1) The arteries of lower extremity were divided into the following four segments: iliac, femoral, popliteal and crural artery. The involvements of these arteries were documented. (2) Based on the lesion's number, location, nature (stricture or occlusion) and length ( 5 cm), the diabetic arterial diseases were categorized. Results: (1) Of 162 diabetic lower limbs, multiple segmental lesions were seen in 131, superficial femoral arterial lesions in 130, and crural arterial lesions in 139, of which 130 arterial lesions had at least two below-the-knee arteries being involved. (2) Based on segmental angiographic classification, a total of 660 vascular lesions were detected, including stricture lesions (33.8%) and occlusive lesions (66.2%). Of the 437 occlusions, 70.5% were located in below-the-knee arteries, and most of which were longer than 10 cm and located in anterior and posterior tibial arteries, while only a few peroneal arteries were involved (P < 0.0001). One hundred and fifty-two lesions were detected in superficial femoral arteries, of which 49 (31.2%) were located at the origin of the superficial femoral artery and 56 (35.7) were in the adductor canal hiatus. Conclusion: The main feature of peripheral arterial disease of lower extremity caused by diabetes mellitus is multi-level atherosclerotic occlusion, the superficial femoral and the crural arteries are most likely to be involved. The lesions of superficial femoral artery are often located at the arterial origin and in the adductor canal hiatus, while the deep femoral artery and the femoral artery are less involved. Long occlusive lesions are more prevalent in crural arteries, especially in anterior and posterior tibial arteries. (J Intervent

  20. Pectin Enhances Bio-Control Efficacy by Inducing Colonization and Secretion of Secondary Metabolites by Bacillus amyloliquefaciens SQY 162 in the Rhizosphere of Tobacco.

    Directory of Open Access Journals (Sweden)

    Kai Wu

    Full Text Available Bacillus amyloliquefaciens is a plant-beneficial Gram-positive bacterium involved in suppressing soil-borne pathogens through the secretion of secondary metabolites and high rhizosphere competence. Biofilm formation is regarded as a prerequisite for high rhizosphere competence. In this work, we show that plant extracts affect the chemotaxis and biofilm formation of B. amyloliquefaciens SQY 162 (SQY 162. All carbohydrates tested induced the chemotaxis and biofilm formation of the SQY 162 strain; however, the bacterial growth rate was not influenced by the addition of carbohydrates. A strong chemotactic response and biofilm formation of SQY 162 were both induced by pectin through stimulation of surfactin synthesis and transcriptional expression of biofilm formation related matrix genes. These results suggested that pectin might serve as an environmental factor in the stimulation of the biofilm formation of SQY 162. Furthermore, in pot experiments the surfactin production and the population of SQY 162 in the rhizosphere significantly increased with the addition of sucrose or pectin, whereas the abundance of the bacterial pathogen Ralstonia decreased. With increased production of secondary metabolites in the rhizosphere of tobacco by SQY 162 and improved colonization density of SQY 162 in the pectin treatment, the disease incidences of bacterial wilt were efficiently suppressed. The present study revealed that certain plant extracts might serve as energy sources or environmental cues for SQY 162 to enhance the population density on tobacco root and bio-control efficacy of tobacco bacterial wilt.

  1. 41 CFR 301-10.162 - When may I use other than coach-class train accommodations?

    Science.gov (United States)

    2010-07-01

    ... 10-TRANSPORTATION EXPENSES Common Carrier Transportation Train § 301-10.162 When may I use other than... require other than coach-class rail accommodations. Exceptional security circumstances are determined by... accommodations on an authorized/approved foreign rail carrier do not provide adequate sanitation or health...

  2. 76 FR 37034 - Certain Employee Remuneration in Excess of $1,000,000 Under Internal Revenue Code Section 162(m)

    Science.gov (United States)

    2011-06-24

    ... Certain Employee Remuneration in Excess of $1,000,000 Under Internal Revenue Code Section 162(m) AGENCY... remuneration in excess of $1,000,000 under the Internal Revenue Code (Code). The proposed regulations clarify... stock options, it is intended that the directors may retain discretion as to the exact number of options...

  3. 33 CFR 162.220 - Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoover Dam, Lake Mead, and Lake... REGULATIONS § 162.220 Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev. (a) Lake Mead and... the axis of Hoover Dam and that portion of Lake Mohave (Colorado River) extending 4,500 feet...

  4. 25 CFR 162.110 - Can these regulations be administered by tribes, on the Secretary's or on BIA's behalf?

    Science.gov (United States)

    2010-04-01

    ... entered into under the Indian Self-Determination and Education Assistance Act (25 U.S.C. § 450f et seq.). ... 25 Indians 1 2010-04-01 2010-04-01 false Can these regulations be administered by tribes, on the... INTERIOR LAND AND WATER LEASES AND PERMITS General Provisions § 162.110 Can these regulations be...

  5. Decay properties of nuclei close to Z = 108 and N = 162

    International Nuclear Information System (INIS)

    Dvorak, Jan

    2007-01-01

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear

  6. PPARα L162V underlies variation in serum triglycerides and subcutaneous fat volume in young males

    Directory of Open Access Journals (Sweden)

    Clarkson Priscilla M

    2007-08-01

    Full Text Available Abstract Background Of the five sub-phenotypes defining metabolic syndrome, all are known to have strong genetic components (typically 50–80% of population variation. Studies defining genetic predispositions have typically focused on older populations with metabolic syndrome and/or type 2 diabetes. We hypothesized that the study of younger populations would mitigate many confounding variables, and allow us to better define genetic predisposition loci for metabolic syndrome. Methods We studied 610 young adult volunteers (average age 24 yrs for metabolic syndrome markers, and volumetric MRI of upper arm muscle, bone, and fat pre- and post-unilateral resistance training. Results We found the PPARα L162V polymorphism to be a strong determinant of serum triglyceride levels in young White males, where carriers of the V allele showed 78% increase in triglycerides relative to L homozygotes (LL = 116 ± 11 mg/dL, LV = 208 ± 30 mg/dL; p = 0.004. Men with the V allele showed lower HDL (LL = 42 ± 1 mg/dL, LV = 34 ± 2 mg/dL; p = 0.001, but women did not. Subcutaneous fat volume was higher in males carrying the V allele, however, exercise training increased fat volume of the untrained arm in V carriers, while LL genotypes significantly decreased in fat volume (LL = -1,707 ± 21 mm3, LV = 17,617 ± 58 mm3 ; p = 0.002, indicating a systemic effect of the V allele on adiposity after unilateral training. Our study suggests that the primary effect of PPARα L162V is on serum triglycerides, with downstream effects on adiposity and response to training. Conclusion Our results on association of PPARα and triglycerides in males showed a much larger effect of the V allele than previously reported in older and less healthy populations. Specifically, we showed the V allele to increase triglycerides by 78% (p = 0.004, and this single polymorphism accounted for 3.8% of all variation in serum triglycerides in males (p = 0.0037.

  7. 46 CFR 162.050-4 - Incorporation by reference: Where can I get a copy of the publications mentioned in this part?

    Science.gov (United States)

    2010-10-01

    ... ENGINEERING EQUIPMENT Pollution Prevention Equipment § 162.050-4 Incorporation by reference: Where can I get a....org): (1) International Standard ISO 8217 Third edition 2005-11-01, Petroleum products—Fuels (class F)—Specifications of marine fuels (“ISO 8217”), incorporation by reference approved for § 162.050-20. (2...

  8. 34 CFR 222.162 - What disparity standard must a State meet in order to be certified and how are disparities in...

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What disparity standard must a State meet in order to be certified and how are disparities in current expenditures or revenues per pupil measured? 222.162... of the Act § 222.162 What disparity standard must a State meet in order to be certified and how are...

  9. 42 CFR 84.162 - Man test for gases and vapors; Type C respirators, continuous-flow class and Type CE supplied-air...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type C respirators, continuous-flow class and Type CE supplied-air respirators; test requirements. 84.162 Section 84.162 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL...

  10. Pitfalls of CT for deep neck abscess imaging assessment: a retrospective review of 162 cases.

    Science.gov (United States)

    Chuang, S Y; Lin, H T; Wen, Y S; Hsu, F J

    2013-01-01

    To investigate the diagnostic value of contrast-enhanced computed tomography (CT) for the prediction of deep neck abscesses in different deep neck spaces and to evaluate the false-positive results. We retrospectively analysed the clinical charts, CT examinations, surgical findings, bacteriology, pathological examinations and complications of hospitalised patients with a diagnosis of deep neck abscess from 2004 to 2010. The positive predictive values (PPV) for the prediction of abscesses by CT scan in different deep neck spaces were calculated individually on the basis of surgical findings. A total of 162 patients were included in this study. All patients received both intravenous antibiotics and surgical drainage. The parapharyngeal space was the most commonly involved space. The overall PPV for the prediction of deep neck abscess with contrast-enhanced CT was 79.6%. The PPV was 91.3% when more than one deep neck space was involved but only 50.0% in patients with isolated retropharyngeal abscesses. In the false-positive group, cellulitis was the most common final result, followed by cystic degeneration of cervical metastases. Five specimens taken intra-operatively revealed malignancy and four of these were not infected. There are some limitations affecting the differentiation of abscesses and cellulitis, particularly in the retropharyngeal space. A central necrotic cervical metastatic lymph node may sometimes also mimic a simple pyogenic deep neck abscess on both clinical pictures and CT images. Routine biopsy of the tissue must be performed during surgical drainage.

  11. 162.5 MHz digital low-level radio frequency control monitoring system design and implementation

    International Nuclear Information System (INIS)

    Zhang Ruifeng; Wang Xianwu; Xu Zhe; Yi Xiaoping

    2014-01-01

    162.5 MHz high-frequency low-level control system self-developed by Institute of Modern Physics for ADS project took digital technology. All parameters' reading and writing, including loop parameter setting, open and close-loop operation, and condition monitoring, were achieved through the monitoring system. The system used lightweight client-server working mode that client running in the PC sent command data, server running on high-frequency digital low level system responded instructions to complete parameter monitoring and control. The system consisted of three parts. Firstly, server hardware system was constructed based on Atera Stratix Ⅲ family of field-programmable gate array (FPGA) development board. Secondly, the server software system was designed based on Micro C/OS Ⅱ real-time operating systems and lightweight TCP/IP protocol stack, and finally a client PC program was designed based on MFC. After a long test, it was indicated that the monitoring system works properly and stably. TCP sends and receives throughput reached 11.931038 Mbps and 8.117624 Mbps. (authors)

  12. Correlation between the progressive cytoplasmic expression of a novel small heat shock protein (Hsp16.2) and malignancy in brain tumors

    International Nuclear Information System (INIS)

    Pozsgai, Eva; Gomori, Eva; Szigeti, Andras; Boronkai, Arpad; Gallyas, Ferenc Jr; Sumegi, Balazs; Bellyei, Szabolcs

    2007-01-01

    Small heat shock proteins are molecular chaperones that protect proteins against stress-induced aggregation. They have also been found to have anti-apoptotic activity and to play a part in the development of tumors. Recently, we identified a new small heat shock protein, Hsp16.2 which displayed increased expression in neuroectodermal tumors. Our aim was to investigate the expression of Hsp16.2 in different types of brain tumors and to correlate its expression with the histological grade of the tumor. Immunohistochemistry with a polyclonal antibody to Hsp16.2 was carried out on formalin-fixed, paraffin-wax-embedded sections using the streptavidin-biotin method. 91 samples were examined and their histological grade was defined. According to the intensity of Hsp16.2 immunoreactivity, low (+), moderate (++), high (+++) or none (-) scores were given. Immunoblotting was carried out on 30 samples of brain tumors using SDS-polyacrylamide gel electrophoresis and Western-blotting. Low grade (grades 1–2) brain tumors displayed low cytoplasmic Hsp16.2 immunoreactivity, grade 3 tumors showed moderate cytoplasmic staining, while high grade (grade 4) tumors exhibited intensive cytoplasmic Hsp16.2 staining. Immunoblotting supported the above mentioned results. Normal brain tissue acted as a negative control for the experiment, since the cytoplasm did not stain for Hsp16.2. There was a positive correlation between the level of Hsp16.2 expression and the level of anaplasia in different malignant tissue samples. Hsp16.2 expression was directly correlated with the histological grade of brain tumors, therefore Hsp16.2 may have relevance as becoming a possible tumor marker

  13. Correlation between the progressive cytoplasmic expression of a novel small heat shock protein (Hsp16.2 and malignancy in brain tumors

    Directory of Open Access Journals (Sweden)

    Gallyas Ferenc

    2007-12-01

    Full Text Available Abstract Background Small heat shock proteins are molecular chaperones that protect proteins against stress-induced aggregation. They have also been found to have anti-apoptotic activity and to play a part in the development of tumors. Recently, we identified a new small heat shock protein, Hsp16.2 which displayed increased expression in neuroectodermal tumors. Our aim was to investigate the expression of Hsp16.2 in different types of brain tumors and to correlate its expression with the histological grade of the tumor. Methods Immunohistochemistry with a polyclonal antibody to Hsp16.2 was carried out on formalin-fixed, paraffin-wax-embedded sections using the streptavidin-biotin method. 91 samples were examined and their histological grade was defined. According to the intensity of Hsp16.2 immunoreactivity, low (+, moderate (++, high (+++ or none (- scores were given. Immunoblotting was carried out on 30 samples of brain tumors using SDS-polyacrylamide gel electrophoresis and Western-blotting. Results Low grade (grades 1–2 brain tumors displayed low cytoplasmic Hsp16.2 immunoreactivity, grade 3 tumors showed moderate cytoplasmic staining, while high grade (grade 4 tumors exhibited intensive cytoplasmic Hsp16.2 staining. Immunoblotting supported the above mentioned results. Normal brain tissue acted as a negative control for the experiment, since the cytoplasm did not stain for Hsp16.2. There was a positive correlation between the level of Hsp16.2 expression and the level of anaplasia in different malignant tissue samples. Conclusion Hsp16.2 expression was directly correlated with the histological grade of brain tumors, therefore Hsp16.2 may have relevance as becoming a possible tumor marker.

  14. Decay properties of nuclei close to Z = 108 and N = 162

    Energy Technology Data Exchange (ETDEWEB)

    Dvorak, Jan

    2007-07-12

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The

  15. Religiousness as a Predictor of Suicide: An Analysis of 162 European Regions.

    Science.gov (United States)

    Stack, Steven; Laubepin, Frederique

    2018-01-25

    Research on religion as a protective factor has been marked by four recurrent limitations: (1) an overemphasis on the United States, a nation where religiosity is relatively high; (2) a neglect of highly secularized zones of the world, where religiousness may be too weak to affect suicide; (3) restriction of religiousness to religious affiliation, a construct which may miss capturing other dimensions of religiousness such as the importance of religion in one's life; and (4) an overwhelming use of the nation as a unit of analysis, which masks variation in religiousness within nations. The present article addresses these limitations by performing a cross-national test of the following hypothesis: The greater the strength of subjective religiousness, the lower the suicide rate, using small units of analysis for a secularized area of the world. All data refer to 162 regions within 22 European nations. Data were extracted from two large databases, EUROSTAT and the European Social Surveys (ESS Round 4), and merged using NUTS-2 (Nomenclature of Statistical Territorial Units) regions as the unit of analysis. Controls are incorporated for level of economic development, education, and measures of economic strain. The results of a multiple regression analysis demonstrated that controlling for the other constructs in the model, religiousness is associated with lower suicide rates, confirming the hypothesis. Even in secularized European nations, where there is a relatively weak moral community to reinforce religion, religiousness acts as a protective factor against suicide. Future work is needed to explore the relationship in other culture zones of the world. © 2018 The American Association of Suicidology.

  16. Genitourinary injuries after traffic accidents: Analysis of a registry of 162,690 victims.

    Science.gov (United States)

    Terrier, Jean-Etienne; Paparel, Philippe; Gadegbeku, Blandine; Ruffion, Alain; Jenkins, Lawrence C; N'Diaye, Amina

    2017-06-01

    Traffic accidents are the most frequent cause of genitourinary injuries (GUI). Kidney injuries after trauma have been well described. However, there exists a paucity of data on other traumatic GUI after traffic accidents. The objective of this study was to analyze the frequency and type of all GUI, by user category, after traffic accidents. Patient cases were extracted from the trauma registry of the French department of Rhone from 1996 to 2013. We assessed the urogenital injuries presented by each of road user's categories. Severity injuries were coded with the Abbreviated Injury Scale and the Injury Severity Score. Kidney trauma was mapped with the classification of the American Association for the Surgery of Trauma. Multivariate prediction models were used for analysis of data. Of 162,690 victims, 963 presented with GUI (0.59%). 47% were motorcyclists, 22% were in a car, 18% on bicycles, and 9% were pedestrians. The most common organ injury was kidney (41%) followed by testicular (23%). Among the 208 motorists with a GUI, kidney (70%), bladder (10%), and adrenal gland (9%) were the most frequent lesions. Among the 453 motorcyclist victims with GUI, kidney (35%) and testicular (38%) traumas were the most frequent and 62% of injuries involved external genitalia. There were 175 cyclists with GUI, 70% of injuries involved external genitalia; penile traumas (23%) were the most frequent. In total, there were 395 kidney injuries, most being low grade. According to the American Association for the Surgery of Trauma kidney injuries were grade I, 59%; grade II, 11%; grade III, 16%; grade IV, 9%; grade V, 3%; and indeterminate, 2%. GUI is an infrequent trauma after traffic accidents, with kidneys being the most commonly injured. Physicians must maintain a high awareness for external genitalia injuries in motorcyclists and cyclists. Prognostic and epidemiologic study, level III.

  17. Surgical management of juvenile nasopharyngeal angiofibroma: analysis of 162 cases from 1995 to 2012.

    Science.gov (United States)

    Huang, Yang; Liu, Zhuofu; Wang, Jingjing; Sun, Xicai; Yang, Lei; Wang, Dehui

    2014-08-01

    The purpose of this study was to report on a series of 162 patients presenting with juvenile nasopharyngeal angiofibroma in a single academic hospital during the past 17 years, in an effort to compare outcomes between open and transnasal endoscopic approach, and to define an ideal treatment strategy. Patients who received either open or endoscopic surgery with a minimum follow-up of 6 months were selected. Local control and complications were compared between groups. Retrospectively, clinical data, surgical reports, pre- and postoperative images, and follow-up information were reviewed and analyzed. All patients were male subjects from 8 to 41 years old. Ninety-six patients were treated by transpalatal or transmaxillary approach, and the remaining 66 patients were treated using transnasal endoscopic approach with/without labiogingival incision. When compared to the open surgery group, the endoscopic surgery group showed a lower median intraoperative blood loss (800 vs. 1100 mL, P = .017) and a lower number of postoperative complications (one vs. 10). In addition, recurrence statistically correlated with Radkowski's classification and patient age. Transnasal endoscopic approach can be successfully used for Radkowski's stages I-IIb tumors and selective IIc-IIIb lesions, allowing for less blood loss, fewer postoperative complications, and a lower percentage of recurrence in comparison to open surgery. The management of recurrent tumor is complex, should be individually tailored, and should take into account tumor location, patient age, complications of treatment, and the possibility of spontaneous involution, to better define treatment strategy. © 2014 The American Laryngological, Rhinological and Otological Society, Inc.

  18. DISCOVERY OF A STRONG LENSING GALAXY EMBEDDED IN A CLUSTER AT z = 1.62

    International Nuclear Information System (INIS)

    Wong, Kenneth C.; Suyu, Sherry H.; Tran, Kim-Vy H.; Papovich, Casey J.; Momcheva, Ivelina G.; Brammer, Gabriel B.; Koekemoer, Anton M.; Brodwin, Mark; Gonzalez, Anthony H.; Kacprzak, Glenn G.; Rudnick, Gregory H.; Halkola, Aleksi

    2014-01-01

    We identify a strong lensing galaxy in the cluster IRC 0218 (also known as XMM-LSS J02182–05102) that is spectroscopically confirmed to be at z = 1.62, making it the highest-redshift strong lens galaxy known. The lens is one of the two brightest cluster galaxies and lenses a background source galaxy into an arc and a counterimage. With Hubble Space Telescope (HST) grism and Keck/LRIS spectroscopy, we measure the source redshift to be z S = 2.26. Using HST imaging in ACS/F475W, ACS/F814W, WFC3/F125W, and WFC3/F160W, we model the lens mass distribution with an elliptical power-law profile and account for the effects of the cluster halo and nearby galaxies. The Einstein radius is θ E =0.38 −0.01 +0.02 arcsec (3.2 −0.1 +0.2 kpc) and the total enclosed mass is M tot (<θ E )=1.8 −0.1 +0.2 ×10 11 M ⊙ . We estimate that the cluster environment contributes ∼10% of this total mass. Assuming a Chabrier initial mass function (IMF), the dark matter fraction within θ E is f DM Chab =0.3 −0.3 +0.1 , while a Salpeter IMF is marginally inconsistent with the enclosed mass (f DM Salp =−0.3 −0.5 +0.2 ). The total magnification of the source is μ tot =2.1 −0.3 +0.4 . The source has at least one bright compact region offset from the source center. Emission from Lyα and [O III] are likely to probe different regions in the source

  19. Study of elastic pion scattering from 9Be, 28Si, 58Ni, and 208Pb at 162 MeV

    International Nuclear Information System (INIS)

    Devereux, M.J.

    1979-05-01

    Elastic pion scattering from 9 Be, 28 Si, 58 Ni, and 208 Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references

  20. Separation of boron isotopes by ion exchange chromatography: studies with Duolite-162, a type-II resin

    International Nuclear Information System (INIS)

    Sharma, B.K.; Subramanian, R.; Balasubramanian, R.; Mathur, P.K.

    1994-01-01

    The selection of resin plays an important role in the process of separation of boron isotopes by ion exchange chromatography. The determination of (i) ion exchange capacity of Duolite-162 resin for hydroxyl - chloride exchange, (ii) hydroxyl - borate exchange, (iii) isotopic exchange separation factor by batch method and (iv) effect of concentration of boric acid on isotopic exchange separation factor to test the suitability of the above resin for this process are discussed in this report. (author)

  1. Development and validation of an event-specific quantitative PCR method for genetically modified maize MIR162.

    Science.gov (United States)

    Takabatake, Reona; Masubuchi, Tomoko; Futo, Satoshi; Minegishi, Yasutaka; Noguchi, Akio; Kondo, Kazunari; Teshima, Reiko; Kurashima, Takeyo; Mano, Junichi; Kitta, Kazumi

    2014-01-01

    A novel real-time PCR-based analytical method was developed for the event-specific quantification of a genetically modified (GM) maize event, MIR162. We first prepared a standard plasmid for MIR162 quantification. The conversion factor (Cf) required to calculate the genetically modified organism (GMO) amount was empirically determined for two real-time PCR instruments, the Applied Biosystems 7900HT (ABI7900) and the Applied Biosystems 7500 (ABI7500) for which the determined Cf values were 0.697 and 0.635, respectively. To validate the developed method, a blind test was carried out in an interlaboratory study. The trueness and precision were evaluated as the bias and reproducibility of relative standard deviation (RSDr). The determined biases were less than 25% and the RSDr values were less than 20% at all evaluated concentrations. These results suggested that the limit of quantitation of the method was 0.5%, and that the developed method would thus be suitable for practical analyses for the detection and quantification of MIR162.

  2. DISCOVERY OF A STRONG LENSING GALAXY EMBEDDED IN A CLUSTER AT z = 1.62

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Kenneth C.; Suyu, Sherry H. [Institute of Astronomy and Astrophysics, Academia Sinica (ASIAA), P.O. Box 23-141, Taipei 10617, Taiwan (China); Tran, Kim-Vy H.; Papovich, Casey J. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics and Astronomy, Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); Momcheva, Ivelina G. [Astronomy Department, Yale University, New Haven, CT 06511 (United States); Brammer, Gabriel B.; Koekemoer, Anton M. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Brodwin, Mark [Department of Physics and Astronomy, University of Missouri, 5110 Rockhill Road, Kansas City, MO 64110 (United States); Gonzalez, Anthony H. [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Kacprzak, Glenn G. [Swinburne University of Technology, Victoria 3122 (Australia); Rudnick, Gregory H. [Department of Physics and Astronomy, The University of Kansas, Malott Room 1082, 1251 Wescoe Hall Drive, Lawrence, KS 66045 (United States); Halkola, Aleksi

    2014-07-10

    We identify a strong lensing galaxy in the cluster IRC 0218 (also known as XMM-LSS J02182–05102) that is spectroscopically confirmed to be at z = 1.62, making it the highest-redshift strong lens galaxy known. The lens is one of the two brightest cluster galaxies and lenses a background source galaxy into an arc and a counterimage. With Hubble Space Telescope (HST) grism and Keck/LRIS spectroscopy, we measure the source redshift to be z {sub S} = 2.26. Using HST imaging in ACS/F475W, ACS/F814W, WFC3/F125W, and WFC3/F160W, we model the lens mass distribution with an elliptical power-law profile and account for the effects of the cluster halo and nearby galaxies. The Einstein radius is θ{sub E}=0.38{sub −0.01}{sup +0.02} arcsec (3.2{sub −0.1}{sup +0.2} kpc) and the total enclosed mass is M {sub tot}(<θ{sub E})=1.8{sub −0.1}{sup +0.2}×10{sup 11} M{sub ⊙}. We estimate that the cluster environment contributes ∼10% of this total mass. Assuming a Chabrier initial mass function (IMF), the dark matter fraction within θ{sub E} is f{sub DM}{sup Chab}=0.3{sub −0.3}{sup +0.1}, while a Salpeter IMF is marginally inconsistent with the enclosed mass (f{sub DM}{sup Salp}=−0.3{sub −0.5}{sup +0.2}). The total magnification of the source is μ{sub tot}=2.1{sub −0.3}{sup +0.4}. The source has at least one bright compact region offset from the source center. Emission from Lyα and [O III] are likely to probe different regions in the source.

  3. Coulomb excitation of rotational states in the 162Dy nucleus in the framework of the generalized semiclassical approximation

    International Nuclear Information System (INIS)

    Bolotin, Yu.L.; Gonchar, V.Yu.; Chekanov, N.A.

    1985-01-01

    Coulomb excitation of rotational states induced in heavyion collisions is treated in the framework of the generalized semiclassical approximation. The Hamiltonian of the system under consideration involves not only Coulomb forces (monopole, quadrupole, and hexadecapole) but as well a real nuclear potential in the form of the deformed Woods-Saxon potential. Strong dependence of the excitation probability on the interference between the Coulomb and nuclear interactions is shown. Calculations are carried out for the reaction 40 Ar+ 162 Dy at E=148.6 MeV. The calculated Coulomb excitation probabilities agree satisfactory with the corresponding experimental values

  4. Persamaan Unsur Pokok Pada Suatu Merek Terkenal (Analisis Putusan MA Nomor 162 K/Pdt.Sus-HKI/2014

    Directory of Open Access Journals (Sweden)

    Dandi Pahusa

    2016-04-01

    Full Text Available Abstract: Equation Basic Element In A Famous Brand (Analysis of the Decision of the Supreme Court Number 162 K / Pdt.Sus-IPR / 2014. Criteria for determining the equation of the constituents in a well-known brand that is the similarity of images, sounds, names, words, letters, numbers, color composition or a combination of these elements, either for goods or services that are similar or dissimilar based on general knowledge of the public, the brand earned a reputation as a massive campaign, and with evidence of the trademark registration in several countries. The impact of the decision of the Supreme Court Number 162 K / Pdt.Sus-IPR / 2014 for brand owners who have registered and well-known to always protect its brand, namely by taking into account the bad faith of the owner of the other brands. If there are other brands that have been registered in the Directorate General of Intellectual Property and published in General News Brands, the owner of the mark that has been registered in advance immediately appealed and the cancellation of the trademark. Abstrak: Persamaan Unsur Pokok Pada Suatu Merek Terkenal (Analisis atas Putusan MA Nomor 162 K/Pdt.Sus-HKI/2014. Kriteria penentuan persamaan unsur pokok pada suatu merek terkenal yaitu adanya kemiripan gambar, bunyi, nama, kata, huruf-huruf, angka-angka, susunan warna atau kombinasi dari unsur-unsur tersebut, baik terhadap barang atau jasa yang sejenis maupun tidak sejenis yang didasarkan pada pengetahuan umum masyarakat, reputasi merek yang diperoleh karena promosi besar-besaran, dan disertai bukti pendaftaran merek tersebut di beberapa negara. Dampak dari putusan Mahkamah Agung Nomor 162 K/Pdt.Sus-HKI/2014 bagi pemilik merek yang telah terdaftar dan terkenal agar selalu melindungi mereknya yaitu dengan memperhatikan adanya itikad tidak baik dari pemilik merek lain. Apabila terdapat merek lain yang telah terdaftar di Dirjen HKI dan diumumkan dalam Berita Umum Merek, maka pemilik merek yang telah

  5. X-ray diffraction studies of 145MeV proton-irradiated AlBeMet 162

    Directory of Open Access Journals (Sweden)

    Mohamed Elbakhshwan

    2016-08-01

    Full Text Available AlBeMet 162 (Materion Co., formerly Brush Wellman has been irradiated with 145MeV protons up to 1.2×1020cm−2 fluence, with irradiation temperatures in the range of 100–220°C. Macroscopic post-irradiation evaluation on the evolution of mechanical and thermal properties was integrated with a comprehensive X-ray- diffraction study using high-energy monochromatic and polychromatic X-ray beams, which offered a microscopic view of the irradiation damage effects on AlBeMet. The study confirmed the stability of the metal–matrix composite, its resistance to proton damage, and the continuing separation of the two distinct phases, fcc aluminum and hcp beryllium, following irradiation. Furthermore, based on the absence of inter-planar distance change during proton irradiation, it was confirmed that the stacking faults and clusters on the Al (111 planes are stable, and thus can migrate from the cascade region and be absorbed at various sinks. XRD analysis of the unirradiated AlBeMet 162 showed clear change in the texture of the fcc phase with orientation especially in the Al (111 reflection which exhibits a “non-perfect” six-fold symmetry, implying lack of isotropy in the composite.

  6. 26 CFR 1.162-10T - Questions and answers relating to the deduction of employee benefits under the Tax Reform Act of...

    Science.gov (United States)

    2010-04-01

    ... of employee benefits under the Tax Reform Act of 1984; certain limits on amounts deductible... and Corporations § 1.162-10T Questions and answers relating to the deduction of employee benefits... amendment of section 404(b) by the Tax Reform Act of 1984 affect the deduction of employee benefits under...

  7. Ambtscriminaliteit aangegeven? : Een onderzoek naar het opvolgen van en kennis over de wettelijke verplichting tot aangifte van artikel 162 Sv misdrijven

    NARCIS (Netherlands)

    Vries Robbé, E. de; Cornelissens, A.; Ferwerda, H.

    2008-01-01

    Dit is een onderzoek naar de werking van de aangifteplicht bij ambtscriminaliteit (art 162 Sv). Het gaat dan bijvoorbeeld om het aannemen van steekpenningen en misdrijven waarbij ambtenaren een bijzondere ambtsplicht schenden. De aangifteplicht raakt de klokkenluidersregeling en maakt onderdeel uit

  8. 19 CFR 162.23 - Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)).

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure under section 596(c), Tariff Act of 1930... SEIZURE Seizures § 162.23 Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)). (a) Mandatory seizures. The following, if introduced or attempted to be introduced into the United...

  9. Relationships between the functional PPARalpha Leu162Val polymorphism and obesity, type 2 diabetes, dyslipidaemia, and related quantitative traits in studies of 5799 middle-aged white people

    DEFF Research Database (Denmark)

    Sparsø, Thomas; Hussain, Meena S; Andersen, Gitte

    2007-01-01

    Peroxisome proliferator-activated receptor-alpha (PPARalpha) is a nuclear receptor capable of regulating the expression of genes involved in peroxisomal and mitochondrial beta-oxidation pathways. The common Leu162Val polymorphism in the gene encoding PPARalpha has inconsistently shown association...

  10. 24 CFR 1000.162 - How will a recipient know that non-dwelling structures assisted under the IHBG program meet the...

    Science.gov (United States)

    2010-04-01

    ...-dwelling structures assisted under the IHBG program meet the requirements of 1000.160? 1000.162 Section... that non-dwelling structures assisted under the IHBG program meet the requirements of 1000.160? (a) The... non-dwelling structure meets the limitation requirements of § 1000.160. If the recipient develops...

  11. Ameliorating effect of TI-1-162, a hydroxyindenone derivative, against TNBS-induced rat colitis is mediated through suppression of RIP/ASK-1/MAPK signaling.

    Science.gov (United States)

    Gurung, Pallavi; Banskota, Suhrid; Katila, Nikita; Gautam, Jaya; Kadayat, Tara Man; Choi, Dong-Young; Lee, Eung Seok; Jeong, Tae Cheon; Kim, Jung-Ae

    2018-05-15

    The pathogenesis of inflammatory bowel disease (IBD) is associated with production of immense pro-inflammatory cytokines including TNF-α. Once generated, TNF-α stimulates production of various pro-inflammatory cytokines and disrupts mucosal barrier by inducing inflamed mucosal epithelial cell death. In the present study, we investigated inhibitory effects of TI-1-162, a hydroxyindenone derivative, against TNF-α-induced and TNBS-induced colon inflammation. TI-1-162 showed inhibitory effect on the TNF-α-induced adhesion of U937 monocytic cells to HT-29 colonic epithelial cells (IC 50 = 0.83 ± 0.12 μM), which is an in vitro model representing the initial step of colitis. In addition, TI-1-162 suppressed TNF-α-stimulated caspase-3 activation and HT-29 cell apoptosis. These in vitro inhibitory activities of TI-1-162 correlated to recovery changes in in vivo colon tissues, such as downregulation of adhesion molecules (ICAM-1, VCAM-1) and chemokines (CCL11, CXCL1, CXCL2, CXCL3, CX3CL1) revealed by gene expression array and Western blot analyses. Such molecular recovery of colon epithelium from TNBS-treated rats corresponded to the recovery in body weight, colon weight/length, and myeloperoxidase level by TI-1-162 (10 and 30 mg/kg/day, orally). In relation to action mechanism, TI-1-162 did not disturb TNF-α binding to its receptor, but suppressed phosphorylation of RIP-1, ASK-1, JNK and p38, and nuclear translocation of NF-kB and AP-1, which corresponded to down regulation of inflammatory cytokines in TNF-α-treated cells (HT-29 and U937) and TNBS-treated rat colon tissues. Taken together, the results indicate that the protective effects of TI-1-162 against colon inflammation and epithelial cell death are associated with its inhibitory action in RIP/ASK-1/MAPK signaling pathway downstream to TNF receptor 1. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. Calculated single-proton levels for nuclei with N equal to 152, 154, 156, 158, 160 and 162

    International Nuclear Information System (INIS)

    Moeller, P.; Nix, J.R.; Swiatecki, W.

    1986-09-01

    The decay properties of nuclei in many cases depend strongly on the quantum numbers of the single-particle levels in the vicinity of the Fermi surface. A striking illustration is the prolonged fission half-lives of odd nuclei relative to their even neighbors. The hindrance factor depends on the spin of unpaired odd particle and increases with increasing spin of the odd particle. The effect has been studied theoretically. For 257 Fm the hindrance factor is almost ten orders of magnitude. The computer code for calculating nuclear masses calculates single-particle levels at the deformations considered as one step in the calculations. We have run this code at the ground state deformation of all nuclei considered in the 1981 mass study and stored the calculated single-particle levels on permanent mass storage. A computer code has been constructed for extracting levels of nuclei that are specified to the program and plotting them. In this report we consider single-proton levels for even-N nuclei in the range 152 ≤ N ≤ 162. Six such plots are included in this report. The levels are plotted relative to the Fermi surface of each nucleus. We also include tables of the plotted single-particle levels since it is not always possible to determine the spin from an inspection of the plots, when levels are overlapping. 6 figs

  13. The pathologic effect of a novel neomorphic Fgf9(Y162C allele is restricted to decreased vision and retarded lens growth.

    Directory of Open Access Journals (Sweden)

    Oliver Puk

    Full Text Available Fibroblast growth factor (Fgf signalling plays a crucial role in many developmental processes. Among the Fgf pathway ligands, Fgf9 (UniProt: P54130 has been demonstrated to participate in maturation of various organs and tissues including skeleton, testes, lung, heart, and eye. Here we establish a novel Fgf9 allele, discovered in a dominant N-ethyl-N-nitrosourea (ENU screen for eye-size abnormalities using the optical low coherence interferometry technique. The underlying mouse mutant line Aca12 was originally identified because of its significantly reduced lens thickness. Linkage studies located Aca12 to chromosome 14 within a 3.6 Mb spanning interval containing the positional candidate genes Fgf9 (MGI: 104723, Gja3 (MGI: 95714, and Ift88 (MGI: 98715. While no sequence differences were found in Gja3 and Ift88, we identified an A→G missense mutation at cDNA position 770 of the Fgf9 gene leading to an Y162C amino acid exchange. In contrast to previously described Fgf9 mutants, Fgf9(Y162C carriers were fully viable and did not reveal reduced body-size, male-to-female sexual reversal or skeletal malformations. The histological analysis of the retina as well as its basic functional characterization by electroretinography (ERG did not show any abnormality. However, the analysis of head-tracking response of the Fgf9(Y162C mutants in a virtual drum indicated a gene-dosage dependent vision loss of almost 50%. The smaller lenses in Fgf9(Y162C suggested a role of Fgf9 during lens development. Histological investigations showed that lens growth retardation starts during embryogenesis and continues after birth. Young Fgf9(Y162C lenses remained transparent but developed age-related cataracts. Taken together, Fgf9(Y162C is a novel neomorphic allele that initiates microphakia and reduced vision without effects on organs and tissues outside the eye. Our data point to a role of Fgf9 signalling in primary and secondary lens fiber cell growth. The results

  14. SAJCC 162.indd

    African Journals Online (AJOL)

    ARTICLE. SAJCC August 2014, Vol. 30, No. 1. 5. The needs of patient family members in ..... has been done in all sectors to improve the quality of life after the .... Leske JS. Needs of relatives of critically ill patients: A follow-up. Heart Lung 1986 ...

  15. SAJCC 162.indd

    African Journals Online (AJOL)

    premature infants, children who died within 2 hours of admission, or children transferred .... [7] The mean difference in probability represented the bias in .... in terms of risk-adjusted mortality rates. ... The age and diagnostic category distribution.

  16. X-ray diffraction studies on merohedrally twinned Δ1-62NtNBCe1-A crystals of the sodium/bicarbonate cotransporter.

    Science.gov (United States)

    Gill, Harindarpal S; Dutcher, Lauren; Boron, Walter F; Patel, Samir; Guay-Woodford, Lisa M

    2013-07-01

    NBCe1-A membrane-embedded macromolecules that cotransport sodium and bicarbonate ions across the bilayer serve to maintain acid-base homeostasis throughout the body. Defects result in a number of renal and eye disorders, including type-II renal tubular acidosis and cataracts. Here, crystals of a human truncated mutant of the cytoplasmic N-terminal domain of NBCe1 (Δ1-62NtNBCe1-A) are reported that diffract X-rays to 2.4 Å resolution. The crystal symmetry of Δ1-62NtNBCe1-A is of space group P31 with pseudo-P3121 symmetry and it has a hemihedral twin fraction of 33.0%. The crystals may provide insight into the pathogenic processes observed in a subset of patients with truncating and point mutations in the gene encoding NBCe1.

  17. Evidence for an association between the Leu162Val polymorphism of the PPARalpha gene and decreased fasting serum triglyceride levels in glucose tolerant subjects

    DEFF Research Database (Denmark)

    Nielsen, Eva-Maria D; Hansen, Lars; Echwald, Søren Morgenthaler

    2003-01-01

    The aim of the study was to investigate whether genetic variation in the peroxisome proliferator-activated receptor-alpha (PPARalpha) is associated with type 2 diabetes and altered lipid or carbohydrate metabolism in glucose tolerant subjects. Mutation analyses of PPARalpha were performed in 56...... type 2 diabetic patients. Six variants were identified: IVS3 + 76T>C, IVS3-19C>T, IVS4 + 35C>T, Leu162Val, Arg178Gly and Ala268Val. In a case-control study comprising 738 type 2 diabetic patients and 524 glucose tolerant subjects, the three exon variants did not show any significant differences...... in allele frequencies between type 2 diabetic patients and control subjects. The functional Leu162Val polymorphism was further investigated in genotype-phenotype studies involving 340 young, healthy subjects and 502 middle-aged glucose tolerant subjects. The young, healthy subjects who were heterozygous...

  18. A Microbiomic Analysis in African Americans with Colonic Lesions Reveals Streptococcus sp.VT162 as a Marker of Neoplastic Transformation

    Directory of Open Access Journals (Sweden)

    Hassan Brim

    2017-11-01

    Full Text Available Increasing evidence suggests a role of the gut microbiota in colorectal carcinogenesis (CRC. To detect bacterial markers of colorectal cancer in African Americans a metabolomic analysis was performed on fecal water extracts. DNA from stool samples of adenoma and healthy subjects and from colon cancer and matched normal tissues was analyzed to determine the microbiota composition (using 16S rDNA and genomic content (metagenomics. Metagenomic functions with discriminative power between healthy and neoplastic specimens were established. Quantitative Polymerase Chain Reaction (q-PCR using primers and probes specific to Streptococcus sp. VT_162 were used to validate this bacterium association with neoplastic transformation in stool samples from two independent cohorts of African Americans and Chinese patients with colorectal lesions. The metabolomic analysis of adenomas revealed low amino acids content. The microbiota in both cancer vs. normal tissues and adenoma vs. normal stool samples were different at the 16S rRNA gene level. Cross-mapping of metagenomic data led to 9 markers with significant discriminative power between normal and diseased specimens. These markers identified with Streptococcus sp. VT_162. Q-PCR data showed a statistically significant presence of this bacterium in advanced adenoma and cancer samples in an independent cohort of CRC patients. We defined metagenomic functions from Streptococcus sp. VT_162 with discriminative power among cancers vs. matched normal and adenomas vs. healthy subjects’ stools. Streptococcus sp. VT_162 specific 16S rDNA was validated in an independent cohort. These findings might facilitate non-invasive screening for colorectal cancer.

  19. Disturbances of ligand potency and enhanced degradation of the human glycine receptor at affected positions G160 and T162 originally identified in patients suffering from hyperekplexia

    Directory of Open Access Journals (Sweden)

    Sinem eAtak

    2015-12-01

    Full Text Available Ligand-binding of Cys-loop receptors is determined by N-terminal extracellular loop structures from the plus as well as from the minus side of two adjacent subunits in the pentameric receptor complex. An aromatic residue in loop B of the glycine receptor (GlyR undergoes direct interaction with the incoming ligand via cation-π interactions. Recently we showed that mutated residues in loop B identified from human patients suffering from hyperekplexia disturb ligand-binding. Here, we exchanged the affected human residues by amino acids found in related members of the Cys-loop receptor family to determine the effects of side chain volume for ion channel properties. GlyR variants were characterized in vitro following transfection into cell lines in order to analyze protein expression, trafficking, degradation and ion channel function. GlyR α1 G160 mutations significantly decrease glycine potency arguing for a positional effect on neighboring aromatic residues and consequently glycine-binding within the ligand-binding pocket. Disturbed glycinergic inhibition due to T162 α1 mutations is an additive effect of affected biogenesis and structural changes within the ligand-binding site. Protein trafficking from the ER towards ER-Golgi intermediate compartment, the secretory Golgi pathways and finally the cell surface is largely diminished, but still sufficient to deliver ion channels that are functional at least at high glycine concentrations. The majority of T162 mutant protein accumulates in the ER and is conducted to ER-associated proteasomal degradation. Hence, G160 is an important determinant during glycine binding. In contrast, T162 assigns primarily receptor biogenesis whereas exchanges in functionality are secondary effects thereof.

  20. High prevalence of Arginine to Glutamine Substitution at 98, 141 and 162 positions in Troponin I (TNNI3 associated with hypertrophic cardiomyopathy among Indians

    Directory of Open Access Journals (Sweden)

    Rani Deepa

    2012-08-01

    Full Text Available Abstract Background Troponin I (TNNI3 is the inhibitory subunit of the thin filament regulatory complex Troponin, which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Mutations (2-7% in this gene had been reported in hypertrophic cardiomyopathy patients (HCM. However, the frequencies of mutations and associated clinical presentation have not been established in cardiomyopathy patients of Indian origin, hence we have undertaken this study. Methods We have sequenced all the exons, including the exon-intron boundaries of TNNI3 gene in 101 hypertrophic cardiomyopathy patients (HCM, along with 160 healthy controls, inhabited in the same geographical region of southern India. Results Our study revealed a total of 16 mutations. Interestingly, we have observed Arginine to Glutamine (R to Q mutation at 3 positions 98, 141 and 162, exclusively in HCM patients with family history of sudden cardiac death. The novel R98Q was observed in a severe hypertrophic obstructive cardiomyopathy patient (HOCM. The R141Q mutation was observed in two familial cases of severe asymmetric septal hypertrophy (ASH++. The R162Q mutation was observed in a ASH++ patient with mean septal thickness of 29 mm, and have also consists of allelic heterogeneity by means of having one more synonymous (E179E mutation at g.4797: G → A: in the same exon 7, which replaces a very frequent codon (GAG: 85% with a rare codon (GAA: 14%. Screening for R162Q mutation in all the available family members revealed its presence in 9 individuals, including 7 with allelic heterogeneity (R162Q and E179E of which 4 were severely affected. We also found 2 novel SNPs, (g.2653; G → A and g.4003 C → T exclusively in HCM, and in silico analysis of these SNPs have predicted to cause defect in recognition/binding sites for proteins responsible for proper splicing. Conclusion Our study has provided valuable information regarding the prevalence of TNNI3 mutations in

  1. [Interest of lactate micro-dosage in scalp and umbilical cord in cases of abnormal fetal heart rate during labor. Prospective study on 162 patients].

    Science.gov (United States)

    Paris, A; Maurice-Tison, S; Coatleven, F; Vandenbossche, F; Dallay, D; Horovitz, J

    2012-06-01

    To compare the interest of lactate microanalysis with pH measurement (Gold Standard procedure) in cord blood and fetal scalp blood samples for the assessment of abnormal fetal heart rate (FHR) during labour. A prospective observational study conducted from July 1st 2007 till March 31st 2008 on 162 patients with abnormal FHR during labour. Sampling failure for scalp lactate was less than 1 % compared to a failure of 10.5 % for scalp pH (Pinterest. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  2. Phenomenological descriptions of the Yrast bands in sup(160,162,164,166)Yb nuclei band crossings and moments of inertia

    International Nuclear Information System (INIS)

    El Zaiki, M.I.; Nafie, H.O.; Abd El Mageed, K.E.

    1992-01-01

    Two methods of calculations have been used to fit the previously presented data on rotationally aligned quasiparticle bands in sup(160,162,164,166)Yb. Backbendings of moment of inertia of the Yrast states can be reproduced reasonably well. The energy levels and the effective moment of inertia for both gs and s-band are calculated and compared with the experimental data. Band crossing interpretations are discussed for each nucleus. The interaction strength calculations are presented. (author). 17 refs., 7 figs., 4 tabs

  3. Construction and immunogenicity of replication-competent adenovirus 5 host range mutant recombinants expressing HIV-1 gp160 of SF162 and TV1 strains.

    Science.gov (United States)

    Hidajat, Rachmat; Kuate, Seraphin; Venzon, David; Kalyanaraman, Vaniambadi; Kalisz, Irene; Treece, James; Lian, Ying; Barnett, Susan W; Robert-Guroff, Marjorie

    2010-05-21

    An HIV Env immunogen capable of eliciting broad immunity is critical for a successful vaccine. We constructed and characterized adenovirus 5 host range mutant (Ad5hr) recombinants encoding HIV(SF162) gp160 (subtype B) and HIV(TV1) gp160 (subtype C). Immunization of mice with one or both induced cellular immunity to subtype B and C peptides by ELISpot, and antibody responses with high binding titers to HIV Env of subtypes A, B, C, and E. Notably, Ad5hr-HIV(TV1) gp160 induced better cellular immunity than Ad5hr-HIV(SF162) gp160, either alone or following co-administration. Thus, the TV1 Env recombinant alone may be sufficient for eliciting immune responses against both subtype B and C envelopes. Further studies of Ad5hr-HIV(TV1) gp160 in rhesus macaques will evaluate the suitability of this insert for a future phase I clinical trial using a replication-competent Ad4 vector. Published by Elsevier Ltd.

  4. A TALE OF DWARFS AND GIANTS: USING A z = 1.62 CLUSTER TO UNDERSTAND HOW THE RED SEQUENCE GREW OVER THE LAST 9.5 BILLION YEARS

    International Nuclear Information System (INIS)

    Rudnick, Gregory H.; Tran, Kim-Vy; Papovich, Casey; Momcheva, Ivelina; Willmer, Christopher

    2012-01-01

    We study the red sequence in a cluster of galaxies at z = 1.62 and follow its evolution over the intervening 9.5 Gyr to the present day. Using deep YJK s imaging with the HAWK-I instrument on the Very Large Telescope, we identify a tight red sequence and construct its rest-frame i-band luminosity function (LF). There is a marked deficit of faint red galaxies in the cluster that causes a turnover in the LF. We compare the red-sequence LF to that for clusters at z 0.6. In this model the cluster accretes blue galaxies from the field whose star formation is quenched and who are subsequently allowed to merge. We find that three to four mergers among cluster galaxies during the 4 Gyr between z = 1.62 and z = 0.6 match the observed LF evolution between the two redshifts. The inferred merger rate is consistent with other studies of this cluster. Our result supports the picture that galaxy merging during the major growth phase of massive clusters is an important process in shaping the red-sequence population at all luminosities.

  5. The mechanical design and fabrication of 162.5 MHz buncher for China accelerator driven sub-critical system injector II

    Energy Technology Data Exchange (ETDEWEB)

    Niu, Hai Hua; Li, Youtang [Lanzhou University of Technology, Lanzhou (China); He, Yuan; Zhang, Bin; Huang, Shichun; Yuan, Chenzhang; Jia, Huan; Zhang, Shenghu [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou (China)

    2017-08-15

    A buncher is one of the main pieces of equipment in the medium energy beam transport line (MEBT) for China accelerator driven sub-critical system (C-ADS) Injector II. To focus the beam longitudinally and match the beam for the acceptance of the superconducting linac section, two room temperature quarter wave resonator (QWR) bunchers with frequency of 162.5 MHz have been designed as parts of the MEBT. According to the beam transmission matching of the MEBT and the geometric parameters requirements of bunchers, the unique mechanical structure and the main processing technology of buncher cavities and their couplers and tuners are described in this paper. The fabrication of bunchers and their parts have been completed and tested at high power, the test results agree well with the design requirements. These bunchers work well for about two years in Institute of Modern Physics, Chinese Academy of Sciences.

  6. The mechanical design and fabrication of 162.5 MHz buncher for China accelerator driven sub-critical system injector II

    Directory of Open Access Journals (Sweden)

    Haihua Niu

    2017-08-01

    Full Text Available A buncher is one of the main pieces of equipment in the medium energy beam transport line (MEBT for China accelerator driven sub-critical system (C-ADS Injector II. To focus the beam longitudinally and match the beam for the acceptance of the superconducting linac section, two room temperature quarter wave resonator (QWR bunchers with frequency of 162.5 MHz have been designed as parts of the MEBT. According to the beam transmission matching of the MEBT and the geometric parameters requirements of bunchers, the unique mechanical structure and the main processing technology of buncher cavities and their couplers and tuners are described in this paper. The fabrication of bunchers and their parts have been completed and tested at high power, the test results agree well with the design requirements. These bunchers work well for about two years in Institute of Modern Physics, Chinese Academy of Sciences.

  7. MiniCD4 microbicide prevents HIV infection of human mucosal explants and vaginal transmission of SHIV(162P3 in cynomolgus macaques.

    Directory of Open Access Journals (Sweden)

    Nathalie Dereuddre-Bosquet

    Full Text Available In complement to an effective vaccine, development of potent anti-HIV microbicides remains an important priority. We have previously shown that the miniCD4 M48U1, a functional mimetic of sCD4 presented on a 27 amino-acid stable scaffold, inhibits a broad range of HIV-1 isolates at sub-nanomolar concentrations in cellular models. Here, we report that M48U1 inhibits efficiently HIV-1(Ba-L in human mucosal explants of cervical and colorectal tissues. In vivo efficacy of M48U1 was evaluated in nonhuman primate (NHP model of mucosal challenge with SHIV(162P3 after assessing pharmacokinetics and pharmacodynamics of a miniCD4 gel formulation in sexually matured female cynomolgus macaques. Among 12 females, half were treated with hydroxyethylcellulose-based gel (control, the other half received the same gel containing 3 mg/g of M48U1, one hour before vaginal route challenge with 10 AID(50 of SHIV(162P3. All control animals were infected with a peak plasma viral load of 10(5-10(6 viral RNA (vRNA copies per mL. In animals treated with miniCD4, 5 out of 6 were fully protected from acquisition of infection, as assessed by qRT-PCR for vRNA detection in plasma, qPCR for viral DNA detection in PBMC and lymph node cells. The only infected animal in this group had a delayed peak of viremia of one week. These results demonstrate that M48U1 miniCD4 acts in vivo as a potent entry inhibitor, which may be considered in microbicide developments.

  8. HSV-2-Driven Increase in the Expression of α4β7 Correlates with Increased Susceptibility to Vaginal SHIVSF162P3 Infection

    Science.gov (United States)

    Goode, Diana; Truong, Rosaline; Villegas, Guillermo; Calenda, Giulia; Guerra-Perez, Natalia; Piatak, Michael; Lifson, Jeffrey D.; Blanchard, James; Gettie, Agegnehu; Robbiani, Melissa; Martinelli, Elena

    2014-01-01

    The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM) model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7 high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7 high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7 high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission. PMID:25521298

  9. HSV-2-driven increase in the expression of α4β7 correlates with increased susceptibility to vaginal SHIV(SF162P3) infection.

    Science.gov (United States)

    Goode, Diana; Truong, Rosaline; Villegas, Guillermo; Calenda, Giulia; Guerra-Perez, Natalia; Piatak, Michael; Lifson, Jeffrey D; Blanchard, James; Gettie, Agegnehu; Robbiani, Melissa; Martinelli, Elena

    2014-12-01

    The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM) model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission.

  10. HSV-2-driven increase in the expression of α4β7 correlates with increased susceptibility to vaginal SHIV(SF162P3 infection.

    Directory of Open Access Journals (Sweden)

    Diana Goode

    2014-12-01

    Full Text Available The availability of highly susceptible HIV target cells that can rapidly reach the mucosal lymphoid tissues may increase the chances of an otherwise rare transmission event to occur. Expression of α4β7 is required for trafficking of immune cells to gut inductive sites where HIV can expand and it is expressed at high level on cells particularly susceptible to HIV infection. We hypothesized that HSV-2 modulates the expression of α4β7 and other homing receptors in the vaginal tissue and that this correlates with the increased risk of HIV acquisition in HSV-2 positive individuals. To test this hypothesis we used an in vivo rhesus macaque (RM model of HSV-2 vaginal infection and a new ex vivo model of macaque vaginal explants. In vivo we found that HSV-2 latently infected RMs appeared to be more susceptible to vaginal SHIVSF162P3 infection, had higher frequency of α4β7high CD4+ T cells in the vaginal tissue and higher expression of α4β7 and CD11c on vaginal DCs. Similarly, ex vivo HSV-2 infection increased the susceptibility of the vaginal tissue to SHIVSF162P3. HSV-2 infection increased the frequencies of α4β7high CD4+ T cells and this directly correlated with HSV-2 replication. A higher amount of inflammatory cytokines in vaginal fluids of the HSV-2 infected animals was similar to those found in the supernatants of the infected explants. Remarkably, the HSV-2-driven increase in the frequency of α4β7high CD4+ T cells directly correlated with SHIV replication in the HSV-2 infected tissues. Our results suggest that the HSV-2-driven increase in availability of CD4+ T cells and DCs that express high levels of α4β7 is associated with the increase in susceptibility to SHIV due to HSV-2. This may persists in absence of HSV-2 shedding. Hence, higher availability of α4β7 positive HIV target cells in the vaginal tissue may constitute a risk factor for HIV transmission.

  11. Silicon Nitride Deposition for Flexible Organic Electronic Devices by VHF (162 MHz)-PECVD Using a Multi-Tile Push-Pull Plasma Source.

    Science.gov (United States)

    Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young

    2017-10-19

    Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4  g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.

  12. Socio-economic development and emotion-health connection revisited: a multilevel modeling analysis using data from 162 counties in China.

    Science.gov (United States)

    Yu, Zonghuo; Wang, Fei

    2016-03-12

    Substantial research has shown that emotions play a critical role in physical health. However, most of these studies were conducted in industrialized countries, and it is still an open question whether the emotion-health connection is a "first-world problem". In the current study, we examined socio-economic development's influence on emotion-health connection by performing multilevel-modeling analysis in a dataset of 33,600 individuals from 162 counties in China. Results showed that both positive emotions and negative emotions predicted level of physical health and regional Gross Domestic Product Per Capita (GDPPC) had some impact on the association between emotion and health through accessibility of medical resources and educational status. But these impacts were suppressed, and the total effects of GDPPC on emotion-health connections were not significant. These results support the universality of emotion-health connection across levels of GDPPC and provide new insight into how socio-economic development might affect these connections.

  13. New candidates for active asteroids: Main-belt (145) Adeona, (704) Interamnia, (779) Nina, (1474) Beira, and near-Earth (162,173) Ryugu

    Science.gov (United States)

    Busarev, Vladimir V.; Makalkin, Andrei B.; Vilas, Faith; Barabanov, Sergey I.; Scherbina, Marina P.

    2018-04-01

    For the first time, spectral signs of subtle coma activity were observed for four main-belt primitive asteroids (145) Adeona, (704) Interamnia, (779) Nina, and (1474) Beira around their perihelion distances in September 2012, which were interpreted as manifestations of the sublimation of H2O ice in/under the surface matter (Busarev et al., 2015a, 2015b). We confirm the phenomenon for Nina when it approached perihelion in September 2016. At the same time, based on results of spectral observations of near-Earth asteroid (162,173) Ryugu (Vilas, 2008) being a target of Japan's Hayabusa 2 space mission, we suspected a periodic similar transient activity on the Cg-type asteroid. However, unlike the main-belt primitive asteroids demonstrating sublimation of ices close to their perihelion distances, the effect on Ryugu was apparently registered near aphelion. To explain the difference, we calculated the subsolar temperature depending on heliocentric distance of the asteroids, considered qualitative models of internal structure of main-belt and near-Earth primitive asteroids including ice and performed some analytical estimations. Presumed temporal sublimation/degassing activity of Ryugu is a sign of a residual frozen core in its interior. This could be an indication of a relatively recent transition of the asteroid from the main asteroid belt to the near-Earth area.

  14. Guideline for determining the mean glandular dose according to DIN 6868-162 and threshold contrast visibility according to the quality assurance guideline for digital mammography systems.

    Science.gov (United States)

    Sommer, A; Schopphoven, S; Land, I; Blaser, D; Sobczak, T

    2014-05-01

    As part of the physico-technical quality assurance of the German breast cancer screening program, the threshold contrast visibility and the average glandular dose of every digital mammography system have to fulfill the requirements of the "European guidelines for quality assurance in breast cancer screening and diagnosis" (4th Edition). To accomplish uniform measurements in all federal states of Germany, the physical board of the reference centers developed a special guideline in 2009. Due to recent changes in the guidelines and standards, a second version of the guideline was developed by the reference centers. This guideline describes the determination of the average glandular dose as well as the CDMAM image acquisition and the CDMAM image evaluation. The determination of the threshold contrast visibility can be performed visually or automatically. The determination of the average glandular dose is based on DIN 6868 - 162 and the threshold contrast visibility test is based on the German "Quality Assurance Guideline". © Georg Thieme Verlag KG Stuttgart · New York.

  15. 159 - 162_Kogo_Aniline

    African Journals Online (AJOL)

    pc

    mechanical properties of doped polyester fabric with aniline w s of various ... tion of the PANI solution rly constant up to ... computer interface and printer according to the AS. Figure 2: .... Material Systems and Structures, 23(17), pp. 1969-1986.

  16. Determination of the cross section for (n,p) reaction with producing short-lived nuclei on the 162,163Dy isotopes at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; Feng, Zhifu; An, Li; Jiang, Li; He, Long

    2016-01-01

    Activation cross-sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb reactions have been measured by means of the activation technique and a coaxial HPGe γ-ray detector at 13.5 and 14.8 MeV. The fast neutrons were produced via the 3 H(d,n) 4 He reaction on Pd-300 neutron generator. The natural high-purity Dy 2 O 3 powder was used as target material. Theoretical excitation functions were calculated using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were also discussed and compared with some corresponding values found in the literature, with the comprehensive evaluation data in ENDF/B-VII.1 and JENDF-4.0 libraries, and with the estimates obtained from a published empirical formula based on the statistical model with Q-value dependence and odd–even effects taken into consideration. - Highlights: • The cross sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb have been measured. • 93 Nb(n,2n) 92m Nb was used as a monitor for neutron fluence. • Codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • The results were compared with previous data. • Inconsistency with previous data and with model calculations are noted.

  17. Study of elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV. [Total and differential cross sections, scattering yields, scattering amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Devereux, M.J.

    1979-05-01

    Elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references.

  18. Songs for funerals and intercession. A collection of polyphony for the confraternity of St Barbara at the Corbie Abbey, Amiens, Bibliothèque Centrale Louis Aragon, MS 162 D. Edited by Peter Woetmann Christoffersen. Volume 1

    DEFF Research Database (Denmark)

    Christoffersen, Peter Woetmann

    2015-01-01

    MS Amiens 162 was made in Paris in 1502 in cooperation between a professional music copyist and the young monk Antoine de Caulaincourt. The MS contained simple polyphony for funerals and commemorative services, and it was to be used in a confraternity, Confrérie Ste Barbe, at the big Benedictine...... the ideas of a new age, fought with arguments as well as violence. A bold move to bolster its position was the demolition of the abbey’s old main church and starting the building of a vast new one in 1502. The founding of the confraternity and the ordering of the music manuscript in Paris were probably...... deliverate moves to ensure local support for the building project. The MS offers music whose sound may compare with contemporary art music in fullness and solemnity, but monks who were neither able to read modern mensural notation nor improvise simple polyphony could perform it. Their competence in singing...

  19. Human small cell lung cancer NYH cells selected for resistance to the bisdioxopiperazine topoisomerase II catalytic inhibitor ICRF-187 demonstrate a functional R162Q mutation in the Walker A consensus ATP binding domain of the alpha isoform

    DEFF Research Database (Denmark)

    Wessel, I; Jensen, L H; Jensen, P B

    1999-01-01

    in expression of the beta isoform. Sequencing of the entire topoisomerase IIalpha cDNA from NYH/187 cells demonstrated a homozygous G-->A point mutation at nucleotide 485, leading to a R162Q conversion in the Walker A consensus ATP binding site (residues 161-165 in the alpha isoform), this being the first drug......-selected mutation described at this site. Western blotting after incubation with ICRF-187 showed no depletion of the alpha isoform in NYH/187 cells in contrast to wild-type (wt) cells, whereas equal depletion of the beta isoform was observed in the two sublines. Alkaline elution assay demonstrated a lack...... of inhibition of etoposide-induced DNA single-stranded breaks in NYH/187 cells, whereas this inhibition was readily apparent in NYH cells. Site-directed mutagenesis in human topoisomerase IIalpha introduced into a yeast Saccharomyces cerevisiae strain with a temperature-conditional yeast TOP2 mutant...

  20. Public inquiry related to the request by EDF of a definitive stopping and complete dismantling of the hardware storage installation of the Monts d'Arree nuclear power plant (INB n.162). Opinion and conclusions of the inquiry commission

    International Nuclear Information System (INIS)

    2010-03-01

    After a recall of the project of stopping and dismantling of the hardware storage installation (INB n.162) which had been created after the stopping and dismantling of the Monts d'Arree heavy water nuclear reactor (INB n.28), this report analyzes the results of the public inquiry, and highlights the arguments of those in favour of this project and those opposed to it. Then, it states the Inquiry Commission's opinion which addresses the request for a national public debate, the project justification, the inquiry file, the site radiological status, the site radiological control during works, the impacts of dismantling, the various risks (for the population and the workers, in terms of fire risks), the issue of radioactive wastes, economic aspects (costs, jobs, local economy, tourism and site image), and site reconversion

  1. Different Phenotypes of the Two Chinese Probands with the Same c.889G>A (p.C162Y Mutation in COCH Gene Verify Different Mechanisms Underlying Autosomal Dominant Nonsyndromic Deafness 9.

    Directory of Open Access Journals (Sweden)

    Qi Wang

    Full Text Available By analyzing the different phenotypes of two Chinese DFNA9 families with the same mutation located in the intervening region between the LCCL and vWFA domains of cochlin and testing the functional changes in the mutant cochlin, we investigated the different pathogeneses for mutations in LCCL and vWFA domains.Targeted next-generation sequencing for deafness-related genes was used to identify the mutation in the proband in family #208. The probands of family #208 and family #32 with the same p.C162Y mutation were followed for more than 3 years to evaluate the progression of hearing loss and vestibular dysfunction using pure-tone audiometry, caloric testing, electrocochleogram, vestibular-evoked myogenic potential, and video head-impulse test. The disruption of normal cleavage to produce secreted LCCL domain fragments and the tendency to form aggregations of mutant cochlins were tested by in vitro cell experiments.The two families showed different clinical symptoms. Family #32 was identified as having early-onset, progressive sensorineural hearing loss, similar to the symptoms in DFNA9 patients with cochlin mutations in the vWFA domain. The proband of family #208 endured late-onset recurrent paroxysmal vertigo attacks and progressively deteriorating hearing, similar to symptoms in those with cochlin mutations in the LCCL domain. We therefore suggest that the disrupted cleavage of the LCCL domain fragment is likely to cause vestibular dysfunction, and aggregation of mutant cochlin caused by mutations in the vWFA domain is responsible for early-onset hearing loss. The p.C162Y mutation causes either disruption of LCCL domain fragment cleavage or aggregation of mutant cochlin, resulting in the different phenotypes in the two families.This study demonstrates that DFNA9 families with the same genotype may have significantly different phenotypes. The mutation site in cochlin is related to the pathological mechanism underlying the different phenotypes.

  2. A Small Molecule, Which Competes with MAdCAM-1, Activates Integrin α4β7 and Fails to Prevent Mucosal Transmission of SHIV-SF162P3.

    Directory of Open Access Journals (Sweden)

    Géraldine Arrode-Brusés

    2016-06-01

    Full Text Available Mucosal HIV-1 transmission is inefficient. However, certain viral and host characteristics may play a role in facilitating HIV acquisition and systemic expansion. Cells expressing high levels of integrin α4β7 have been implicated in favoring the transmission process and the infusion of an anti-α4β7 mAb (RM-Act-1 prior to, and during a repeated low-dose vaginal challenge (RLDC regimen with SIVmac251 reduced SIV acquisition and protected the gut-associated lymphoid tissues (GALT in the macaques that acquired SIV. α4β7 expression is required for lymphocyte trafficking to the gut lamina propria and gut inductive sites. Several therapeutic strategies that target α4β7 have been shown to be effective in treating inflammatory conditions of the intestine, such as inflammatory bowel disease (IBD. To determine if blocking α4β7 with ELN, an orally available anti-α4 small molecule, would inhibit SHIV-SF162P3 acquisition, we tested its ability to block MAdCAM-1 (α4β7 natural ligand and HIV-gp120 binding in vitro. We studied the pharmacokinetic profile of ELN after oral and vaginal delivery in macaques. Twenty-six macaques were divided into 3 groups: 9 animals were treated with ELN orally, 9 orally and vaginally and 8 were used as controls. All animals were challenged intra-vaginally with SHIV-SF162P3 using the RLDC regimen. We found that ELN did not protect macaques from SHIV acquisition although it reduced the SHIV-induced inflammatory status during the acute phase of infection. Notably, integrins can exist in different activation states and, comparing the effect of ELN and the anti-α4β7 mAb RM-Act-1 that reduced susceptibility to SIV infection, we determined that ELN induces the active conformation of α4β7, while RM-Act-1 inhibits its activation through an allosteric mechanism. These results suggest that inhibition of α4β7 activation may be necessary to reduce susceptibility to SIV/SHIV infection and highlight the complexity of anti

  3. 15 CFR 922.162 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... waters of the Atlantic Ocean, Caribbean, or Gulf of Mexico without passive or active introduction to such... animal and plant life other than marine mammals and birds. Fishing means: (1) The catching, taking, or...

  4. 46 CFR 162.028-3 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... cutting, forming, and bending operations are completed, are considered to provide suitable corrosion... points of contact or close proximity of dissimilar metals; (iv) The extinguisher and its bracket, if any... examined and tested to establish its reliability and effectiveness in accordance with the intent of this...

  5. 34 CFR 668.162 - Requesting funds.

    Science.gov (United States)

    2010-07-01

    ... Secretary, the Secretary may provide funds to an institution under the advance, reimbursement, just-in-time, or cash monitoring payment methods. (2) Each time an institution requests funds from the Secretary... received those funds. (c) Just-in-time payment method. Under the just-in-time payment method— (1) For each...

  6. 21 CFR 133.162 - Neufchatel cheese.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... which produces a finished cheese having the same physical and chemical properties. The milkfat content... this section is subjected to the action of a harmless lactic acid-producing bacterial culture, with or...

  7. 7 CFR 3550.162 - Recapture.

    Science.gov (United States)

    2010-01-01

    ... appreciation. (2) The value appreciation of property with a cross-collateralized loan is based on the market... are due and payable when the borrower transfers title or ceases to occupy the property. (b) Amount to... family housing property. (3) Interest reduced from the promissory note rate to six percent under the...

  8. 162. Seguimiento de pacientes cardiovasculares por telemedicina

    Directory of Open Access Journals (Sweden)

    I. Díaz de Tuesta Revilla

    2010-01-01

    Conclusiones: Sin costes adicionales para un hospital razonablemente informatizado, la telemedicina ahorra tiempo, mejora el acceso al especialista, adelanta decisiones y evita desplazamientos para trivialidades. Mejora la calidad. Es el futuro en la toma de decisiones.

  9. 46 CFR 162.050-3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... monitoring and control system that is designed to measure the oil content of cargo residues from cargo tanks and oily mixtures combined with these residues. PPM means parts per million by volume of oil in water...

  10. Search Results | Page 162 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Islamist Parties and Democratization : Lessons from Turkey's Justice and Development Party. The Turkish elections of November 2002 brought a new Islamic-oriented political party to power, with almost two-thirds of the seats in Parliament. Project ...

  11. 46 CFR 162.018-3 - Materials.

    Science.gov (United States)

    2010-10-01

    ... best quality spring steel consistent with the design of the valve and the service requirement. [CGFR 52... materials melting above 1700 °F. for liquefied flammable gas service. Consideration of lower melting materials for internal pressure-containing parts will be given if their use provides significant improvement...

  12. 26 CFR 1.162-4 - Repairs.

    Science.gov (United States)

    2010-04-01

    ... the cost of acquisition or production or the gain or loss basis of the taxpayer's plant, equipment, or other property, as the case may be, is not increased by the amount of such expenditures. Repairs in the... incidental repairs which neither materially add to the value of the property nor appreciably prolong its life...

  13. Vegetation - Suisun Marsh 2003 [ds162

    Data.gov (United States)

    California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...

  14. Effectiveness of UV-C light assisted by mild heat on Saccharomyces cerevisiae KE 162 inactivation in carrot-orange juice blend studied by flow cytometry and transmission electron microscopy.

    Science.gov (United States)

    García Carrillo, Mercedes; Ferrario, Mariana; Guerrero, Sandra

    2018-08-01

    The aim of this study was to analyze the effectiveness of UV-C light (0-10.6 kJ/m 2 ) assisted by mild heat treatment (50 °C) on the inactivation of Saccharomyces cerevisiae KE 162 in peptone water and fresh carrot-orange juice blend (pH: 3.8; 9.8°Brix; 707 NTU; absorption coefficient: 0.17 cm -1 ). Yeast induced damage by single UV-C and mild heat (H) and the combined treatment UV-C/H, was investigated by flow cytometry (FC) and transmission electron microscopy (TEM). When studying induced damage by FC, cells were labeled with fluorescein diacetate (FDA) and propidium iodide (PI) to monitor membrane integrity and esterase activity. UV-C/H provoked up to 4.7 log-reductions of S. cerevisiae; whereas, only 2.6-3.3 log-reductions were achieved by single UV-C and H treatments. FC revealed a shift with treatment time from cells with esterase activity and intact membrane to cells with permeabilized membrane. This shift was more noticeable in peptone water and UV-C/H treated juice. In the UV-C treated juice, double stained cells were detected, suggesting the possibility of being sub-lethally damaged, with compromised membrane but still metabolically active. TEM images of treated cells revealed severe damage, encompassing coagulated inner content, disorganized lumen and cell debris. FC and TEM provided additional information regarding degree and type of damage, complementing information revealed by the traditional plate count technique. Copyright © 2018 Elsevier Ltd. All rights reserved.

  15. Kandó-Melocco, Ferenc. 2015. An Anti-Nazi at Hitler's Table: Political Memoirs of a Hungarian Nobleman Who Dared to Oppose Both Hitler and the Communists. (trans. and ed. Esther Kando Odescalchi. North Charleston, SC: CreateSpace. 162 pp., Illus.; Odescalchi, Esther Kando. 2016. My Escape: Memoirs of a Hungarian Teenage Freedom Fighter. North Charleston, SC: CreateSpace. Illus. 148 pp.

    Directory of Open Access Journals (Sweden)

    Ruth G. Biro

    2017-09-01

    Full Text Available Kandó-Melocco, Ferenc. 2015. An Anti-Nazi at Hitler's Table: Political Memoirs of a Hungarian Nobleman Who Dared to Oppose Both Hitler and the Communists. (trans. and ed. Esther Kando Odescalchi. North Charleston, SC: CreateSpace. 162 pp., Illus.; Odescalchi, Esther Kando. 2016. My Escape: Memoirs of a Hungarian Teenage Freedom Fighter. North Charleston, SC: CreateSpace. Illus. 148 pp.

  16. Preparation of 147Pm metal and the determination of the melting point and phase transformation temperatures

    International Nuclear Information System (INIS)

    Angelini, P.; Adair, H.L.

    1976-07-01

    The promethium metal used in the determination of the melting point and phase transformation temperatures was prepared by reduction of promethium oxide with thorium metal at 1600 0 C and distilling the promethium metal into a quartz dome. The melting point and phase transformation temperatures of promethium metal were found to be 1042 +- 5 0 C and 890 +- 5 0 C, respectively. The ratio for the heat of the high-temperature transformation to the heat of fusion was determined to be 0.415

  17. 40 CFR 162.154 - Disapproval of State registrations.

    Science.gov (United States)

    2010-07-01

    ... unreasonable adverse effects on man or the environment by the registered use. (ii) Refusal of the registering... (b)(1) of this section, the Administrator will make a final decision on disapproval of a State... days of its effective date, then the Administrator will make a final decision on disapproval within 90...

  18. Publications | Page 162 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    africain. Il y a deux ans, le Centre de recherches pour le développement ... African Youth on the Information Highway : Participation and Leadership in Community Development. Tout comme elle l'a fait dans le Nord industrialisé, la révolution de ...

  19. Development of somaclones in sugarcane genotype BF-162 and ...

    African Journals Online (AJOL)

    pris

    2012-02-21

    Feb 21, 2012 ... Baksha R, Alam R, Karim MZ, Paul SK, Hossain MA, Miah MAS,. Rahman ABMM (2002). In vitro Shoot Tip Culture of Sugarcane. (Saccharum officinarum) Variety Isd 28. Int. Quarterly J. Biotech. 1: 67-72. Brisibe E, Miyake AH, Taniguchi T, Maeda E (1994). Regulation of somatic embryogenesis in long-term ...

  20. People’s Republic of China Scientific Abstracts, Number 162

    Science.gov (United States)

    1977-01-28

    endocrine function of the syncytiotrophoblasts. It should be mentioned that the decrement rate in the levels of HCG zh hours after in- jection showed some...photograph and one map are included. AUTHOR: KAO HSIA [7559/0201+] ORG: None TITLE: " Gigantic Tasks Performed Along the Thousands of Miles of the

  1. Publications | Page 162 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Taking Care of What We Have : Participatory Natural Resource Management on ... affirment qu'il améliorerait à la fois l'accès aux soins de santé et leur qualité. ... des régions où il y a eu domestication et évolution des cultures constituent la ...

  2. South of Sahara | Page 162 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Our research program for the region dovetails with The World Economic Forum's Survey on the Global Agenda, which revealed sub-Saharan Africa's most pressing challenges: education and skills development, building sustainable governance systems, and delivering hard infrastructure. Working closely with researchers ...

  3. 47 CFR 36.162 - Intangible assets-Account 2690.

    Science.gov (United States)

    2010-10-01

    ... costs of organizing and incorporating the company, franchises, patent rights, and other intangible... the operations on the basis of the separation of the cost of Telecommunications Plant In Service...

  4. Dicty_cDB: VHB162 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus par...adoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  5. 46 CFR 162.050-5 - Contents of application.

    Science.gov (United States)

    2010-10-01

    ... control procedures, in-process and final inspections and tests followed in manufacturing the item, and construction and sales record keeping systems maintained. (4) Arrangement drawings and piping diagrams of the... containing detailed and easily understandable instructions on installation, operation, calibration, zeroing...

  6. 7 CFR 993.162 - Voluntary prune plum diversion.

    Science.gov (United States)

    2010-01-01

    ... SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE DRIED... production/dehydration characteristics. The addition of a county or counties, as the case may be, to one of...

  7. What we do | Page 162 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... valuable decision support information is vital to the delivery of effective health services. ... The IDRC program initiative, Acacia (communities and the information ... is characterized by great socioeconomic diversity and strong social networks ...

  8. 15 CFR 16.2 - Description and goal of program.

    Science.gov (United States)

    2010-01-01

    ... particular advantages of their products. These objectives are accomplished by: (1) Selecting or developing.... (c) For selected categories of consumer products, the program includes advertising guidelines covering situations where quantitative performance values are stated in advertising or where qualitative...

  9. Development of somaclones in sugarcane genotype BF-162 and ...

    African Journals Online (AJOL)

    pris

    2012-02-21

    Feb 21, 2012 ... Cluster and sub cluster formation further verified the presence of variability in the red rot resistant somaclones with respect to the parent. Key words: Sugarcane, callogenesis, organogenesis, somaclone, polymorphism, cluster. INTRODUCTION. Sugarcane (Saccharum officinarum L) is a major source.

  10. 26 CFR 1.162-21 - Fines and penalties.

    Science.gov (United States)

    2010-04-01

    ... country; or (3) A political subdivision of, or corporation or other entity serving as an agency or... (felony or misdemeanor) in a criminal proceeding; (ii) Paid as a civil penalty imposed by Federal, State... potential liability for a fine or penalty (civil or criminal); or (iv) Forfeited as collateral posted in...

  11. All projects related to | Page 162 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: Poverty, URBAN COMMUNITIES, SOCIAL INEQUALITY, LOCAL LEVEL, ... Nutrition and Food Security in Uplands of Vietnam and Thailand ... SURVEYS, INTERVIEWS, POLICY MAKING, Capacity building, Food security, Gender.

  12. 26 CFR 1.162-13 - Depositors' guaranty fund.

    Science.gov (United States)

    2010-04-01

    ... carried to the credit of the State banking board or duly authorized State officer, ceases to be an asset of the bank and may be withdrawn in whole or in part upon demand by such board or State officer to... deductible except as it is actually paid out as required by law and upon demand of the proper State officers. ...

  13. 7 CFR 1786.162 - Outstanding loan documents.

    Science.gov (United States)

    2010-01-01

    ... outstanding notes issued to RUS, and the RUS Mortgage. (b) Nothing in this subpart shall affect any rights of... shall prohibit a borrower from making prepayments of any loans pursuant to the RE Act in accordance with...

  14. 26 CFR 1.162-29 - Influencing legislation.

    Science.gov (United States)

    2010-04-01

    ...) Reading any publications available to the general public or viewing or listening to other mass media... lobbying communication; and (ii) All activities, such as research, preparation, planning, and coordination, including deciding whether to make a lobbying communication, engaged in for a purpose of making or...

  15. 26 CFR 1.162-2 - Traveling expenses.

    Science.gov (United States)

    2010-04-01

    ... traveling expenses as are reasonable and necessary in the conduct of the taxpayer's business and directly... expenses. If the trip is solely on business, the reasonable and necessary traveling expenses, including travel fares, meals and lodging, and expenses incident to travel, are business expenses. For the...

  16. 33_162 - 165_CHM 006 Aliyu SM

    African Journals Online (AJOL)

    userpc

    Department of Chemistry, Fede baffasma@gmail. ABSTRACT. This research is aimed at titrimetric det collected from boreholes and irrigation ch. Nigeria. Twenty three samples were random the samples was determined immediately was determined using Flame Absorption concentration of Arsenic from boreholes in t.

  17. Preparation of 147Pm ceramic source core

    International Nuclear Information System (INIS)

    Mielcarski, M.

    1989-01-01

    Preparation of ceramic pellets containing fixed promethium-147 is described. Incorporation rate of 147 Pm into the ceramic material was determined. The leachability and vaporization of promethium from the obtained ceramics was investigated. The ceramic pellets prepared by the described procedure, mounted in special holders, can be applied as point sources in beta backscatter thickness gauges. (author)

  18. Process for producing a self luminescent material

    Energy Technology Data Exchange (ETDEWEB)

    Abe, E

    1962-01-28

    A self luminescent material is produced by a process comprising applying a hydroxide or fluoride of promethium-147 suspended in a medium of paraffinic acid to the surface of a fluorescent body. Promethium-147 decays with a half-life of 2.6 years and emits beta-rays but not alpha- and gamma-rays so that it is suitable for manufacturing self luminescent materials. A chloride of promethium-147 cannot be employed because its structure is destroyed by acids. Although fluorides and hydroxides of promethium-147 are difficult to mix with the fluorescent body material, they become mixable when paraffinic acids containing from 12 to 20 carbon atoms, (for example, steric acid, palmitic acid and margaric acid) are used as a medium. In embodiments, the self luminescent materials are prepared by either neutralization of a promethium-147 chloride solution having a specific radioactivity of 1.2 c/cc. with an ammonium hydroxide solution to form gelatinous hydroxide, or the reaction of a promethium-147 chloride solution with H/sub 2/SiF/sub 6/ by heating at 80/sup 0/C to form a fluoride of promethium-147. The products have a specific radioactivity of 8 to 12 mc/g. These products are suspended in vehicles of polystyrene and methacrylic resin to produce the self luminescent coating materials. Tests show that the initical brightness is comparatively high, the decreasing rate of brightness is small, no blackening effects by alpha-rays occur and costs are low. The brightness of the coating containing promethium-147 is 82-85 after 5 days, 100-105 after 100 days and 82-92 after 180 days. With respect to the coating containing radium the values are 31-70 after 5 days, 28-49 after 100 days and 19-31 after 180 days.

  19. 46 CFR 162.050-27 - Oil content meter: Approval tests.

    Science.gov (United States)

    2010-10-01

    ... dimension not exceeding 0.5 mm in diameter arranged in line with the sample flow. The quantity of air.... The pump is run at one-fourth of its design speed. The oil content reading, when steady, is recorded...

  20. 25 CFR 162.231 - How can the land be used under an agricultural lease?

    Science.gov (United States)

    2010-04-01

    ... with recognized principles of sustained yield management, integrated resource management planning, sound conservation practices, and other community goals as expressed in applicable tribal laws, leasing policies, or agricultural resource management plans. Appropriate stipulations or conservation plans must be...

  1. The Search for a Cold War Grand Strategy: NSC 68 & 162

    Science.gov (United States)

    2014-05-22

    Harper Collins Publishers, 1990. Chandler , Alfred D., Jr., and Louis Galamos Jr. The Papers of Dwight D. Eisenhower. Baltimore, MD, 1970. Cutler...76Alfred D. Chandler Jr., and Louis Galamos Jr., The Papers of Dwight D. Eisenhower (Baltimore, MD, 1970), Vol. 11, 1312; Vol. 8, 1609. 77Ibid

  2. 26 CFR 1.162-28 - Allocation of costs to lobbying activities.

    Science.gov (United States)

    2010-04-01

    ... following example. Example. (i) Three full-time employees, A, B, and C, work in the Washington office of... include costs attributable to full-time, part-time, and contract employees. Labor costs include all..., to assume that all full-time personnel spend 1,800 hours per year on a taxpayer's trade or business...

  3. Lifetimes Measurements in 160Yb,162Yb,164Yb,166Yb,168Yb

    International Nuclear Information System (INIS)

    Araddad, S. Y.; El-barouni, A. M.; Rateb, G. M.; Mosbah, D. S.; Elahrash, M. S.; Sergiwa, S. M.

    2004-01-01

    From our measurements of the lifetimes of high spin states in 168 Yb along with the published lifetime data for the nearby even even ytterbium isotopes, 160-168 Yb using the Recoil Distance Method (RDM) and the Doppler Shift Attenuation Method (DSAM) present a great opportunity to probe systematically the relationship between the nuclear shape changes and the reduction in collectivity. (authors)

  4. 33 CFR 162.205 - Suisun Bay, San Joaquin River, Sacramento River, and connecting waters, CA.

    Science.gov (United States)

    2010-07-01

    ... Commander or his authorized representative. (5) Wrecks. In no case following accidents of fire or collision...); a wharf or other structure; work under construction; plant engaged in river and harbor improvement... navigable channels, when within a reasonable distance therefrom and not in any case over a mile, shall...

  5. 78 FR 35022 - Parker-Davis Project-Rate Order No. WAPA-162

    Science.gov (United States)

    2013-06-11

    ...), a power marketing administration within the Department of Energy (DOE), is proposing to extend the... transmission service, firm transmission service of Salt Lake City Area/Integrated Projects power, and non-firm...

  6. Résultats de recherche | Page 162 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Société civile et islamisme en Iraq et au Maroc. Par son dynamisme, la société civile du Maroc s'est approprié avec les années un rôle traditionnellement dévolu aux institutions de l'État, soit offrir des services sociaux dans les secteurs de la santé, de l'éducation et du logement. Projet ...

  7. 20 CFR 702.162 - Liens on compensation authorized under special circumstances.

    Science.gov (United States)

    2010-04-01

    ... district director or the administrative law judge is not satisfied that the trust fund qualifies for a lien... under special circumstances. (a) Pursuant to section 17 of the Act, 33 U.S.C. 917, when a trust fund... authorized on such compensation in favor of the trust fund for the amount of such payments. (b)(1) An...

  8. How to Use the School Survey of Practices Associated with High Performance. REL 2016-162

    Science.gov (United States)

    Weinstock, Phyllis; Yumoto, Futoshi; Abe, Yasuyo; Meyers, Coby; Wan, Yinmei

    2016-01-01

    This report describes and explains how to use the School Survey of Practices Associated with High Performance, which measures the degree to which schools are engaging in practices associated with high performance. State education departments and school districts can use the survey results to identify and describe school practices associated with…

  9. FCJ-162 Symbolic violence in the online field: Calls for ‘civility’ in online discussion

    Directory of Open Access Journals (Sweden)

    Shannon Sindorf

    2014-04-01

    Full Text Available In this paper, I argue that enforcing norms of civility in a deliberative space can be dangerous, as a requirement of civility can be used as a tool to stifle dissent and reinforce existing arrangements of power. I analyse the comments that led to the closing of the online comments board of a community newspaper in Greeley, Colorado in the United States, the editor of the paper’s justification for shutting down commenting, as well as the few comments that made it to the forum in response to the announcement before the commenting function ceased. I find that despite the fact that comments were often rude and insulting, they were performing a vital deliberative democratic function.

  10. 78 FR 45285 - Certifications Pursuant to Section 609 of Public Law 101-162

    Science.gov (United States)

    2013-07-26

    ..., Costa Rica, Ecuador, El Salvador, Guatemala, Guyana, Honduras, Mexico, Nicaragua, Nigeria, Pakistan..., China, the Dominican Republic, Fiji, Hong Kong, Jamaica, Oman, Peru, Sri Lanka, and Venezuela. The... in the Spencer Gulf region in Australia may be exported to the United States under the DS-2031...

  11. 26 CFR 1.162-27 - Certain employee remuneration in excess of $1,000,000.

    Science.gov (United States)

    2010-04-01

    ... capacity other than as a director. For this purpose, remuneration includes any payment in exchange for... received, directly or indirectly, by a director in each of the following circumstances: (A) If remuneration... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Certain employee remuneration in excess of $1...

  12. 26 CFR 1.162-20 - Expenditures attributable to lobbying, political campaigns, attempts to influence legislation...

    Science.gov (United States)

    2010-04-01

    ... fashion, expenditures for advertising which presents views on economic, financial, social, or other... consumer may reduce the demand for them. Legislation which would provide an income tax credit or exclusion...

  13. 33 CFR 162.15 - Manhasset Bay, N.Y.; seaplane restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Manhasset Bay, N.Y.; seaplane... Bay, N.Y.; seaplane restricted area. (a) The restricted area. An area in Manhasset Bay between the... line bearing 166°50′ true from latitude 40°50′17.337 N, longitude 73°43′03.877 W, which point is on the...

  14. : tous les projets | Page 162 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une nouvelle vision de la transition en Syrie. Projet. Le régime syrien ayant exercé un important contrôle sur l'émergence des institutions de la société civile, ces dernières n'ont jamais atteint le degré d'inclusion, de participation et de pluralisme requis afin de donner lieu à une société ouverte et démocratique. Date de ...

  15. 162 Alienation and Quest for Identity in VS Naipaul's A House for Mr ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... Caribbean as a place is regarded as the “Great Wrong” of imperial atrocities perpetrated ... people that guarantee a self-empowered Caribbean future. Introduction. Vidiadhar .... taboos by eating shop bread" (140). In another ...

  16. Ce que nous faisons | Page 162 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... est une organisation non gouvernementale internationale qui encourage la coopération entre les ... Réseau d'information sur la santé du Mozambique ... de plus en plus fréquentes entre des professionnels issus de différentes disciplines.

  17. Hybrid external fixation in the treatment of tibial pilon fractures: A retrospective analysis of 162 fractures.

    Science.gov (United States)

    Galante, Vito N; Vicenti, Giovanni; Corina, Gianfranco; Mori, Claudio; Abate, Antonella; Picca, Girolamo; Conserva, Vito; Speciale, Domenico; Scialpi, Lorenzo; Tartaglia, Nicola; Caiaffa, Vincenzo; Moretti, Biagio

    2016-10-01

    To determine the efficacy of hybrid external fixation in the treatment of tibial pilon fractures. Retrospective, multicentre study. Adult patients with tibial pilon fractures treated with hybrid external fixation. Fracture reduction with ligamentotaxis and fixation with XCaliber hybrid external fixator. Fracture union, complications, functional outcome (Mazur Ankle Score). Union was obtained in 159 fractures at an average of 125days; there were three delayed unions and three non-unions. The most frequent complication was superficial pin-track infections (48), all of which responded to local wound care and antibiotics. There were no deep infections and no DVT. Only one fracture had loss of reduction that required frame revision. The overall functional scores were 91 (excellent) for AO/OTA type A fractures, 89 (good) for type B fractures, and 75 (satisfactory) for type C fractures. Hybrid external fixation is an effective method of stabilising tibial pilon fractures, particularly those with marked comminution. The minimally-invasive technique and stable fixation enable early mobilisation, with good functional results and minimal complications. Level IV Case series. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. 24 CFR 891.655 - Definitions applicable to 202/162 projects.

    Science.gov (United States)

    2010-04-01

    ... includes a kitchen and a bath. Operating costs means expenses related to the provision of housing and...) Security expenses; (4) Utilities expenses, including gas, oil, electricity, water, sewer, trash removal...

  19. Education Policy Implementation: A Literature Review and Proposed Framework. OECD Education Working Papers, No. 162

    Science.gov (United States)

    Viennet, Romane; Pont, Beatriz

    2017-01-01

    This literature review focuses on education policy implementation, its definition, processes and determinants. It aims to clarify what implementing policies involve in complex education systems to support policy work, building on the literature and country examples. An introduction delves into the reasons behind the need to update the concept of…

  20. 26 CFR 1.162-19 - Capital contributions to Federal National Mortgage Association.

    Science.gov (United States)

    2010-04-01

    ... issuance price (the amount of capital contributions evidenced by a share of stock) over the fair market... sale to FNMA of mortgage paper gives rise to the issuance of a share of FNMA stock during a taxable... gain or loss from the sale to FNMA of mortgage paper, with respect to which a share of FNMA stock is...

  1. 40 CFR 205.162-3 - Instructions for maintenance, use, and repair.

    Science.gov (United States)

    2010-07-01

    ...-technical language. (3) The instructions must not be used to secure an unfair competitive advantage. They shall not restrict replacement equipment to original equipment or restrict service to dealer service...

  2. 45 CFR 162.1302 - Standards for referral certification and authorization transaction.

    Science.gov (United States)

    2010-10-01

    ... Standards for Electronic Data Interchange Technical Report Type 3, April 2008, ASC X12N/005010X217E1... authorization. The NCPDP Telecommunication Standard Implementation Guide, Version 5, Release 1 (Version 5.1... (Version 1.1), January 2000, supporting Telecommunications Standard Implementation Guide, Version 5...

  3. 45 CFR 162.1202 - Standards for eligibility for a health plan transaction.

    Science.gov (United States)

    2010-10-01

    ... benefit inquiry and response. The ASC X12 Standards for Electronic Data Interchange Technical Report Type... Telecommunication Standard Implementation Guide, Version 5, Release 1 (Version 5.1), September 1999, and equivalent... supporting Telecommunications Standard Implementation Guide, Version 5, Release 1 (Version 5.1) for the NCPDP...

  4. Inhaled /sup 147/Pm and/or total-body gamma radiation: Early mortality and morbidity in rats

    Energy Technology Data Exchange (ETDEWEB)

    Filipy, R.E.; Lauhala, K.E.; McGee, D.R.; Cannon, W.C.; Buschbom, R.L.; Decker, J.R.; Kuffel, E.G.; Park, J.F.; Ragan, H.A.; Yaniv, S.S.; Scott, B.R.

    1989-05-01

    Rats were given doses of /sup 60/Co gamma radiation and/or lung burdens of /sup 147/Pm (in fused aluminosilicate particles) within lethal ranges in an experiment to determine and compare morbidity and mortality responses for the radiation insults within 1 year after exposure. Radiation-induced morbidity was assessed by measuring changes in body weights, hematologic parameters, and pulmonary-function parameters. Acute mortality and morbidity from inhaled promethium were caused primarily by radiation pneumonitis and pulmonary fibrosis that occurred more than 53 days after exposure. Acute mortality and morbidity from total-body gamma irradiation occurred within 30 days of exposure and resulted from the bone-marrow radiation syndrome. Gamma radiation caused transient morbidity, reflected by immediately depressed blood cell levels and by reduced body weight gain in animals that survived the acute gamma radiation syndrome. Inhaled promethium caused a loss of body weight and diminished pulmonary function, but its only effect on blood cell levels was lymphocytopenia. Combined gamma irradiation and promethium lung burdens were synergistic, in that animals receiving both radiation insults had higher morbidity and mortality rates than would be predicted based on the effect of either kind of radiation alone. Promethium lung burdens enhanced the effect of gamma radiation in rats within the first 30 days of exposure, and gamma radiation enhanced the later effect of promethium lung burdens. 70 refs., 68 figs., 21 tabs.

  5. Raman spectra of Pm2O3, PmF3, PmCl3, PmBr3 and PmI3

    International Nuclear Information System (INIS)

    Wilmarth, W.R.; Peterson, J.R.

    1988-01-01

    Raman spectral data are presented for the sesquioxide and the trihalides (F, Cl, Br and I) of promethium. The Raman spectra of these lanthanide compounds are reported for the first time and are compared with those of the homologous lanthanide compounds. Tentative symmetry assignments have been made for the observed Raman-active bands based on factor group analysis of their respective crystal structures and comparisons with the assigned Raman spectra of other lanthanide compounds. The characteristic band patterns of the Raman phonon spectra have been found to be very useful in determining the crystal structure of the respective promethium compounds. (author)

  6. Use of Box-Wilson method for determination of optimum conditions for extraction some lanthanoids with amines

    International Nuclear Information System (INIS)

    Kopyrin, A.A.; Murashov, V.D.; Shvedov, V.P.

    1980-01-01

    The effect of DTPA, cerium and europium nitrates concentration in the range from 10 -1 -10 -6 M on extraction and separation of americium (3), cerium (3), prometium and europium 0.2 M with the solution of tri-n-octylamine nitrate in n-xylol of concentrated lithium nitrate solutions, is investigated. The method of Box-Wilson is used to determine the optimum conditions of separation of the above elements. The maximum values of separation factors are obtained for the following pairs: cerium(3)-americium(3) - 100, americium (3)-europium - 12, promethium-americium(3) - 35, cerium(3)-promethium - 30, cerium(3)-europium - 890 [ru

  7. Mass separation of rare-earth elements by a high-temperature thermal ion source coupled with a He-jet system

    International Nuclear Information System (INIS)

    Kawase, Y.; Okano, K.; Aoki, K.

    1987-01-01

    By using a high-temperature thermal ion source coupled to a He-jet system, neutron-rich isotopes of rare-earth elements such as cerium, praseodymium, neodymium and promethium produced by the thermal-neutron fission of /sup 235/U were ionized and successfully separated. The temperature dependence of the ionization efficiency has been measured and found to be explained qualitatively by the vapour pressure of the relevant elements. The characteristic temperature dependence of the ionization efficiency has been utilized for Z-identification of several isobars of rare-earth elements. The heaviest isotopes of neodymium and promethium, /sup 155/Nd and /sup 156/Pm, have recently been identified

  8. Corrigendum to "Decadal to millennial variations in water column parameters in pelagic marine environments of the Western Tethys (Carpathian realm) during Middle-Late Jurassic - Evidence from the radiolarian record" [Glob. Planet. Chang. 162 (2018) 148-162

    Science.gov (United States)

    Bąk, Marta; Bąk, Krzysztof; Michalik, Mariola

    2018-04-01

    The authors regret (Abstract. The causal link between changes in Middle-Late Jurassic radiolarian habitat group abundances, microfacies and water column conditions in the Western Tethys was studied based on the examination of siliceous limestones and cherts from the Tatra Mountains, Central Western Carpathians. Deposition occurred on a morphological high with incised pelagic sedimentation within a tropical zone. High-resolution quantitative analyses of millimetre-thick microlaminae show changes in microfacies constituents that most likely record the fluxes of nutrients and biological activity in superficial waters. Variability of radiolarian assemblages that are classified to represent (i) upwelling and (ii) stratified water taxa suggest successive changes in water conditions that fluctuated between periods of upwelling and periods of formation of a thick, stratified, warm superficial layer above a deep thermocline during middle Bajocian-late Oxfordian time. Such variations would be strongly influenced by ocean-atmosphere global circulation patterns, which are caused by pressure gradients and are the result of Walker circulation along the equatorial part of the Tethys and the Panthalassa Ocean, including the duration of El Niño-like and La Niña-like cycles, which affect sea surface temperature trends on decadal scales. The fluctuations in radiolarian assemblages in the sediments indicate that long-term palaeoceanographic changes occurred on multi-decadal to centennial-scales during the Bajocian, but lengthened in duration to millennial-scale during the Bathonian through the Oxfordian.)

  9. R and D of an LLRF control system for a 162.5 MHz radio frequency system

    International Nuclear Information System (INIS)

    Wen Lianghua; Wu Xianwu; He Yuan; Zhang Ruifeng; Zhang Shenghu; Zhu Zhenglong; Li Chunlong; Shi Longbo; Zhang Rui; Chang Wei

    2013-01-01

    This paper describes a low level radio frequency control system that was developed by the Institute of Modern Physics Chinese Academy of Sciences, and will be used in Injector Ⅱ of the China-ADS project. The LLRF control system consists of an RF modulated front end, fast analog-to-digital converter (ADC) modules, and a digital signal processing board based on a field programmable gate array. The system has been tested on a room temperature cavity with 12-hr, and the results illustrate that the stability of amplitude and phase achieved ±0.32% and ±0.35 degrees, respectively. (authors)

  10. 33 CFR 162.40 - Inland waterway from Delaware River to Chesapeake Bay, Del. and Md. (Chesapeake and Delaware Canal).

    Science.gov (United States)

    2010-07-01

    ...., between Reedy Point, Delaware River, and Old Town Point Wharf, Elk River. (b) Speed. No vessel in the..., are required to travel at all times at a safe speed throughout the canal and its approaches so as to... Point and Welch Point. (f) Sailboats. Transiting the canal by vessels under sail is not permitted...

  11. 33 CFR 162.90 - White River, Arkansas Post Canal, Arkansas River, and Verdigris River between Mississippi River...

    Science.gov (United States)

    2010-07-01

    ... go adrift. Immediately after completion of the emergency mooring, the lockmaster of the first lock... of approach to unattended, normally open automatic, movable span bridges, the factor of river flow...

  12. Experiment data report for Loft anticipated transient experiments 16-1, 16-2, and 16-3

    International Nuclear Information System (INIS)

    Batt, D.L.; Carpenter, J.M.

    1980-12-01

    This report presents uninterpreted experimental data from the second, third, and fourth anticipated transient experiments (Experiments L6-2, L6-1, and L6-3), conducted in the Loss-of-Fluid Test (LOFT) facility. Experiment L6-2 simulated a loss of forced primary coolant flow in a large PWR by tripping power to primary coolant pump motor generator sets, allowing the pumps to coast down under the influence of the flywheel system. Reactor scram initiated on indication of low flow in the primary coolant system (PCS). Experiment L6-1 simulated a loss of steam load in a large PWR by closing the steam flow control valve which reduced heat removal from the secondary coolant system and caused the PCS temperature and pressure to increase until reactor scram initiated on indication on high PCS pressure. Experiment L6-3 simulated an excessive load increase in a large PWR by opening the steam flow control valve at its maximum rate. PCS temperature and pressure decreased, causing the reactor to scram on indication of low PCS pressure. All experiments were complete when the plant was returned to a hot-standby condition

  13. SU-E-J-162: Quality Assurance Procedures for MR Guided Focused Ultrasound Treatment of Bone Metastasis

    Energy Technology Data Exchange (ETDEWEB)

    Chen, L; Chen, X; Wang, B; Gupta, R; Ma, C [Fox Chase Cancer Center, Philadelphia, PA (United States)

    2014-06-01

    Purpose: The purpose of this work is to develop and verify our quality assurance (QA) procedures to ensure the safety and efficacy of MR-guided focused ultrasound (MRgFUS) treatment of bone metastases. Methods: A practical QA program was developed. Monthly and daily QA (DQA) procedures were performed. The major QA items included the checks of the machine hardware, software and patient safety features. Briefly, these checks/tests include: 1) the cooling system reservoir and treatment table; 2) power to the treatment table; 3) the MR coil; 4) the transducer position with MRI; 5) image display on the treatment work station; 6) the effective focal spot in 3 directions using MR thermometry; and 7) all the safety devices including a sonication lamp, and the emergency stop-sonication switches. In order to avoid patient skin burn, it is important to remove gas bubbles in the interfaces between the treatment table and the gel pad, and the gel pad and patients skin during the patient setup. Our QA procedures have been verified and evaluated through patient treatments. Seven patients with scapula, humeral head, sacrum, ilium, pubic ramus and acetabular bone metastases were treated using MRgFUS. Results: Our study showed that all seven patients tolerated the MRgFUS treatment well. No skin toxicity or other complications were observed. The pain score (0–10) using the visual analog scale (VAS) was significantly reduced from 8.0 ± 1.1 before treatment to 4.7 ± 3.0, 3.0 ± 1.5, 3.2 ± 2.8 and 3.4 ± 1.5 at one day, one month, two months and three months after the MRgFUS treatment, respectively. Conclusion: We demonstrated that with the appropriate QA procedures, MRgFUS is a safe, effective and noninvasive treatment modality for palliation of bone metastases.

  14. SU-E-J-162: Quality Assurance Procedures for MR Guided Focused Ultrasound Treatment of Bone Metastasis

    International Nuclear Information System (INIS)

    Chen, L; Chen, X; Wang, B; Gupta, R; Ma, C

    2014-01-01

    Purpose: The purpose of this work is to develop and verify our quality assurance (QA) procedures to ensure the safety and efficacy of MR-guided focused ultrasound (MRgFUS) treatment of bone metastases. Methods: A practical QA program was developed. Monthly and daily QA (DQA) procedures were performed. The major QA items included the checks of the machine hardware, software and patient safety features. Briefly, these checks/tests include: 1) the cooling system reservoir and treatment table; 2) power to the treatment table; 3) the MR coil; 4) the transducer position with MRI; 5) image display on the treatment work station; 6) the effective focal spot in 3 directions using MR thermometry; and 7) all the safety devices including a sonication lamp, and the emergency stop-sonication switches. In order to avoid patient skin burn, it is important to remove gas bubbles in the interfaces between the treatment table and the gel pad, and the gel pad and patients skin during the patient setup. Our QA procedures have been verified and evaluated through patient treatments. Seven patients with scapula, humeral head, sacrum, ilium, pubic ramus and acetabular bone metastases were treated using MRgFUS. Results: Our study showed that all seven patients tolerated the MRgFUS treatment well. No skin toxicity or other complications were observed. The pain score (0–10) using the visual analog scale (VAS) was significantly reduced from 8.0 ± 1.1 before treatment to 4.7 ± 3.0, 3.0 ± 1.5, 3.2 ± 2.8 and 3.4 ± 1.5 at one day, one month, two months and three months after the MRgFUS treatment, respectively. Conclusion: We demonstrated that with the appropriate QA procedures, MRgFUS is a safe, effective and noninvasive treatment modality for palliation of bone metastases

  15. 77 FR 44676 - 162nd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2012-07-30

    ... afternoon of August 29, subject to change. Organizations or members of the public wishing to submit a... following issues: (1) Managing Disability Risks in an Environment of Individual Responsibility; (2) Current... change, and can be retrieved by most Internet search engines. Individuals or representatives of...

  16. Seasonal Variation in Blood Pressure in 162,135 Patients With Type 1 or Type 2 Diabetes Mellitus.

    Science.gov (United States)

    Hermann, Julia M; Rosenbauer, Joachim; Dost, Axel; Steigleder-Schweiger, Claudia; Kiess, Wieland; Schöfl, Christof; Holl, Reinhard W

    2016-04-01

    Seasonal variation in blood pressure (BP) has been observed in different populations. However, only few studies have focused on BP seasonality in diabetic patients. This study examined the seasonal patterns in BP in 62,589 patients with type 1 diabetes mellitus (T1DM) and in 99,546 patients with type 2 diabetes mellitus (T2DM) from the German/Austrian Diabetes Follow-up Registry. Adjusted mean BP values revealed seasonal cycles of 12 months, with higher BP in colder months. Using harmonic regression models, the estimated systolic BP difference throughout the year was 2.28/2.48 mm Hg in T1DM/T2DM (both P1). Interestingly, seasonal variation in diastolic BP was larger in T1DM than in T2DM (1.24/0.64 mm Hg, P1). A sex difference was observed in T1DM only, while age differences occurred in both types of diabetes. Correlations between BP and potentially related factors such as outdoor temperature indicated that reasons underlying BP seasonality are likely to be complex and vary by subgroup. © 2015 Wiley Periodicals, Inc.

  17. 19 CFR 162.45 - Summary forfeiture: Property other than Schedule I and Schedule II controlled substances. Notice...

    Science.gov (United States)

    2010-04-01

    ... 812), exceeds $5,000, the notice will be published for at least three successive weeks in a newspaper...-in-interest shall be notified of the newspaper and expected dates of publication of such notice. (2... kind included in two or more seizures will be advertised as one unit. (c) Delay of publication...

  18. 19 CFR 162.77 - Prepenalty notice for violations of section 592, Tariff Act of 1930, as amended.

    Science.gov (United States)

    2010-04-01

    ...) Specify all laws and regulatons allegedly violated, (iv) Disclose all material facts which establish the... negligence, or negligence, and (vi) State the estimated loss of duties, if any, and, taking into account all...

  19. 19 CFR 162.77a - Prepenalty notice for violation of section 593A, Tariff Act of 1930, as amended.

    Science.gov (United States)

    2010-04-01

    ... aiding or procuring of, the drawback claim; (iii) Specify all laws and regulations allegedly violated... alleged violation occurred as a result of fraud or negligence; and (vi) State the estimated actual or...

  20. 33 CFR 162.65 - All waterways tributary to the Atlantic Ocean south of Chesapeake Bay and all waterways tributary...

    Science.gov (United States)

    2010-07-01

    ... Atlantic Ocean south of Chesapeake Bay and all waterways tributary to the Gulf of Mexico east and south of... All waterways tributary to the Atlantic Ocean south of Chesapeake Bay and all waterways tributary to..., which are tributary to or connected by other waterways with the Atlantic Ocean south of Chesapeake Bay...

  1. Erratum for "Symmetry of stochastic non-variational differential equations" [Phys. Rep. 686 (2017) 1-62

    Science.gov (United States)

    Gaeta, G.

    2017-11-01

    In my recent paper [1], due to a regrettable and rather trivial mistake, a mixed derivatives term is missing in the expression (5.3) for the Ito Laplacian - which is essentially a Taylor expansion. The correct formula is, of course

  2. SU-F-J-162: Is Bulky Electron Density Assignment Appropriatefor MRI-Only Based Treatment Planning for Lung Cancer?

    Energy Technology Data Exchange (ETDEWEB)

    Prior, P; Chen, X; Johnstone, C; Gore, E; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2016-06-15

    Purpose: To assess the appropriateness of bulky electron density assisment for MRI-only treatment planning for lung cancer via comparing dosimetric difference between MRI- and CT-based plans. Methods: Planning 4DCTs acquired for six representative lung cancer patients were used to generate CT-based IMRT plans. To avoid the effect of anatomic difference between CT and MRI, MRI-based plans were generated using CTs by forcing the relative electron density (rED) of organ specific values from ICRU report 46 and using the mean rED value of the internal target volume (ITV) of the patient for the ITV. Both CT and “MRI” plans were generated using a research planning system (Monaco, Elekta) employing Monte Carlo dose calculation the following dose-volume-parameters (DVPs): D99 – dose delivered to 99% of the ITV/PTV volume; D95; D5; D1; Vpd –volume receiving the prescription dose; V5 – volume of normal lung irradiated > 5 Gy; and V20. The percent point difference and dose difference was used for comparison for Vpd-V5-V20 and D99-D1, respectively. Four additional plans per patient were calculated with rEDITV = 0.6 and 1.0 and rEDlung = 0.1 and 0.5. Results: Noticeable differences in the ITV and PTV point doses and DVPs were observed. Variations in Vpd ranged from 0.0–6.4% and 0.32–18.3% for the ITV and PTV, respectively. The ITV and PTV variations in D99, D95, D5 and D1 were 0.15–3.2 Gy. The normal lung V5 & V20 variations were no larger than 1.9%. In some instances, varying the rEDITV between rEDmean, 0.6 and 1.0 resulted in D95 increases ranging from 3.9–6.3%. Uniform rED assignment on normal lung affected DVPs of ITV and PTV by 4.0–9.8% and 0.3–19.6%, respectively. Conclusion: The commonly-used uniform rED assignment in MRI-only based planning may not be appropriate for lung-cancer. A voxel based method, e.g. synthetic CT generated from MRI data, is required. This work was partially funded by Elekta, Inc.

  3. State of the art of cardiac pacemaker technology

    International Nuclear Information System (INIS)

    Lambeck, R.

    1978-01-01

    The development of cardiac pacemakers from fixed-frequency to demand pacemakers is reviewed. The latter is described in more detail with regard to its energy sources and its design. The use of radioactive energy sources is illustrated by the example of 238 Pu and 147 promethium and a comparison of the two radiation sources. (AJ) 891 AJ [de

  4. 10 CFR 32.55 - Same: Quality assurance; prohibition of transfer.

    Science.gov (United States)

    2010-01-01

    ...; prohibition of transfer. (a) Each person licensed under § 32.53 shall visually inspect each device and shall... promethium-147. (b) Each person licensed under § 32.53 shall take a random sample of the size required by the... subject each unit in the sample to the following tests: (1) Each device shall be immersed in 30 inches of...

  5. ESO 439-162/163 - a common proper motion binary formed by a magnetic DQ and a DC type white dwarf

    International Nuclear Information System (INIS)

    Ruiz, M.T.; Maza, J.

    1988-01-01

    In the course of a search for faint large proper motion stars, a common proper motion pair was identified having a mu = 0.38 + or - 0.03 arcsec/yr in the direction theta = 233 deg. The stars are separated by 23 arcsec and have apparent visual magnitudes 18.77 and 19.84, respectively. Spectrophotometry of the stars established that the fainter component is a cold DC white dwarf, while the brighter one is a magnetic white dwarf with strong Swan bands of C2 shifted and broadened by an about 10 to the 8th G magnetic field. 6 references

  6. Multibeam collection for KN162L15: Multibeam data collected aboard Knorr from 2001-05-07 to 2001-05-20, Seychelles to Istanbul, Turkey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  7. Analysis of 162 colon injuries in patients with penetrating abdominal trauma: concomitant stomach injury results in a higher rate of infection.

    Science.gov (United States)

    O'Neill, Patricia A; Kirton, Orlando C; Dresner, Lisa S; Tortella, Bartholomew; Kestner, Mark M

    2004-02-01

    Fecal contamination from colon injury has been thought to be the most significant factor for the development of surgical site infection (SSI) after trauma. However, there are increasing data to suggest that other factors may play a role in the development of postinjury infection in patients after colon injury. The purpose of this study was to determine the impact of gastric wounding on the development of SSI and nonsurgical site infection (NSSI) in patients with colon injury. Post hoc analysis was performed on data prospectively collected for 317 patients presenting with penetrating hollow viscus injury. One hundred sixty-two patients with colon injury were subdivided into one of three groups: patients with isolated colon wounds (C), patients with colon and stomach wounds with or without other organ injury (C+S), and patients with colon and other organ injury but no stomach injury (C-S) and assessed for the development of SSI and NSSI. Infection rates were also determined for patients who sustained isolated gastric injury (S) and gastric injury in combination with other injuries other than colon (S-C). Penetrating Abdominal Trauma Index, operative times, and transfusion were assessed. Discrete variables were analyzed by Cochran-Mantel-Haenszel chi2 test and Fisher's exact test. Risk factor analysis was performed by multivariate logistic regression. C+S patients had a higher rate of SSI infection (31%) than C patients (3.6%) (p=0.008) and C-S patients (13%) (p=0.021). Similarly, the incidence of NSSI was also significantly greater in the C+S group (37%) compared with the C patients (7.5%) (p=0.07) and the C-S patients (17%) (p=0.019). There was no difference in the rate of SSI or NSSI between the C and C-S groups (p=0.3 and p=0.24, respectively). The rate of SSI was significantly greater in the C+S patients when compared with the S-C patients (31% vs. 10%, p=0.008), but there was no statistical difference in the rate of NSSI in the C+S group and the S-C group (37% vs. 24%, p=0.15). The addition of a gastric injury to a colon injury has a synergistic effect on the rate of postoperative infection.

  8. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.04504, Lat: 05.87031 (WGS84); Sensor Depth: 1.52m; Data Range: 20080402-20100412.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  9. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.12694, Lat: 05.86387 (WGS84); Sensor Depth: 15.20m; Data Range: 20040402-20060328.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  10. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.04044, Lat: 05.87450 (WGS84); Sensor Depth: 5.18m; Data Range: 20080402-20100409.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  11. CRED Subsurface Temperature Recorder (STR); PRIA, KIN; Long: -162.38180, Lat: 06.42888 (WGS84); Sensor Depth: 5.18m; Data Range: 20080407-20100415.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  12. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.11275, Lat: 05.86657 (WGS84); Sensor Depth: 12.19m; Data Range: 20090918-20100408.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  13. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.12130, Lat: 05.88243 (WGS84); Sensor Depth: 3.96m; Data Range: 20080403-20100411.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  14. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.04503, Lat: 05.87029 (WGS84); Sensor Depth: 1.21m; Data Range: 20060326-20070618.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  15. CRED Subsurface Temperature Recorder (STR); PRIA, KIN; Long: -162.34219, Lat: 06.39240 (WGS84); Sensor Depth: 7.60m; Data Range: 20040403-20060329.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  16. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.16859, Lat: 05.88377 (WGS84); Sensor Depth: 19.51m; Data Range: 20080331-20100411.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  17. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.00206, Lat: 05.87637 (WGS84); Sensor Depth: 32.61m; Data Range: 20080402-20100412.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  18. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.06237, Lat: 05.88208 (WGS84); Sensor Depth: 25.29m; Data Range: 20060324-20080227.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  19. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.06183, Lat: 05.88278 (WGS84); Sensor Depth: 4.26m; Data Range: 20060324-20080330.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  20. CRED Subsurface Temperature Recorder (STR); PRIA, PAL; Long: -162.11364, Lat: 05.86635 (WGS84); Sensor Depth: 19.20m; Data Range: 20090918-20100408.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  1. CRED Subsurface Temperature Recorder (STR); PRIA, KIN; Long: -162.37968, Lat: 06.43320 (WGS84); Sensor Depth: 8.23m; Data Range: 20080406-20100416.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  2. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... § 86.160-00 providing that the procedure can be run by the Administrator for SEA and in-use enforcement... the values of (ACRFt) additional dynamometer load is applied by the dynamometer to the vehicle tire... testing should be an average of at least two runs unless the manufacturer can demonstrate to the...

  3. Corrigendum to "A semi-empirical airfoil stall noise model based on surface pressure measurements" [J. Sound Vib. 387 (2017) 127-162

    Science.gov (United States)

    Bertagnolio, Franck; Madsen, Helge Aa.; Fischer, Andreas; Bak, Christian

    2018-06-01

    In the above-mentioned paper, two model formulae were tuned to fit experimental data of surface pressure spectra measured in various wind tunnels. They correspond to high and low Reynolds number flow scalings, respectively. It turns out that there exist typographical errors in both formulae numbered (9) and (10) in the original paper. There, these formulae read:

  4. Multibeam collection for KN162L11: Multibeam data collected aboard Knorr from 2001-02-11 to 2001-03-15, Mombassa, Kenya to Seychelles

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  5. Assis, Machado de. Ressurrection by Machado de Assis. Trad. Karen Sherwood Sotelino. Pittsburgh: Latin American Literary Review Press, 2013. 162 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa

    2015-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2015v35n2p494 Resenha crítica da primeira e única tradução para o inglês do romance machadiano Ressurreição, publicado em 1872. Lançada em 2013, a tradução da professora da Universidade de Stanford Karen Sherwood Sotelino chamou a atenção de estudiosos de Machado por mostrar como a obra do autor brasileiro desperta interesse atual no mundo anglófono.

  6. Assis, Machado de. Ressurrection by Machado de Assis. Trad. Karen Sherwood Sotelino. Pittsburgh: Latin American Literary Review Press, 2013. 162 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa

    2015-12-01

    Full Text Available Resenha crítica da primeira e única tradução para o inglês do romance machadiano Ressurreição, publicado em 1872. Lançada em 2013, a tradução da professora da Universidade de Stanford Karen Sherwood Sotelino chamou a atenção de estudiosos de Machado por mostrar como a obra do autor brasileiro desperta interesse atual no mundo anglófono.

  7. Investigations of the Navβ1b sodium channel subunit in human ventricle; functional characterization of the H162P Brugada Syndrome mutant

    DEFF Research Database (Denmark)

    Yuan, Lei; Koivumaki, Jussi; Liang, Bo

    2014-01-01

    Brugada Syndrome (BrS) is a rare inherited disease which can give rise to ventricular arrhythmia and ultimately sudden cardiac death. Numerous loss-of-function mutations in the cardiac sodium channel Nav1.5 have been associated with BrS. However, few mutations in the auxiliary Navβ1-4 subunits ha...... density was reduced by 48 % (-645±151 vs - 334±71 pA/pF), V1/2 steady-state inactivation shifted by -6.7 mV (-70.3±1.5 vs. -77.0±2.8 mV), and time-dependent recovery from inactivation slowed by more than 50% as compared to co-expression with Navβ1b WT. Computer simulations revealed...

  8. Multibeam collection for KN162L13: Multibeam data collected aboard Knorr from 2001-03-30 to 2001-05-01, Mauritius to Mauritius

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  9. Multibeam collection for KN162L12: Multibeam data collected aboard Knorr from 2001-03-24 to 2001-03-27, Seychelles to Mauritius

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Health care research by degrees N Reid Health care research by degrees Blackwell Scientific 162pp £13.99 0632-03466-1 [Formula: see text].

    Science.gov (United States)

    1993-03-03

    Inadequately understood statistics so often cloud both the argument of the researcher and the judgement of the reader. Norma Reid brings a refreshing clarity to a complex topic; she takes the mystification and mystique out of statistics. Her basic premiss that theory ought to be based on practical utility and relevance shines through her text and helps to make the subject accessible co clinicians who want to understand the underpinnings of their practice. Research methods, particularly qualitative approaches, are sketchily dealt with when compared with the wealth of detail on the mechanics of computing. Also, it is awkward to find methods and analysis not clearly separated in places (eg, Delphi studies), but ample references direct the reader to more expansive sources. Any attempt to steer the uninitiated through the minefields of computing is fraught with difficulties, and some will be disappointed to find one system used exclusively, but, perhaps, it serves as an illustration rather than a course to be slavishly followed.

  11. Multibeam collection for KN162L19: Multibeam data collected aboard Knorr from 2001-06-25 to 2001-07-22, Las Palmas, Spain to Bridgetown, Barbados

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. CRED Recording Current Meter (RCM); PRIA, KIN; Long: -162.35925, Lat: 06.38263 (WGS84); Sensor Depth: 7.60m; Data Range: 20020318-20040402.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Recording Current Meters (RCM) provide a time series of water...

  13. Multibeam collection for KN162L17: Multibeam data collected aboard Knorr from 2001-06-01 to 2001-06-10, Istanbul, Turkey to Istanbul, Turkey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  14. Public health implications of radioluminous materials

    International Nuclear Information System (INIS)

    Moghissi, A.A.; Carter, M.W.

    1975-07-01

    The safety, efficacy, and relative merits of radium, tritium, and promethium in radioluminous materials, particularly as used in the dial paint of timepieces and instruments, were evaluated. The reduced use of radium in recent years is reflected in estimates of the population dose for 1973--3600 person-rem from 24 million tritium watches versus 2500 person-rem from 8.4 million radium clocks. Had radium still been used in watches, the dose could have been significantly higher. No reliable data are available on the activity of promethium used for this purpose. Assuming a minimum dose of 6100 person-rem from all these radionuclides, an average of 0.03 mrem/year is estimated for the U.S. population. Because of the unavoidable radiation hazard, it is recommended that radium no longer be used in radioluminous materials. Furthermore, the 'frivolous' use of other radionuclides for this purpose should be discouraged

  15. Preparation, characterization and thermal behaviour study of 4-dimethyl amino benzal pyruvate of lanthanides (III) and yttrium (III) in solid state

    International Nuclear Information System (INIS)

    Miyano, M.H.

    1990-01-01

    Solid state compounds involving Ln and DMBP, where Ln trivalent lanthanides (except promethium) and yttrium; DMBP 4-dimethyl amino benzylidene pyruvate, were prepared by addition of ligand to the corresponding metal ions chlorides, both in aqueous solution. The precipitates were washed with distilled water and dried at 40 0 C in a forced circulation oven. Complexometry with EDTA, thermogravimetry (TG), differential thermal analysis (DTA), infra-red absorption and X-ray diffraction have been used in the study of these compounds. (author)

  16. Nuclear structure from radioactive decay

    International Nuclear Information System (INIS)

    Wood, J.L.

    1991-01-01

    This report discusses nuclear structure from radioactive decay of the following: Neutron-Deficient Iridium Isotopes; Neutron-Deficient Platinum Isotopes; Neutron-Deficient Gold Isotopes; Neutron-Deficient Mercury Isotopes; Neutron-Deficient Thallium Isotopes; Neutron-Deficient Lead Isotopes; Neutron-Deficient Samarium Isotopes; Neutron-Deficient Promethium Isotopes; Neutron-Deficient Neodymium Isotopes; and Neutron-Deficient Praseodymium Isotopes. Also discussed are Nuclear Systematics and Models

  17. Identification of Radiation Sources in a Peacetime Environment

    Science.gov (United States)

    1998-04-01

    Radionuclides in Medicine, Research, and Industry (continued) Isotope Symbol Polonium - 210 Po- 210 Promethium-147 Pr-147 Radium-226 Ra-226 Selenium-75 Se...equip- ment seen in a nuclear medicine department or nuclear pharmacy, radia- tion therapy sources, industrial food irradiation facilities, and small... Food Irradiator 28 Commercial Irradiator Facility 28 Appendix 1. Commonly Used Radionuclides in Medicine, Research, and Industry 29 General

  18. New developments in the analysis and measurement of thicknesses by excitation of the fluorescent lines by means of β particles

    International Nuclear Information System (INIS)

    Martinelli, P.

    1960-01-01

    The process for analysing and measuring the thickness of deposits by β-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [fr

  19. Surface-ionization ion source designed for in-beam operation with the BEMS-2 isotope separator

    International Nuclear Information System (INIS)

    Bogdanov, D.D.; Voboril, J.; Demyanov, A.V.; Karnaukhov, V.A.; Petrov, L.A.

    1976-01-01

    A surface-ionization ion source designed to operate in combination with the BEMS-2 isotope separator in a heavy ion beam is described. The ion source is adjusted for the separation of rare-earth elements. The separation efficiency for 150 Dy is determined to be equal to about 20% at the ionizer temperature of 2600 deg K. The hold-up times for praseodymium, promethium and dysprosium in the ion source range from 5 to 10 sec at the ionizer temperature of 2500-2700 deg K

  20. Methods radiation protection data sheets for the use radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    These radiation protection data sheets are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to safety in this field. They contain the essential radiation protection data for the use of radionuclides in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: bromine 82, cobalt 58, cobalt 60, manganese 54, mercury 197, mercury 203, promethium 147, xenon 133 and ytterbium 169. (O.M.)

  1. Sorption and chromatographic techniques for processing liquid waste of nuclear fuel cycle

    International Nuclear Information System (INIS)

    Gelis, V.M.; Milyutin, V.V.; Chuveleva, E.A.; Maslova, G.B.; Kudryavtseva, S.P.; Firsova, L.A.; Kozlitin, E.A.

    2000-01-01

    In the spent nuclear fuel processing procedures the significant quantity of high level liquid waste containing long-lived high toxic radionuclides of cesium, strontium, promethium, americium, curium, etc. is generated. Separation of those radionuclides from the waste not merely simplifies the further safe waste handling but also reduces the waste processing operation costs due to the market value of certain individual radionuclide preparations. Recovery and separation of high grade pure long-lived radionuclide preparations is frequently performed by means of chromatographic techniques. (authors)

  2. Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

    International Nuclear Information System (INIS)

    Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

    2001-01-01

    For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

  3. Casualty Estimation for Nuclear and Radiological Weapons

    Science.gov (United States)

    2016-06-01

    rate 2.69 d β Metal Polonium - 210 210Po Static eliminators 138 d α Metal foil Radium-226 226Ra Brachytherapy - low dose rate 1600 y α Salt...Promethium-147 153Gd Gadolinium-153 169Yb Ytterbium-169 170Tm Thulium-170 192Ir Iridium-192 210Po Polonium - 210 226Ra Radium-226 238Pu Plutonium-238...Brussels: NATO, in development). iv present in a large food irradiator facility, and constitutes about 34.5 kg of 137Cs. To illustrate alternative

  4. Installation for producing sealed radioactive sources

    International Nuclear Information System (INIS)

    Fradin, J.; Hayoun, C.

    1969-01-01

    This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [fr

  5. Lack of Annual Reports Make it Difficult to Analyze Library Strategic Credibility. A Review of: Staines, G. (2009. Towards an assessment of strategic credibility in academic libraries. Library Management, 30(3, 148-162.

    Directory of Open Access Journals (Sweden)

    Kirsty Thomson

    2011-06-01

    Full Text Available Objective – To investigate whether libraries achieve strategic credibility by assessing if strategic planning goals match the achievements described in annual reports.Design – Content analysis of annual reports and strategic plans from a sample of Association of Research Libraries (ARL.Setting – Academic libraries in Canada and the United States of America.Subjects – A random sample of 12 Canadian and 16 American academic libraries. All libraries were members of ARL.Methods – The researcher contacted the directors of 28 ARL libraries and asked for copies of their strategic plans and annual reports. She also visited the websites of libraries to obtain the reports. The contents of the strategic plans and annual reports were analyzed, and trends in the Canadian and American strategic plans were identified.Main Results – This study found that only 39% of ARL libraries produce annual reports, making it difficult to assess if libraries have strategic credibility, as their strategic plans cannot be assessed against annual reports. The strategic plans gathered in this study were analyzed and emerging themes were identified. These included physical library space (renovations, expansions or new buildings; offsite storage; assessment (both of the libraries’ services, and of information literacy training; development activities such as fundraising and marketing; and personnel issues. Cultural differences also were found inthe strategic plans, with American libraries being more focused on trends such as digitization and institutional repositories, andCanadian libraries’ plans being more focused on users’ needs. Trends in annual reports were not reported due to the small number ofannual reports in the sample.Conclusion – This study gives a snapshot ofthe trends in strategic plans of ARL members. It shows that many ARL members do not produce an annual report, and that it istherefore difficult to assess if their strategicplans are implemented successfully. Thearticle hypothesizes that the communication ofachievements may now be part ofdevelopment and marketing efforts, ratherthan traditional annual reports.

  6. Hermansky F, Pudlak P. Albinism associated with hemorrhagic diathesis and unusual pigmented reticular cells in the bone marrow: report of two cases with histochemical studies. Blood. 1959;14(2):162-169.

    Science.gov (United States)

    2016-04-07

    This landmark article by Frantisek Hermansky and Paulus Pudlak, clinicians in Prague, Czechoslovakia, is the first to describe 2 unrelated individuals with what is now called Hermansky-Pudlak syndrome, a bleeding disorder that occurs in association with oculocutaneous albinism. The definition of this syndrome resulted not only in improved care of these patients but also in a functional and molecular understanding of the disease and the role of dense granule secretion in platelet function. Hermansky-Pudlak syndrome is now known to be related to defective dense granule biogenesis due to mutations in any of ≥9 different genes.

  7. CRED Subsurface Temperature Recorder (STR); Palmyra Atoll, Pacific Remote Island Areas; Long: -162.12653, Lat: 05.86666 (WGS84); Sensor Depth: 10.40m; Data Date Range: 20100407-20110503.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  8. Corrigendum to 'A new cross-detection method for improved energy-resolving photon counting under pulse pile-up' [Nucl. Instrum. Methods Phys. Res. A 867 (2017) 154-162

    Science.gov (United States)

    Lee, Daehee; Lim, Kyung Taek; Park, Kyungjin; Lee, Changyeop; Cho, Gyuseong

    2018-03-01

    The authors regret to inform the editorial office that the name for one of the co-authors in the article requires a correction. The co-author's name should be changed from 'Kyungjin Park' to 'Kyeongjin Park'. We would like to emphasize that 'Kyungjin Park' and 'Kyeongjin Park' belong to the identical person. However, 'Kyeongjin Park' is the official spelling on other published journals and his passport. There has been a miscommunication among the authors on the pronunciation for 'Kyeongjin Park' when we were translating his name from Korean to English. Therefore, the author's name spelling needs to be changed from 'Kyungjin Park' to 'Kyeongjin Park.'

  9. Garip Turunç, La Turquie aux marches de l’Europe, Paris : l’Harmatan, 2001, 162 p., tableaux, annexes, bibliographie, préface de Maurice Catin.

    Directory of Open Access Journals (Sweden)

    Gérard Groc

    2004-12-01

    Full Text Available Les relations entre la Turquie et l'Europe, de la Communauté Économique Européenne du Traité de Rome (1957 à l'Union Européenne du Traité de Maastricht (1993 sont à la fois longues et embrouillées. En effet, premier pays, avec la Grèce, à avoir signé, en 1963, un accord d'association avec le Marché Commun, la Turquie est tout à la fois un ancien partenaire de l'Europe occidentale et un vieux prétendant à l'adhésion, jamais satisfait et toujours éconduit. Et la complexité de ces relations vi...

  10. CRED Subsurface Temperature Recorder (STR); Kingman Reef, Pacific Remote Island Areas; Long: -162.34221, Lat: 06.39242 (WGS84); Sensor Depth: 7.00m; Data Date Range: 20100414-20120512.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  11. A Latent Class Analysis of Multimorbidity and the Relationship to Socio-Demographic Factors and Health-Related Quality of Life. A National Population-Based Study of 162,283 Danish Adults

    DEFF Research Database (Denmark)

    Larsen, Finn Breinholt; Pedersen, Marie Hauge; Friis, Karina

    2017-01-01

    Respiratory Disorders" (2%). Female gender was associated with an increased likelihood of belonging to any of the six multimorbidity classes except for class 2 (Hypertension). Low educational attainment predicted membership of all of the multimorbidity classes except for class 5 (Asthma-Allergy). Marked...... had nearly identical profiles in relation to health-related quality of life. CONCLUSION: The results clearly support that diseases tend to compound and interact, which suggests that a differentiated public health and treatment approach towards multimorbidity is needed.......% of the population) labeled "1) Relatively Healthy" and six classes with a very high prevalence of multimorbidity labeled; "2) Hypertension" (14%); "3) Musculoskeletal Disorders" (10%); "4) Headache-Mental Disorders" (7%); "5) Asthma-Allergy" (6%); "6) Complex Cardiometabolic Disorders" (3%); and "7) Complex...

  12. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Supplemental Sea Surface Temperature Recorder (SBE39); PRIA, PAL; Long: -162.10289, Lat: 05.88463 (WGS84); Sensor Depth: 1.00m; Data Range: 20080401-20090515.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  13. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Sea Surface Temperature and Conductivity Recorder (SBE37); PRIA, PAL; Long: -162.10280, Lat: 05.88468 (WGS84); Sensor Depth: 1.00m; Data Range: 20060326-20080401.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  14. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Environmental Data Logger (EDL); PRIA, PAL; Long: -162.10283, Lat: 05.88468 (WGS84); Sensor Depth: 0.00m; Data Range: 20020315-20021024.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to sea surface measure water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  15. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Environmental Data Logger (EDL); PRIA, PAL; Long: -162.10282, Lat: 05.88467 (WGS84); Sensor Depth: 0.00m; Data Range: 20040330-20060325.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to sea surface measure water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  16. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Supplemental Sea Surface Temperature Recorder (SBE39); PRIA, PAL; Long: -162.10280, Lat: 05.88468 (WGS84); Sensor Depth: 1.00m; Data Range: 20060326-20071017.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  17. CRED Subsurface Temperature Recorder (STR); Palmyra Atoll, Pacific Remote Island Areas; Long: -162.03300, Lat: 05.88243 (WGS84); Sensor Depth: 10.40m; Data Date Range: 20100409-20110816.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  18. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Sea Surface Temperature and Conductivity Recorder (SBE37); PRIA, PAL; Long: -162.10289, Lat: 05.88463 (WGS84); Sensor Depth: 1.00m; Data Range: 20080401-20100410.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  19. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Sea Surface Temperature and Conductivity Recorder (SBE37); PRIA, PAL; Long: -162.10282, Lat: 05.88467 (WGS84); Sensor Depth: 1.00m; Data Range: 20040330-20060325.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  20. Multibeam collection for KN162L09: Multibeam data collected aboard Knorr from 2001-01-07 to 2001-01-31, Cape Town, South Africa to Durban, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. Deep-UV high resolution cavity ring-down spectroscopy of the Schumann-Runge bands in O-16(2) and O-18(2) at wavelengths 197-203 nm

    NARCIS (Netherlands)

    Hannemann, S.; van Duijn, E.J.; Ubachs, W.M.G.

    2005-01-01

    With the use of a novel titanium:sapphire laser source delivering, upon fourth harmonic generation, narrowband and tunable radiation in the deep-UV, spectroscopic studies were performed on weak Schumann-Runge bands of oxygen. Improved values for rotational and fine structure molecular parameters for

  2. Økologisk risikovurdering af genmodificeret majs-krydsning: BT11xMIR162x1507xGA21 i anmeldelse vedr. markedsføring under Forordning 1829/2003/EF

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta; Sørensen, Jesper Givskov; Damgaard, Christian

    2012-01-01

    "Den genmodificerede fire-stakkede majskrydsning adskiller sig fra konven-tionelle majs ved at have indsat gener der gør planterne tolerante over for herbiciderne glufosinat-ammonium og glyfosat. Desuden er majsen tolerant over for angreb af sommerfuglearter såsom kornboreren (Ostrinia nubilalis...... consequences. In case of accidental mixing and/or dispersal of GMO-seed, this will probably be detected by the procedures performed by the Danish NaturErhvervstyrelse....

  3. Multibeam collection for KN162L07: Multibeam data collected aboard Knorr from 2000-12-09 to 2001-01-05, Cape Town, South Africa to Cape Town, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. Songs for funerals and intercession. A collection of polyphony for the confraternity of St Barbara at the Corbie Abbey, Amiens, Bibliothèque Centrale Louis Aragon, MS 162 D. Edited by Peter Woetmann Christoffersen. Volume 2

    DEFF Research Database (Denmark)

    Christoffersen, Peter Woetmann

    2015-01-01

    artikel ‘Prayers for the dead, funeral music and simple polyphony in a French music manuscript of the early sixteenth century’. Dette labyrintiske materiale findes desuden organiseret i en lineær form som to PDF-bøger i A4-format: Volume 1 – Introduction and appendices (96 sider), volume 2 – Edition...

  5. CRED Coral Reef Early Warning System (CREWS) Enhanced Buoy, Supplemental Sea Surface Temperature Recorder (SBE39); PRIA, PAL; Long: -162.10282, Lat: 05.88467 (WGS84); Sensor Depth: 1.00m; Data Range: 20040330-20060325.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Enhanced (CREWS-ENH) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  6. CRED Subsurface Temperature Recorder (STR); Kingman Reef, Pacific Remote Island Areas; Long: -162.43914, Lat: 06.41887 (WGS84); Sensor Depth: 33.50m; Data Date Range: 20100417-20120509.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  7. Installation for producing sealed radioactive sources; Installation de fabrication de sources radioactives scellees

    Energy Technology Data Exchange (ETDEWEB)

    Fradin, J.; Hayoun, C. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1969-07-01

    This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)

  8. Installation for producing sealed radioactive sources; Installation de fabrication de sources radioactives scellees

    Energy Technology Data Exchange (ETDEWEB)

    Fradin, J; Hayoun, C [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1969-07-01

    This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)

  9. ORF Alignment: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .3.2) ... Length = 177 ... Query: 103 LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLCXXXXXXXXXXXXXXXXXX 162 ... ... ... LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLC ... Sbjct: 1 ... LHRAFSVFIFNEQGELLLQQRATEKITFPDLWTNTCCSHPLC

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... AVRRVTEVGEEVLHRPCRDVTEFGPDLAALIDDMFRTMYVAEGAGLAANQVGVDLRLFVY 60 ... Query: 145 GVPLLVEGTGYFARC...LAHETDHVNGHVYLDRLSGRERKAALR 186 ... GVPLLVEGTGYFARCLAHETDHVNGHVYLDRLSGRERKAALR Sbjct: 121 GVPLLVEGTGYFARCLAHETDHVNGHVYLDRLSGRERKAALR 162

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

  12. A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Oe

    1995-08-01

    The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb{sup 22+} ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb{sup 22+} ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb{sup 21+}). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs.

  13. Measurement of 147Pm in-vivo using phoswich detectors

    International Nuclear Information System (INIS)

    Johnson, J.R.

    1977-10-01

    Recently an individual was suspected of having inhaled significant amounts of the almost pure beta emitter, 147 Pm. Urine analysis confirmed that contaminations had occurred but these results could not be used to evaluate the amount of material deposited in the lungs because an acceptable model of promethium clearance from the lung to blood and hence to urine has not been developed. Therefore another method of evaluation, that of the measurement, using phoswich detectors, of the soft photons emitted by the deposited 147 Pm was used. This paper describes the calibrations and measurements that were done in order that an upper limit on the deposited activity, and hence limits for committed dose to the various organs, could be assigned. (author)

  14. Determination of stability constants of lanthanide complexes with tetracycline

    International Nuclear Information System (INIS)

    Saiki, Mitiko

    1975-01-01

    The stability constants of complexes compounds formed with tetracycline and lanthanides elements were determined for all lanthanides except promethium. The experimental procedure used was solvent extraction of the lanthanides labelled with their radioactive isotopes. It was shown that the formed complexes are mononuclear and that no hydroxo complexes or negatively charged complexes are formed in the experimental conditions of this work. Four methods of calculation were used for all complexes studied: the method of the average number of ligands, the method of limiting value, the method of two parameters and the method of weighted least squares. A comparison was made of the graphical methods with the method of least squares, showing the convenience of preceding least squares calculation by the graphical methods, in order to verify eventual mistakes of numerical data. It was shown the advantage of using radioisotopes of the elements for such a study, specially if the solvent extraction technique is used to-get the experimental data. (author)

  15. Radioactive rare earths from fallout for study of particle movement in the sea

    International Nuclear Information System (INIS)

    Sugihara, Thomas T.; Bowen, Vaughan T.

    1962-01-01

    As part of an extensive study of the distribution of long-lived radionuclides from fallout in the Atlantic Ocean, a large number of measurements of cerium-144 and promethium-147 concentration have been made. Comparison of these concentrations as they vary both horizontally and vertically, with simultaneously measured concentrations of strontium-90, indicates that the rare earths are generally depleted in surface water, by comparison with the nuclides known to be soluble. This observation, coupled with frequent observation of rare-earth enrichment at depth, leads us to postulate rapid vertical transport of rare earths by attachment to particles undergoing sedimentation. This is completely plausible in terms of the 'radiocolloid' behaviour generally observed for rare earths at sea-water pH. An attempt is made to interpret this study in the overall picture of the marine geochemistry of the trivalent cations, as well as to emphasize the unique and generally useful aspects of the fallout tracer experiment. (author) [fr

  16. Closed N-shell alkali spectra

    International Nuclear Information System (INIS)

    Ellis, D.G.; Curtis, L.J.

    1982-01-01

    Term values and ionization potentials have been calculated for several ions in the promethium (N = 61) isoelectronic sequence. As the nuclear charge is increased, the ground configuration changes from 4f 13 5s 2 to 4f 14 5s giving the upper portion of the sequence an alkali-like character. According to our most recent Hartree-Fock calculations with first-order relativistic corrections, the ground term is 5s 2 S for Z > 77 (Ir XVII) and the first excited term is 5p 2 P 0 for Z > 84 (P 0 XXIV). Comparisons are made with calculations of Cowan in W XIV. The prospects for observation of these spectra in fast ion beams are discussed. (orig.)

  17. Dosimetry in single lung cells by means of microautoradiographic activity measurements

    International Nuclear Information System (INIS)

    Kraus, W.

    1976-01-01

    After inhalation of compounds containing promethium-147 in the lungs of mice most of the activity was deposited in the form of local concentrations (hotspots). By means of a special quantitative microautoradiographic method using stripping film ORWO K 105, measurements of the activity of single hotspots of about 10 -14 Ci were possible. A microphotometer with a variable measuring diaphragm was used for the determination of the density profile of the autoradiographic image in order to get hotspot depth within the biological specimen. To determine hotspot activity it was necessary to calibrate the film with a Pm-147 plane source. The systematic and random errors of the method are discussed in detail, giving a total error of +- 21% (SD) for one hotspot activity measurement. A few examples of biological results obtained by the method are given. Simple models were used to calculate doses absorbed in macrophage and alveolar cell nuclei from the measured activities. (author)

  18. On the use of spectroscopic techniques to determine the crystal structure of compounds of the artificial f elements

    International Nuclear Information System (INIS)

    Peterson, J.R.

    1989-01-01

    For some time the author has been using solid state absorption spectrophotometry to identify the crystal structure of selected transuranium (5f) and promethium (4f) compounds, based on spectral-structural correlations in his data base. More recently he has shown that Raman phonon spectroscopy is also very useful in this regard. These spectral probes of structure have their specific advantages and disadvantages; however, both are applicable to the structural characterization of radioactive compounds and can provide data for interpretation faster and more reliably than the commonly used X-ray powder diffraction method. The experimental methods, examples from the growing data bases, successes and limitations of these spectral probes of crystal structure, and some useful applications to the study of f-element compounds under varying conditions of temperature and pressure are presented

  19. A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence

    International Nuclear Information System (INIS)

    Andersson, Oe.

    1995-08-01

    The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb 22+ ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb 22+ ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb 21+ ). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs

  20. Results of submerged sediment core sampling and analysis on Par Pond, Pond C, and L Lake: July 1995

    International Nuclear Information System (INIS)

    Koch, J.W. II; Martin, F.D.; Friday, G.P.

    1996-06-01

    Sediment cores from shallow and deep water locations in Par Pond, Pond C, and L Lake were collected and analyzed in 1995 for radioactive and nonradioactive constituents. This core analysis was conducted to develop a defensible characterization of contaminants found in the sediments of Par Pond, Pond C, and L Lake. Mercury was the only nonradiological constituent with a nonestimated quantity that was detected above the U.S Environmental Protection Agency Region IV potential contaminants of concern screening criteria. It was detected at a depth of 0.3--0.6 meters (1.0--2.0 feet) at one location in L Lake. Cesium-137, promethium-146, plutonium-238, and zirconium-95 had significantly higher concentrations in Par Pond sediments than in sediments from the reference sites. Cobalt-60, cesium-137, plutonium-238, plutonium-239/240, and strontium-90 had significantly higher concentrations in L-Lake sediments than sediments from the reference sites

  1. Studies of photon spectra from a thallium-204 foil source as an aid to dosimetry and shielding

    CERN Document Server

    Francis, T M

    1976-01-01

    Beta ray foil sources incorporating nuclides such as thallium-204, promethium-147 and strontium-90 plus yttrium-90 ar increasingly used in industrial devices such as thickness gauges. These sources are so constructed that they give rise to complex photon spectra containing low energy Bremsstrahlung and X-rays characteristic of the constructional materials. The energy response of practical monitoring instruments is such that they are likely to underestimate the dose due to such spectra unless they are calibrated using appropriate spectra. This report describes a series of measurements carried out on a commercially available thallium-204 foil source and five commonly used shielding materials. The measurements made with a NaI(T1) spectrometer have been corrected for instrumental distortions to obtain the photon spectra in air. These spectra are presented and have been used to compute dose in air with the help of published data on mass energy-absorption coefficients. Also included in the report are data derived f...

  2. Acoustic study of the characteristic temperature of metals

    International Nuclear Information System (INIS)

    Tekuchev, V.V.; Rygalov, L.N.; Ivanova, I.V.; Barashkov, B.I.

    2000-01-01

    The calculation of the Debye temperature for 64 metals, including Be, La, Mo, W, Os, Ni, Cd, In, Ta, U, Sc, Cs, Sr, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Dy, Ho, Er, Yb, Lu, Th is carried out. The data on polonium and promethium are obtained for the first time. The calculation is performed with application of ultrasound velocity value at the melting temperature of the given metal. The average derivation of the calculational data on the Debye temperature from the published ones equals 12%. It is noted, that application of the acoustic method for determination of the characteristic temperature makes it possible to solve the wide range of theoretical and applied problems [ru

  3. Separation device of radio lanthanides (DISER)

    International Nuclear Information System (INIS)

    Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.

    2008-01-01

    At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and

  4. Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)

    Energy Technology Data Exchange (ETDEWEB)

    Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com

    2008-07-01

    At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166

  5. “La Constitución de los Pueblos de Occidente”. Une proposition inédite du voyageur cAlî Bey l’Abbasside pour le Maroc dans l´Arxiu Històric de la Ciutat de Barcelona (AHCB, Col. Toda, Ms B.162-II

    Directory of Open Access Journals (Sweden)

    Mercè Viladrich

    2006-11-01

    Full Text Available L’objectif de ce travail est de faire connaître et d’éditer à partir d’un manuscrit autographe le texte intitulé Constitution des peuples d´Occident rédigé par le voyageur catalan Domènec Badía i Leblich (1767-18181, connu sous le nom d’cAlî Bey l’Abbasside. Cette grande charte était destinée à s´implanter comme texte légal dans l´Empire du Maroc. Fonctionnaire au service du premier ministre de Carlos IV, Manuel de Godoy, Domènec Badía voyagea en 1803 au Maroc, dans la péninsule Arabique et au Moyen Orient et gagna une certaine célébrité parmi ses contemporains en racontant ses aventures dans un récit Les voyages d´Ali Bey en Asie et en Afrique, œuvre qui mélange vérité historique et fiction et dans laquelle l´auteur révèle une psychologie pathologique.

  6. Reflexiones en torno a la pensión de alimentos: la irretroactividad de la modificación de una pensión de alimentos. Comentario a la STS núm. 162/2014, de 26 de marzo (Rj 2014, 2035)

    OpenAIRE

    Chaparro Matamoros, Pedro

    2015-01-01

    El Tribunal Supremo ha declarado que la modificación de una pensión de alimentos únicamente surge efecto desde el momento en que se dicta la sentencia que la acuerda, y no desde la fecha de interposición de la demanda inicial. The Supreme Court has held that the modification of an alimony takes effect only from the time of the judgment that establishes it, and not from the date of filing of the initial claim.

  7. A gestão social como base metodológica de avaliação de projetos de responsabilidade social de empresas http://dx.doi.org/10.15601/1983-7631/rt.v8n15p150-162

    Directory of Open Access Journals (Sweden)

    Marcelo Scarpa Rennó

    2015-12-01

    Full Text Available Este trabalho busca promover uma contribuição metodológica através de revisão da literatura de avaliações de projetos de responsabilidade social de empresas (RSC em suas áreas de influência, sob a ótica da gestão social. Nas avaliações normalmente desenvolvidas desses projetos, percebe-se que a construção de indicadores é mais atrelada às necessidades internas das empresas, em detrimento de outros indicadores capazes de aferir a efetividade na promoção do desenvolvimento local e da sustentabilidade dos processos desencadeados pelos projetos. Neste sentido, como avaliar a sustentabilidade destes projetos de RSC em sua capacidade de promover desenvolvimento local? Entende-se aqui que a sustentabilidade destas inciativas está diretamente associada à afinidade metodológica dos projetos com a gestão social. Sendo assim, propõe-se a aferição de seus impactos em aspectos qualitativos e que traduzem valores intangíveis locais, tais como: o capital social, a participação, o empoderamento e o protagonismo comunitário na condução dos processos.    

  8. Notat vedr. By- og Landskabsstyrelsens anmodning om en foreløbig vurdering af mulige konsekvenser på udpegningsgrundlaget for Natura 2000 område nr. 162 ved etablering af sommerhuse på Agersø og Orø (Notat til Skov- og Naturstyrelsen)

    DEFF Research Database (Denmark)

    Wind, Peter

    2008-01-01

      By- og Landskabsstyrelsen har med brev af den 30. maj 2008 anmodet Danmarks Miljøundersøgelser om at foretage en screening af mulige konsekvenser på udpegningsgrundlaget som anført ovenfor på baggrund af eksisterende data og viden.   I notatet gør DMU rede for mulige konsekvenser for udpegnings......  By- og Landskabsstyrelsen har med brev af den 30. maj 2008 anmodet Danmarks Miljøundersøgelser om at foretage en screening af mulige konsekvenser på udpegningsgrundlaget som anført ovenfor på baggrund af eksisterende data og viden.   I notatet gør DMU rede for mulige konsekvenser...

  9. A enfermagem nas estratégias de enfrentamento implementadas a pacientes oncológicos em cuidados paliativos: uma revisão integrativa doi: 10.12662/2317-3076jhbs.v3i3.162.p172-179.2015

    Directory of Open Access Journals (Sweden)

    Silvio Eder Dias da Silva

    2015-09-01

    Full Text Available Introdução: O cuidado paliativo apresenta-se como uma abordagem assistencial que tem como objetivo promover uma melhoria na qualidade de vida dos pacientes e de seus familiares, por meio da prevenção e do alívio do sofrimento por meio de identificação precoce e tratamento da dor e outros agravos físicos e psicológicos. Objetivo: identificar como os estudos de enfermagem vem abordando as estratégias de coping ao paciente em cuidados paliativos oncológicos. Método: Trata-se de uma revisão integrativa. O material selecionado para análise foi extraído nas bases de dados National Library of Medicine (PubMed, Literatura Latino Americana e do Caribe em Ciências da Saúde (LILACS e Cumulative Index to Nursing and Alied Health Literature (CINAHL, segundo os seguintes critérios de inclusão: artigos publicados nos idiomas português, inglês ou espanhol, artigos completos que abordem a temática em questão. Ao final do processo de seleção, foram identificados 18 artigos. Resultados: As estratégias de enfrentamento encontradas foram: realizar mudanças no cotidiano; adotar uma nova rotina de acordo com a necessidade de cuidados; manter a esperança; buscar apoio espiritual; preservar uma boa relação do familiar com o profissional de saúde; reconhecer os aspectos positivos do cuidar; valorizar o tempo restante ao lado do ente querido; praticar constantemente a autorreflexão; aceitar as delimitações do cuidado e dividir os cuidados com a equipe. Conclusão: Coping na enfermagem é recente no Brasil; ela constitui uma ferramenta indispensável para a compreensão dos problemas enfrentados pela terminalidade do câncer entre os estudos aqui analisados.

  10. Genetics Home Reference: Omenn syndrome

    Science.gov (United States)

    ... immunodeficiency. Front Immunol. 2014 Apr 22;5:162. doi: 10.3389/fimmu.2014.00162. Erratum in: Front ... immunodeficiency. Front Immunol. 2014 Apr 22;5:162. doi: 10.3389/fimmu.2014.00162. Erratum in: Front ...

  11. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FATMYAAHGVGLAANQVGEAVRVFVYD Sbjct: 1 ... VRPLGLLGDPVLHARCAEVTDFGPELAALVEDLFATMYAAHGVGLAANQVGEAVRVFVYD 60 ... Query: 171 TVRGTGFFARC...LQHECDHLEGRVYADRLTGRRHRKLMRQVAR 212 ... TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR Sbjct: 121 TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR 162

  12. The Danish Air Quality Monitoring Programme

    DEFF Research Database (Denmark)

    Ellermann, Thomas; Nøjgaard, Jacob Klenø; Nordstrøm, Claus

    Aarhus University, DCE – Danish Centre for Environment and Energy, 64 pp. Scientific Report from DCE – Danish Centre for Environment and Energy No. 162. http://dce2.au.dk/pub/SR162.pdf......Aarhus University, DCE – Danish Centre for Environment and Energy, 64 pp. Scientific Report from DCE – Danish Centre for Environment and Energy No. 162. http://dce2.au.dk/pub/SR162.pdf...

  13. Protein (Cyanobacteria): 647660116 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :162 ... hypothetical protein, partial Prochlorococcus sp. scB243_496A2 MRILLAAAECAPMIKVGGMGDVVGSLPPSLIKLGHDVRVIIPGYGKLWSLLEVSNEPVFRTNTMGTDFAVYEAKHPIHNYVIYLVGHPTFDSDQIYGGENEDWRFTFFASAT

  14. 42 CFR 81.23 - Guidelines for cancers for which primary site is unknown.

    Science.gov (United States)

    2010-10-01

    ...), 189 (M). Brain and spinal cord (198.3) 162, 172 (M), 174 (F). Other parts of nervous system (198.4) 162, 172 (M), 174 (F), 185 (M), 202. Bone and bone marrow (198.5) 162, 174 (F), 185 (M). Ovary (198.6...

  15. J.O. no. 10 of the 13 january 2004, page 991, text no. 14. Decrees, orders. General texts. Decree no. 2004-47 of the 12 january 2004 modifying the decree no. 96-978 of the 31 october 1996 relative to the creation of the nuclear installation no. 162 named EL4-D, installation of storage for the Monts d'Arree power plants materials; J.O. no. 10 du 13 janvier 2004, page 991, texte no. 14. Decrets, arretes, circulaires. Textes generaux. Decret no. 2004-47 du 12 janvier 2004 modifiant le decret no. 96-978 du 31 octobre 1996 relatif a la creation de l'installation nucleaire de base no. 162 denommee EL4-D, installation d'entreposage de materiels de la centrale nucleaire des monts d'Arree

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-06-01

    The reactor EL4, implemented in december 1966, has definitely shutdown on the 31 july 1985. This reactor was an industrial prototype, built and exploited by Cea and EDF. In the framework of the partial dismantling of the installation, the decree 96-978 of the 31 october 1996 agreed the Cea to modify the installation to become a storage installation. (A.L.B.)

  16. J.O. no. 10 of the 13 january 2004, page 991, text no. 14. Decrees, orders. General texts. Decree no. 2004-47 of the 12 january 2004 modifying the decree no. 96-978 of the 31 october 1996 relative to the creation of the nuclear installation no. 162 named EL4-D, installation of storage for the Monts d'Arree power plants materials

    International Nuclear Information System (INIS)

    2004-06-01

    The reactor EL4, implemented in december 1966, has definitely shutdown on the 31 july 1985. This reactor was an industrial prototype, built and exploited by Cea and EDF. In the framework of the partial dismantling of the installation, the decree 96-978 of the 31 october 1996 agreed the Cea to modify the installation to become a storage installation. (A.L.B.)

  17. Search Results | Page 50 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 491 - 500 of 9601 ... ... WOMEN'S RIGHTS (162) Apply WOMEN'S RIGHTS filter · GENDER ... Knowledge for Democracy Myanmar (7) Apply Knowledge for ... INDIGENOUS POPULATION ETHNIC MINORITIES TRADITIONAL CULTURE ...

  18. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TMYAANGVGLAANQIGVPLRVFVYD Sbjct: 1 ... VRPLALLGDPVLHAPCEEVTDHGPELARLVEDMFATMYAANGVGLAANQIGVPLRVFVYD 60 ... Query: 133 RVLGTGWFARC...LQHECDHLDGGVYVDRVSGWRHRRVMRQAAR 174 ... RVLGTGWFARCLQHECDH...LDGGVYVDRVSGWRHRRVMRQAAR Sbjct: 121 RVLGTGWFARCLQHECDHLDGGVYVDRVSGWRHRRVMRQAAR 162

  19. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SQRTAEGVGLAANQIGVDLKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECKDVTDFGAELEQLVADMFASQRTAEGVGLAANQIGVDLKVFVYDC 60 ... Query: 162 PIKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PIKVRGTGYFARCLQ...HETDHLYGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PIKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164

  20. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GVGLAANQIGVSKKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDC 60 ... Query: 162 PVKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PVKVRGTGYFARCLQHETDHL...YGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PVKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164

  1. ORF Alignment: NC_003423 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pombe) ... Length = 141 ... Query: 22 ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSD...LCGYKNIVHGGF 81 ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSDLCGYKNIVHGGF Sbjct: 1 ... ... ISMQPYKGEDNKSYIANLVRHNALTFCPYYFIEKSGKGSVVYFHPTSDLCGYKNIVHGGF 60 ... Query: 142 LLRLNGSEPPVLCAKASGFFV 162 ... LLRLNGSEPPVLCAKASGFFV Sbjct: 121 LLRLNGSEPPVLCAKASGFFV 141

  2. ORF Alignment: NC_006526 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ltransferase [Zymomonas mobilis subsp. mobilis ... ZM4] ... Length = 162 ... Query: 11 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE 70 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE Sbjct: 1 ... IALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGKSPLFSSEERASM

  3. Startup Report for Ground Water Extraction, Treatment, and Recharge System

    National Research Council Canada - National Science Library

    Lamb, Steve

    1997-01-01

    The document presents startup procedures, observations and measurements conducted during the startup of the Groundwater Extraction, Treatment and Recharge System, built for the 162nd Fighter Wing, Air...

  4. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available family ... [Bacillus clausii KSM-K16] ... Length = 162 ... Query: 84 ... LIAEMESIYKAIIGGSRELINQDDIV...QAATLLENANRIEIYGIGSSGLSGQEMKFRLMRM 143 ... LIAEMESIYKAIIGGSRELINQDDIVQAATL...LENANRIEIYGIGSSGLSGQEMKFRLMRM Sbjct: 1 ... LIAEMESIYKAIIGGSRELINQDDIVQAATLLENANRIEIYGIGSSGLSGQEMKFRLMRM 60 ... Qu

  5. Plasma Separation Process: Betacell (BCELL) code: User's manual. [Bipolar barrier junction

    Energy Technology Data Exchange (ETDEWEB)

    Taherzadeh, M.

    1987-11-13

    The emergence of clearly defined applications for (small or large) amounts of long-life and reliable power sources has given the design and production of betavoltaic systems a new life. Moreover, because of the availability of the plasma separation program, (PSP) at TRW, it is now possible to separate the most desirable radioisotopes for betacell power generating devices. A computer code, named BCELL, has been developed to model the betavoltaic concept by utilizing the available up-to-date source/cell parameters. In this program, attempts have been made to determine the betacell energy device maximum efficiency, degradation due to the emitting source radiation and source/cell lifetime power reduction processes. Additionally, comparison is made between the Schottky and PN junction devices for betacell battery design purposes. Certain computer code runs have been made to determine the JV distribution function and the upper limit of the betacell generated power for specified energy sources. A Ni beta emitting radioisotope was used for the energy source and certain semiconductors were used for the converter subsystem of the betacell system. Some results for a Promethium source are also given here for comparison. 16 refs.

  6. Rare-earth metal prices in the USA ca. 1960 to 1994

    Science.gov (United States)

    Hedrick, James B.

    1997-01-01

    Rare-earth metal prices were compiled from the late 1950s and early 1960s through 1994. Although commercial demand for rare-earth metals began in 1908, as the alloy mischmetal, commercial quantities of a wide range of individual rare-earth metals were not available until the late 1950s. The discovery of a large, high-grade rare-earth deposit at Mountain Pass. CA, USA, in 1949, was significant because it led to the production of commercial quantities or rare-earth elements that reduced prices and encouraged wider application of the materials. The availability of ore from Mountain Pass, and other large rare-earth deposits, especially those in Australia and China, has provided the world with abundant resources for rare-earth metal production. This availability, coupled with improved technology from Government and private-sector metallurgical research, has resulted in substantial decreases in rare-earth metal prices since the late 1950s and early 1960s. Price series for the individual rare-earth metals (except promethium) are quoted on a kilogram basis from the late 1950s and early 1960s through 1994. Prices are given in US dollars on an actual and constant dollar basis. Industrial and economic factors affecting prices during this time period are examined.

  7. The occurrence of primary pulmonary neoplasms in rats after inhalation of 147Pm in fused aluminosilicate particles

    International Nuclear Information System (INIS)

    Herbert, R.A.; Scott, B.R.; Hahn, F.F.; Newton, G.J.; Snipes, M.B.; Damon, E.G.; Boecker, B.B.

    1988-01-01

    To determine the biological response following low-energy, beta irradiation of the lung, F344/Crl rats were exposed to aerosols of promethium-147 in fused aluminosilicate particles and observed for their life spans. Radiation pneumonitis and pulmonary fibrosis caused the majority of deaths during the first year after exposure with cumulative doses to the lungs of 210 to 630 Gy. Primary pulmonary neoplasms were responsible for the majority of deaths that occurred beyond 1 yr after exposure and in rats receiving lower cumulative doses to the lung. Hemangiosarcomas and squamous cell carcinomas were the most prevalent pulmonary neoplasms. Three adenocarcinomas were found. The uncorrected crude incidence of primary lung tumors increased with increasing dose to the lung for cumulative doses less than 140 Gy. With higher doses, the incidence declined. Adjusting the data for competing risks eliminated the turnover in the dose-response curve. The times of onset of pulmonary tumors and median survival times were dose-dependent. Rats with higher accumulated radiation doses developed fatal lung tumors at earlier times after exposure. (author)

  8. Strategic Materials in the Automobile: A Comprehensive Assessment of Strategic and Minor Metals Use in Passenger Cars and Light Trucks.

    Science.gov (United States)

    Field, Frank R; Wallington, Timothy J; Everson, Mark; Kirchain, Randolph E

    2017-12-19

    A comprehensive component-level assessment of several strategic and minor metals (SaMMs), including copper, manganese, magnesium, nickel, tin, niobium, light rare earth elements (LREEs; lanthanum, cerium, praseodymium, neodymium, promethium, and samarium), cobalt, silver, tungsten, heavy rare earth elements (yttrium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium), and gold, use in the 2013 model year Ford Fiesta, Focus, Fusion, and F-150 is presented. Representative material contents in cars and light-duty trucks are estimated using comprehensive, component-level data reported by suppliers. Statistical methods are used to accommodate possible errors within the database and provide estimate bounds. Results indicate that there is a high degree of variability in SaMM use and that SaMMs are concentrated in electrical, drivetrain, and suspension subsystems. Results suggest that trucks contain greater amounts of aluminum, nickel, niobium, and silver and significantly greater amounts of magnesium, manganese, gold, and LREEs. We find tin and tungsten use in automobiles to be 3-5 times higher than reported by previous studies which have focused on automotive electronics. Automotive use of strategic and minor metals is substantial, with 2013 vehicle production in the United States, Canada, EU15, and Japan alone accounting for approximately 20% of global production of Mg and Ta and approximately 5% of Al, Cu, and Sn. The data and analysis provide researchers, recyclers, and decision-makers additional insight into the vehicle content of strategic and minor metals of current interest.

  9. Technology for recovery of by-products

    International Nuclear Information System (INIS)

    Van Tuy, H.H.

    1983-01-01

    Products of conventional nuclear fuel processing plants are uranium and plutonium, and any other recovered material is considered to be a by-product. Some by-products have been recovered from past nuclear fuel processing operations, either as a normal mode of operation or by special campaigns. Routing recovery over an extended period has been limited to neptunium, but extended campaigns were used at Hanford to recover strontium for radioisotope thermoelectric generators. Krypton is recovered at Idaho Chemical Processing Plant on a campaign basis, and isotope separation of krypton is done at Oak Ridge National Laboratory. Past campaigns at Hanford PUREX have recovered cesium, promethium, amercium, cerium, and technetium. Past by-product recovery efforts were usually severely constrained by the status of flowsheet development and availability of existing facilities at the time decisions wee made to recover the by-products. Additional processes were developed to accommodate other unit operations and in response to changes in waste management objectives or user requirements. Now an impressive variety of recovery technology is available for most potential by-products, with varying degrees of demonstration under conditions which satisfy today's environmental protection and waste management constraints

  10. New developments in the analysis and measurement of thicknesses by excitation of the fluorescent lines by means of {beta} particles; Nouveaux developpements de l'analyse et de la mesure des epaisseurs par excitation des raies de fluorescence au moyen de particules {beta}

    Energy Technology Data Exchange (ETDEWEB)

    Martinelli, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires; Seibel, G [Institut de Recherches de la Siderurgie, 78 - Saint-Germain-en-Laye (France)

    1960-07-01

    The process for analysing and measuring the thickness of deposits by {beta}-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [French] Le procede d'analyse et de mesure des epaisseurs de depots par fluorescence {beta}-X que nous avons precedemment decrit a fait l'objet de nouveaux developpements. L'emploi de sources de prometheum-147 et de krypton-85 permet de reduire le bruit de fond que l'on observe avec le strontium-90. Nous dormons les resultats obtenus pour diverses mesures d'epaisseurs de depots metalliques et la mesure en continu du calcium et du fer dans les carottes de minerais. Nous decrivons les essais effectues en vue d'analyser le rayonnement X au moyen d'un cristal. (auteur)

  11. Astronomy Matters for Chemistry Teachers

    Science.gov (United States)

    Huebner, Jay S.; Vergenz, Robert A.; Smith, Terry L.

    1996-11-01

    The purpose of this paper is to encourage more chemistry teachers to become familiar with some of the basic ideas described in typical introductory astronomy courses (1 - 9), including those about the origin of elements and forms of matter. These ideas would enrich chemistry courses and help resolve some basic misconceptions that are expressed in many introductory texts (10 - 16) and journal articles for chemistry teachers (17, 18). These misconceptions are typified by statements such as "we can classify all substances as either elements or compounds," and "nature has provided 92 elements out of which all matter is composed." If students accept these misconceptions, they could be deprived of (i) an appreciation of the history of elements and knowing that the elemental composition of the universe continues to evolve, (ii) knowing that of the first 92 elements in the periodic table, technetium and promethium do not occur naturally on Earth, and (iii) understanding that there are forms of matter other than elements and compounds. This paper briefly explores these ideas.

  12. Return to the... past

    International Nuclear Information System (INIS)

    Ammerich, M.

    2009-01-01

    This article goes back over the incidents occurring during the summer 2008, that is to say the uranium release from the Socatri facility in the South of France. From this point, the purpose studies the radiological situation of the Camargue seashore; the levels of radioactivity are from 3 to thirty times higher than these ones expected in this area, but the natural radioactivity with thorium and uranium coming from the granitic massifs erosion brings an important part. It is difficult to make the part between human and natural contribution to ambient radioactivity. However, it appears that to limit the water consumption until the time of dilution played its part was absolutely necessary. Then, because it is question of water, the drinking water is tackled. Some mineral waters go over the recommended limits of doses. A last return to the past with the radioactive watches, but this time with actual watches that activate detection. Two watches contained promethium 147, 147 Pm is a beta emitter but also gamma emitter. To end, in Ireland and Great Britain, some fire detectors contain americium 241. In fact, this article constitutes a summary of different abnormalities around radioactivity. (N.C.)

  13. Predikce rizika vzniku přívalové povodně s využitím dat meteorologických radarů

    Czech Academy of Sciences Publication Activity Database

    Rapant, P.; Kolejka, Jaromír; Inspektor, T.

    2016-01-01

    Roč. 50, č. 3 (2016), s. 162-166 ISSN 0044-4863 R&D Projects: GA MV VG20132015106 Institutional support: RVO:68145535 Keywords : flash floods * prediction * weather radar * early warning Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://147.213.211.222/sites/ default /files/2016_3_162_166_Rapant_a_kol.pdf

  14. 24 CFR 891.685 - Prohibited relationships.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Prohibited relationships. 891.685... and Individuals-Section 162 Assistance § 891.685 Prohibited relationships. The requirements for prohibited relationships for 202/162 projects are provided in § 891.130. ...

  15. Educational and Nonprofit Institutions Receiving Prime Contract Awards for RDT&E (Research, Development, Test and Evaluation), Fiscal Year 1981.

    Science.gov (United States)

    1981-01-01

    SCIENCE & TECH 162 - UNITED KINGDOM MINISTRY OF DEFENCE 2,670 - UN KINGDOM 162 UN KINGDOM 2,670 INSTITUT FUER ATMOSPHAERISCHE 25 - UNIVERSITE RENE ... DESCARTES 10 - GERMANY 25 FRANCE 10 INVERESK RESEARCH INTERNATIONAL 106 - 8,602 UN KINGDOM 106 ISRAEL INSTITUTE OF TECHNOLOGY 55 - ISRAEL 55 KEELE UNIVERSITY

  16. Stemcell Information: SKIP000949 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available SKIP000949 ... dermal fibroblast 表皮繊維芽細胞 Diseased SP16.2 SP16.2 ... パーキンソン病 G20 Parkinson...s of genetic and sporadic Parkinson's disease. Sanchez-Danes A, Richaud-Patin Y, Carballo-Carbajal I, Jimene

  17. Binding affinities of insulin analogues substituted at the position B26 with glutamine, asparagine and aspartic acid

    Czech Academy of Sciences Publication Activity Database

    Antolíková, Emília; Žáková, Lenka; Jiráček, Jiří

    2010-01-01

    Roč. 16, S1 (2010), s. 162-162 ISSN 1075-2617. [European Peptide Symposium /31./. 05.09.2010-09.09.2010, Copenhagen] Institutional research plan: CEZ:AV0Z40550506 Keywords : insulin * insulin analogues * diabetes Subject RIV: CC - Organic Chemistry

  18. The effect of a lignan complex isolated from flaxseed on inflammation markers in healthy postmenopausal women

    DEFF Research Database (Denmark)

    Hallund, Jesper; Tetens, Inge; Bugel, S.

    2008-01-01

    the lignan complex intervention period compared with 0.80 (0.62, 1.62) mg/L at baseline and 1.10 (0.72, 1.62) mg/L after placebo. No significant differences in interleukin-6, tumor necrosis factor-alpha, soluble intracellular adhesion motecule-1, soluble vascular cell adhesion molecule-1, and monocyte...

  19. X-Ray Photoionized Bubble in the Wind of Vela X-1 Pulsar Supergiant Companion

    Czech Academy of Sciences Publication Activity Database

    Krtička, J.; Kubát, Jiří; Skalický, J.

    2012-01-01

    Roč. 757, č. 2 (2012), 162/1-162/6 ISSN 0004-637X R&D Projects: GA ČR GA205/08/0003 Institutional support: RVO:67985815 Keywords : hydrodynamics * radiative transfer * early-type stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.733, year: 2012

  20. Zhodnocení vlivu těžby a úpravy měděných a kobaltových rud na životní prostředí v zambijské části Copperbeltu: výsledky projektu rozvojové spolupráce

    Czech Academy of Sciences Publication Activity Database

    Kříbek, B.; Majer, V.; Bezuško, Petr; Pašava, J.; Adamovič, Jiří; Nyambe, I.; Liyungu, K.; Chibesakunda, F.

    2007-01-01

    Roč. 2006, - (2007), s. 160-162 ISSN 0514-8057 R&D Projects: GA AV ČR KSK3012103 Institutional research plan: CEZ:AV0Z30130516; CEZ:AV0Z30860518 Keywords : contamination * heavy metals * soils Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2006/2006-str.160-162.pdf

  1. 77 FR 74546 - Posting of Pamphlet Provided for in the International Marriage Broker Regulation Act

    Science.gov (United States)

    2012-12-14

    ... Marriage Broker Regulation Act ACTION: Notice of posting of pamphlet provided for in section 833(a) of the International Marriage Broker Regulation Act, Title D of Public Law 109-162. SUMMARY: Section 833(a) of the International Marriage Broker Regulation Act, Title D of Public Law 109-162, provided that the Secretary of...

  2. 46 CFR 38.10-15 - Safety relief valves-TB/ALL.

    Science.gov (United States)

    2010-10-01

    .... plus the maximum flow rate of the cargo filling pipes or, (2) The vapors generated under fire exposure..., constructed and flow tested for capacity in conformance with subpart 162.017 or 162.018 of subchapter Q... excessive external pressure. (f) Void spaces between the primary and secondary barriers of nonpressure...

  3. Advanced Processing for Biomedical Informatics (APBI)

    Science.gov (United States)

    2009-10-01

    pothetical gene CG018 CG018 90634 1.62E-06 4.16E-05 7.21 4.81 -5.3 203881_s_at dystrophin (muscular dystrophy , Duchenne and Becker types) DMD 1756 1.93E-06...fundus dystrophy , pseudoinflammatory) TIMP3 7078 1.62E-06 4.16E-05 10.96 8.63 -5.0 1563466_at myosin, light chain kinase MYLK 4638 1.62E-06 4.16E-05

  4. Demonstration Results of Phytoremediation of Explosives-Contaminated Groundwater Using Constructed Wetlands At The Milan Army Ammunition Plant, Milan, Tennessee Volume IV.

    Science.gov (United States)

    1998-12-01

    Bromoform Bromomethane iso -Butanol n-Butanol 2-Butanone n-Butylbenzene sec-Butylbenzene tert-Butylbenzene Carbon disulfide Carbon tetrachloride...1994 TABLE 10 DIRECT INJECTION .ANALYSIS OF NEW OIL AT 5 PPM Compound Acetone Benzene n-Butanol*,** iso -Butanol*,** Carbon tetrachlorid Carbon...Sediment 48.0 48.0 2977 16.2 Autocl.sediment 53.7 2.7 15.7 11.0 83.1 12755 16.2 Gravel 53.1 6.8 7.8 8.7 76.4 8583 16.2 Autocl.gravel 11.0 7.7

  5. Intra-group separation of rare earths using new organic phosphorus ligands

    International Nuclear Information System (INIS)

    Hadic, Sanela

    2017-01-01

    Rare earth elements (REE) have unique magnetic, photophysical, and chemical properties and they are therefore used in numerous high-technology applications. However, to this day, the isolation of pure rare earths from primary and secondary raw materials is very challenging. In this work, the hydrometallurgical separation of neighboring rare earths (e.g., praseodymium/ neodymium) was optimized with novel selective extraction agents. The separation of rare earths (yttrium and all lanthanides except promethium) was investigated with fourteen new organophosphorus compounds. Oxygen-bearing phosphinic acids yielded good separation results for heavy rare earths (dysprosium to lutetium). For light rare earths (lanthanum to neodymium), particularly high separation factors were realized with synergistic systems containing an aromatic dithiophosphinic acid and a co-extractant, such as tris (2-ethylhexyl) phosphate (TEHP). Optimization studies of the latter extraction system revealed an extremely high separation factor (SF) of 4.21 between praseodymium and neodymium. Another focus of this work was to understand the extraction mechanism. With the aid of nuclear magnetic resonance spectroscopy ("1H-NMR) and time-resolved laser fluorescence spectroscopy (TRLFS), the complex stoichiometry of promising extraction systems was examined. Studies revealed a dependency between the selectivity for rare earths and the coordination number of the formed complexes. In addition, temperature-dependent extraction experiments were performed and thermodynamic data (ΔG, ΔH, and ΔS) determined. These data provided additional information about the origin of selectivity for neighboring rare earths. With regard to the industrial capability of the investigated extraction systems, the chemical durability of ligands was studied under process-relevant conditions. Qualitative and quantitative analytical methods (e.g., GC-MS) were used in long-term experiments to determine the ligand degradation. After

  6. Intra-group separation of rare earths using new organic phosphorus ligands; Intragruppentrennung Seltener Erden mittels neuer phosphororganischer Liganden

    Energy Technology Data Exchange (ETDEWEB)

    Hadic, Sanela

    2017-10-01

    Rare earth elements (REE) have unique magnetic, photophysical, and chemical properties and they are therefore used in numerous high-technology applications. However, to this day, the isolation of pure rare earths from primary and secondary raw materials is very challenging. In this work, the hydrometallurgical separation of neighboring rare earths (e.g., praseodymium/ neodymium) was optimized with novel selective extraction agents. The separation of rare earths (yttrium and all lanthanides except promethium) was investigated with fourteen new organophosphorus compounds. Oxygen-bearing phosphinic acids yielded good separation results for heavy rare earths (dysprosium to lutetium). For light rare earths (lanthanum to neodymium), particularly high separation factors were realized with synergistic systems containing an aromatic dithiophosphinic acid and a co-extractant, such as tris (2-ethylhexyl) phosphate (TEHP). Optimization studies of the latter extraction system revealed an extremely high separation factor (SF) of 4.21 between praseodymium and neodymium. Another focus of this work was to understand the extraction mechanism. With the aid of nuclear magnetic resonance spectroscopy ({sup 1}H-NMR) and time-resolved laser fluorescence spectroscopy (TRLFS), the complex stoichiometry of promising extraction systems was examined. Studies revealed a dependency between the selectivity for rare earths and the coordination number of the formed complexes. In addition, temperature-dependent extraction experiments were performed and thermodynamic data (ΔG, ΔH, and ΔS) determined. These data provided additional information about the origin of selectivity for neighboring rare earths. With regard to the industrial capability of the investigated extraction systems, the chemical durability of ligands was studied under process-relevant conditions. Qualitative and quantitative analytical methods (e.g., GC-MS) were used in long-term experiments to determine the ligand degradation

  7. China's rare-earth industry

    Science.gov (United States)

    Tse, Pui-Kwan

    2011-01-01

    Introduction China's dominant position as the producer of over 95 percent of the world output of rare-earth minerals and rapid increases in the consumption of rare earths owing to the emergence of new clean-energy and defense-related technologies, combined with China's decisions to restrict exports of rare earths, have resulted in heightened concerns about the future availability of rare earths. As a result, industrial countries such as Japan, the United States, and countries of the European Union face tighter supplies and higher prices for rare earths. This paper briefly reviews China's rare-earth production, consumption, and reserves and the important policies and regulations regarding the production and trade of rare earths, including recently announced export quotas. The 15 lanthanide elements-lanthanum, cerium, praseodymium, neodymium, promethium, samarium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium (atomic numbers 57-71)-were originally known as the rare earths from their occurrence in oxides mixtures. Recently, some researchers have included two other elements-scandium and yttrium-in their discussion of rare earths. Yttrium (atomic number 39), which lies above lanthanum in transition group III of the periodic table and has a similar 3+ ion with a noble gas core, has both atomic and ionic radii similar in size to those of terbium and dysprosium and is generally found in nature with lanthanides. Scandium (atomic number 21) has a smaller ionic radius than yttrium and the lanthanides, and its chemical behavior is intermediate between that of aluminum and the lanthanides. It is found in nature with the lanthanides and yttrium. Rare earths are used widely in high-technology and clean-energy products because they impart special properties of magnetism, luminescence, and strength. Rare earths are also used in weapon systems to obtain the same properties.

  8. Radiation sources and process

    International Nuclear Information System (INIS)

    Honious, H.B.; Janzow, E.F.; Malson, H.A.; Moyer, S.E.

    1980-01-01

    The invention relates to radiation sources comprising a substrate having an electrically-conductive non-radioactive metal surface, a layer of a metal radioactive isotope of the scandium group, which in addition to scandium, yttrium, lanthanum and actinium, includes all the lanthanide and actinide series of elements, with the actinide series usually being preferred because of the nature of the radioactive isotopes therein, particularly americium-241, curium-244, plutonium-238, californium-252 and promethium-147, and a non-radioactive bonding metal codeposited on the surface by electroplating the isotope and bonding metal from an electrolytic solution, the isotope being present in the layer in minor amount as compared to the bonding metal, and with or without a non-radioactive protective metal coating covering the isotoype and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating. The invention also relates to a process for providing radiation sources comprising codepositing a layer of the metal radioactive isotope with a non-radioactive bonding metal from an electrolytic solution in which the isotope is present in minor molar amount as compared to the bonding metal such that the codeposited layer contains a minor molar amount of the isotope compared to the bonding metal by electroplating on an electrically-conductive non-radioactive metal surface of a cathode substrate, and with or without depositing a nonradioactive protective metal coating over the isotope and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating

  9. New processing techniques for radioisotopes at Oak Ridge National Laboratory; Production de radioisotopes: nouvelles techniques employees au Laboratoire national d'Oak Ridge; Novye tekhnologicheskie metody polucheniya radioizotopov v Okridzhskoj natsional'noj laboratorii; Nuevos metodos de preparacion de radioisotopos aplicados en el Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Butler, T A; Lamb, E; Rupp, A F [Oak Ridge National Laboratory, Oak Ridge, TN (United States)

    1962-01-15

    Recent developments in the radioisotope production programme at Oak Ridge National Laboratory include new processes and process improvements for the production of cerium-144, promethium-147, technetium-99 and strontium-90. Cerium-144 has been produced in kc quantities in a test run. A product recovery of more than 98% with a product purity of more than 99% was attained. The cerium was further processed to obtain pure cerium-144 oxide powder having an activity concentration of 235 c/g. The powder was pressed into pellets which were sintered to a dense ceramic form. Promethium-147 has been produced in kc quantities by a combination of precipitation and ion exchange techniques. A solvent extraction system for separating promethium- 147 from other rare earths has been tested on a tracer scale. Gram quantities of technetium-99 have been recovered from fission-product waste streams by a combination of precipitation and solvent extraction processes. The technetium product was produced with a chemical purity of more than 99.9% and radiochemical purity of more than 99.99%. The separation and purification of strontium-90 from gross contaminants by a continuous solvent-extraction flowsheet has been demonstrated on a tracer scale. Product quality of 98% strontium has been achieved from feed containing 95% inert calcium contaminant. The strontium-90 is further processed to form strontium titanate ceramic elements. (author) [French] Les faits recents a noter dans le programme de production de radioisotopes du laboratoire national d'Oak Ridge sont l'introduction de nouvelles methodes et l'amelioration des techniques existantes pour la production du eerium-144, du prometheum-147, du technetium-99 et du strontium-90. Le cerium-144 a ete obtenu en quantites de l'ordre du kilocurie, lors d'une experience. On a obtenu un taux d'extraction de plus de 98% et un produit d'une purete superieure a 99%. On a ensuite traite le cerium pour avoir de l'oxyde de cerium-144 pur en poudre ayant

  10. An Enumeration of Research to Determine the Optimal Design and Use of Army Flight Training Simulators

    Science.gov (United States)

    1987-10-01

    abstract display format (Williams & Flexman, 1949; Flexman, Matheny, & Brown, 1950; Flexman, Townsend, and Ornstein, 1954; Creelman , 1959; Hennessy, Lintern...Resources Laboratory. Creelman , J. A. (1959). Evaluation of approach training procedures. Pensacola, FL: US. Naval School of Aviation Medicine, 162

  11. Newall Glacier Snow Pit and Ice Core, 1987 to 1989, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — Snow pit and ice core data from the Newall Glacier (location - 162 30' East, 77 35' South) were collected during 1987 and 1988. These include information on...

  12. Creative Artist: A Journal of Theatre and Media Studies - Vol 9, No 1 ...

    African Journals Online (AJOL)

    A semiotic reading of costumes in Nigerian video films: African bride as a paradigm · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mary Nkechi Okadigwe, 139-162 ...

  13. Specific Statistics of Czech Legislation

    Czech Academy of Sciences Publication Activity Database

    Novák, František

    2015-01-01

    Roč. 5, č. 3 (2015), s. 162-183 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : legislation * quantitative description of legislation * structure and development of the legislation in the CR Subject RIV: AG - Legal Sciences

  14. Madyastha, Prof. Kattigari Madhava

    Indian Academy of Sciences (India)

    Pune), FNASc. Date of birth: 22 July 1937. Specialization: Bio-organic Chemistry, Xenobiotics Metabolism, Plant Biochemistry and Microbial Transformations Address: 162, Srikrishna, 5th Main, 4th Cross, NGEF Layout, Sanjay Nagar, Bengaluru ...

  15. 39 The Validity of Herzberg's Dual-Factor Theory on Job Satisfaction ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... But Herzberg's two-factor theory (also called motivation /Hygiene theory) has been ... democratic process and more importantly, it attracts the right calibre of politicians into ..... Journal of Applied Psychology pp.162. Francis ...

  16. Blahopřání Alexandře Navrátilové

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    2016-01-01

    Roč. 33, č. 2 (2016), s. 159-162 ISSN 1211-8117 Institutional support: RVO:68378076 Keywords : congratulations * ethnology * anniversary * personality Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Delinquent directors under the Companies Act 71 of 2008: Gihwala ...

    African Journals Online (AJOL)

    Potchefstroom Electronic Law Journal/Potchefstroomse Elektroniese Regsblad ... 71 of 2008 infringed the constitutional right to dignity, the right to choose a trade, ... determining whether the offences set out in section 162(5) of the Companies ...

  18. 76 FR 3135 - Pesticide Experimental Use Permit; Receipt of Extension Application;

    Science.gov (United States)

    2011-01-19

    ... (vector PHP 17662) necessary for their production in Event DAS-59122-7 corn, 3) [MIR162] Bacillus... language for your requested changes. iv. Describe any assumptions and provide any technical information and...

  19. Gene : CBRC-EEUR-01-0576 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID

  20. A cross-national study of direct and indirect effects of cyberbullying on cybergrooming victimization via self-esteem

    NARCIS (Netherlands)

    Wachs, Sebastian; Jiskrova, Gabriela Ksinan; Vazsonyi, Alexander T.; Wolf, Karsten D.; Junger, Marianne

    2016-01-01

    The present study reports frequency rates of cybergrooming, profiled characteristics of cybergrooming perpetrators, and examine direct and indirect associations between cyberbullying victimization, self-esteem, and cybergrooming victimization. The study sample included 2,162 adolescents between 11

  1. Neoalloionema indicum n.sp. (Nematoda: Alloinematidae), a new alloionematid from India

    Czech Academy of Sciences Publication Activity Database

    Nermuť, Jiří; Půža, Vladimír; Mráček, Zdeněk

    2016-01-01

    Roč. 18, č. 8 (2016), s. 949-962 ISSN 1388-5545 Institutional support: RVO:60077344 Keywords : Alloionema appendiculatum * Neoalloionema tricaudatum * molecular Subject RIV: EG - Zoology Impact factor: 1.162, year: 2016

  2. 75 FR 26301 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-11

    ... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  3. 75 FR 25895 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of a Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  4. 76 FR 38220 - Submission for OMB Review

    Science.gov (United States)

    2011-06-29

    ...: Self-Monitoring Questionnaire for Insurance and Finance Projects. Form Number: OPIC 162. Frequency of...); individuals. Standard Industrial Classification Codes: All. Description of Affected Public: U.S. companies or...

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 162 ... ... on sodium nitrite‑induced cerebellar cortex toxicity in adult Wistar rats, Abstract .... Vol 14, No 2 (2015), Histopathological effects of acetaminophen ... extracts of Garcinia Kola on acetaminophen-Induced liver injury in ...

  6. Changes in soil microbial community functionality and structure in a metal-polluted site: Theeffect of digestate and fly ash applications

    Czech Academy of Sciences Publication Activity Database

    Garcia-Sanchez, M.; Garcia-Romera, I.; Cajthaml, Tomáš; Tlustoš, P.; Száková, J.

    2015-01-01

    Roč. 162, OCT 2015 (2015), s. 63-73 ISSN 0301-4797 Institutional support: RVO:61388971 Keywords : Amendments * Communities structure * Physiological diversity Subject RIV: EE - Microbiology, Virology Impact factor: 3.131, year: 2015

  7. Mathematical expression of discharge capacity of compound open ...

    Indian Academy of Sciences (India)

    value of 0.162 has the best performance, among the various analytical methods tested. ...... Iran, who introduced us to the advanced concept of compound open channel ... management in practice: Better water management for development ...

  8. 76 FR 23834 - Notice of Proposed Reinstatement of Terminated Oil and Gas Leases NDM 98791, NDM 98792, NDM 98793...

    Science.gov (United States)

    2011-04-28

    ... royalties of $10 per acre and 16\\2/3\\ percent. The lessee paid the $500 administration fee for the... terms and conditions of the leases; The increased rental of $10 per acre; The increased royalty of 16\\2...

  9. National Status and Trends: Bioeffects Program: Magnitude and Extent of Sediment Toxicity of South Carolina and Georgia

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surficial sediment samples were collected from 162 locations within five estuaries - Charleston Harbor, Winyah Bay, Leadenwah Creek, Savannah River, and St. Simons...

  10. Search Results | Page 52 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 511 - 520 of 9602 ... ... Economics (172) Apply Economics filter · WOMEN'S RIGHTS (162) ... Ecohealth Emerging Infectious Diseases Research Initiative (2) Apply ... Perspectives on public sector antiretroviral access ... Journal articles ... Trade liberalisation and economic growth : empirical evidence on Bangladesh.

  11. Sonochemical precipitation of amorphous uranium phosphates from trialkyl phosphate solutions and their thermal conversion to UP2O7

    Czech Academy of Sciences Publication Activity Database

    Doroshenko, I.; Žurková, J.; Moravec, Z.; Bezdička, Petr; Pinkas, J.

    2015-01-01

    Roč. 26, SEP (2015), s. 157-162 ISSN 1350-4177 Institutional support: RVO:61388980 Keywords : Uranium * Phosphates * Sonochemistry * Nuclear waste * Trimethyl phosphate * Triethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 4.556, year: 2015

  12. 02 Fubara WEB 03.pmd

    African Journals Online (AJOL)

    Owner

    Emecheta's Double Yoke and Ama Ata Aidoo's Changes reveals that these inimitable feminist writers, .... From this knowledge springs a decision equipped with forceful ... aware of is desolation” (162) and her personality drastically changes.

  13. Kodanike õigusi ahistava riigijuhtimisorganite ja ametiisikute õigusvastase tegevuse peale kohtusse kaebamise korrast

    Index Scriptorium Estoniae

    1989-01-01

    NSV Liidu seaduse "Kodanike õigusi ahistava riigijuhtimisorganite ja ametiisikute õigusvastase tegevuse peale kohtusse kaebamise korrast" kehtestamise kohta vt. Eesti Jurist 1990 nr. 2, lk. 162-163 (NSVL RKÜT 1989 nr. 22 art. 417)

  14. Search Results | Page 10 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 91 - 100 of 162 ... Hungry Cities Initiative: Informality, Inclusive Growth, and Food Security in Cities of the Global South. As urban populations grow in developing countries, promoting inclusive growth that ensures food security for all is critical. Project.

  15. Palmyra Atoll, 2006 Sea Surface Temperature and Meteorological Enhanced Mooring - CRED CREWS Near Real Time and Historical Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Site Palmyra Atoll, (5.88467, -162.10281 ) ARGOS ID 307-001. Time series data from this mooring provide high resolution sea surface temperature and conductivity, and...

  16. The Royal Summer Palace, Ferdinand I and Anne

    Czech Academy of Sciences Publication Activity Database

    Dobalová, Sylva

    2015-01-01

    Roč. 7, č. 2 (2015), s. 162-175 ISSN 1804-1132 Institutional support: RVO:68378033 Keywords : Anne of Jagiello * Prague Castle * Ferdinand I of Habsburg * olive tree * dynasticism Subject RIV: AL - Art, Architecture, Cultural Heritage

  17. Star Wars als bron van religie : Voorbeeld van een lessenserie in bovenbouw havo/vwo

    NARCIS (Netherlands)

    Ouden, den J.A.J.; Davidsen, M.A.

    2017-01-01

    Voorbeeldlessen bij Davidsen, Markus Altena & Jeannette den Ouden (2016), “Star Wars in het religieonderwijs: Religiekunde in de lespraktijk I”, Narthex: tijdschrift voor levensbeschouwing en educatie 16(2), 64-71.

  18. Antigravitace a její projevy, aneb platí zákon zachování energie? Část 2

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2013-01-01

    Roč. 63, č. 3 (2013), s. 162-167 ISSN 0009-0700 Institutional support: RVO:67985840 Keywords : gravitational aberration * solar system * dark energy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Karyotypes of the mammals of Turkey and neighbouring regions: a review

    Czech Academy of Sciences Publication Activity Database

    Arslan, A.; Zima, Jan

    2014-01-01

    Roč. 63, č. 1 (2014), s. 1-62 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : chromosomes * banding pattern * Balkan * Caucasus * Middle East * species * taxonomy Subject RIV: EG - Zoology Impact factor: 0.724, year: 2014

  20. Miroslav Fiedler, 1926–2015

    Czech Academy of Sciences Publication Activity Database

    Rákosník, Jiří; Rozložník, Miroslav; Strakoš, Zdeněk

    2016-01-01

    Roč. 497, 15 May (2016), s. 162-166 ISSN 0024-3795 Keywords : Miroslav Fiedler * linear algebra * geometry Impact factor: 0.973, year: 2016 http://www.sciencedirect.com/science/article/pii/S0024379516001178

  1. Prioritization of balanced scorecard measurement indicators as a process management approach via fuzzy AHP: Case study in automotive industry

    Czech Academy of Sciences Publication Activity Database

    Senvar, M. O.; Vayvay, O.; Kurt, E.; Hloch, Sergej

    2014-01-01

    Roč. 21, č. 1 (2014), s. 155-162 ISSN 1330-3651 Institutional support: RVO:68145535 Keywords : balanced scorecard * fuzzy * automotive Subject RIV: JQ - Machines ; Tools Impact factor: 0.579, year: 2014

  2. Mechanismen und Strategien der\

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana; Kreisslová, S.; Pavlásek, Michal

    2017-01-01

    Roč. 58 (2017), s. 158-162. ISBN 978-3-8309-2501-9. ISSN 0075-2738 Institutional support: RVO:68378076 Keywords : family memory * generation * Germany * Czech Republic * Croatia OBOR OECD: Antropology, ethnology

  3. Palmyra Island Monthly Oxygen Isotope Data (delta 18O) for 1886-1998

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Palmyra Island Monthly Coral Oxygen Isotope Data. 112-yr, monthly-resolved coral record from Palmyra Island (5 deg 52 min N, 162 deg 8 min W). The coral was drilled...

  4. Disease: H01612 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 5 update on diagnosis, risk-stratification and management. ... JOURNAL ... Am J Hematol 90:162-73 (2015) DOI:10.... TITLE ... Pharmacological management of essential thrombocythemia. ... JOURNAL ... Expert Opin Pharmacother 14:

  5. South African Journal of Animal Science - Vol 15, No 4 (1985)

    African Journals Online (AJOL)

    Supplementary winter feeding and reproduction of beef heifers on Dohne sourveld · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JA Erasmus, HH Barnard, 162-164 ...

  6. 2017-2018 Hospitality Expense Reports for Jean Lebel, President

    International Development Research Centre (IDRC) Digital Library (Canada)

    SD

    Page 1. Description: Lunch - Discuss programming with rural development research partners. Date: 2017-04-12. Attendees: 7 (IDRC 3). Location: Ottawa. Total: $162.00. Comments: 2017-2018 Hospitality Expense Reports for Jean Lebel, President.

  7. Transparent conducting film: Effect of mechanical stretching

    Indian Academy of Sciences (India)

    We describe in this paper a transparent conducting film (TCF). ... conducting carbon nanotube film which is crack-resistant for solar cell applications. ... CA 90095, USA; Nanocomp Technologies, Inc, 162 Pembroke Road, Concord, NH 03301 ...

  8. Winter banding of passerines on the Alaska Peninsula

    Data.gov (United States)

    Department of the Interior — Between February 1969 and May 1973, bait traps were operated during winter at Cold Bay (55° 12' N, 162° 43' W), Alaska, headquarters of the Izembek National Wildlife...

  9. Polymorphism patterns in two tightly linked developmental genes, Idgf1 and Idgf3, of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Žurovcová, Martina; Ayala, F. J.

    2002-01-01

    Roč. 162, - (2002), s. 177-188 ISSN 0016-6731 Institutional research plan: CEZ:AV0Z5007907 Keywords : Drosophila melanogaster Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.483, year: 2002

  10. Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production

    Czech Academy of Sciences Publication Activity Database

    Kamarainen, J.; Knoop, H.; Stanford, N.; Guerrero, F.; Akhtar, M. K.; Aro, E. M.; Steuer, Ralf; Jones, P. R.

    2012-01-01

    Roč. 162, č. 1 (2012), s. 67-74 ISSN 0168-1656 Institutional support: RVO:67179843 Keywords : Cyanobacteria * Hydrocarbon * Fuel * Toxicity * Stoichiometric potential Subject RIV: EH - Ecology, Behaviour Impact factor: 3.183, year: 2012

  11. Foreign investment, corporate ownership, and development: are firms in emerging markets catching up to the world standard?

    Czech Academy of Sciences Publication Activity Database

    Sabirianova Peter, K.; Švejnar, Jan; Terrell, D.

    -, č. 72 (2005), s. 1-62 ISSN N Institutional research plan: CEZ:AV0Z70850503 Keywords : foreign direct investment * economic development * productivity * efficiency Subject RIV: AH - Economics http://hdl.handle.net/2027.42/61179

  12. Adolescents beliefs of the role of self concept and government policy ...

    African Journals Online (AJOL)

    -entry of adolescents into school in Abia State. Four continuing education and two skills acquisition schools were randomly selected for the study. One hundred and sixty two (162) adolescents who re-enrolled in these schools participated in ...

  13. Search Results | Page 8 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 71 - 80 of 162 ... ... access to knowledge contained in learning resources and materials. ... health information systems in Africa using open technologies. ... divides, and highlight the need for comparative analysis of the use and impact of.

  14. Digestive alpha-amylases of the flour moth Ephestia kuehniella - adaptation to alkaline environment and plant inhibitors

    Czech Academy of Sciences Publication Activity Database

    Pytelková, Jana; Hubert, J.; Lepšík, Martin; Šobotník, Jan; Šindelka, Radek; Křížková, I.; Horn, Martin; Mareš, Michael

    2009-01-01

    Roč. 276, Suppl. 1 (2009), s. 162-162 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA ČR GP525/09/P600; GA AV ČR IAA400550617 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50520701 Keywords : Ephestia kuehniella * alpha amylase * alkaline adaptation Subject RIV: CE - Biochemistry

  15. Numerical analysis of a hypersonic turbulent and laminar flow using a commercial CFD solver

    OpenAIRE

    Pajčin Miroslav P.; Simonović Aleksandar M.; Ivanov Toni D.; Komarov Dragan M.; Stupar Slobodan N.

    2017-01-01

    Computational fluid dynamics computations for two hypersonic flow cases using the commercial ANSYS FLUENT 16.2 CFD software were done. In this paper, an internal and external hypersonic flow cases were considered and analysis of the hypersonic flow using different turbulence viscosity models available in ANSYS FLUENT 16.2 as well as the laminar viscosity model were done. The obtained results were after compared and commented upon. [Project of the Serbian Ministry of Education, Science and Tec...

  16. Job satisfaction among secondary school teachers in Tanzania : the case of Njombe district

    OpenAIRE

    Ngimbudzi, Fredy Wilson

    2009-01-01

    The purpose of this study is to examine the factors that are associated with teachers‟ job satisfaction. A study sample of 162 (N=162) teachers was surveyed. The descriptive statistics techniques revealed that teachers are satisfied with aspects under the following dimensions: social benefits, meaningfulness of the job and support from administration. Conversely, the teachers indicated they are least satisfied with the aspects under the job characteristics dimension. Additionally, the inde...

  17. Behavior of alloying elements during anodizing of Mg-Cu and Mg-W alloys in a fluoride/glycerol electrolyte

    Czech Academy of Sciences Publication Activity Database

    Palagonia, M. S.; Němcová, A.; Kuběna, Ivo; Šmíd, Miroslav; Gao, S.; Liu, H.; Zhong, X. L.; Haigh, S. J.; Santamaria, M.; Di Quarto, F.; Habazaki, H.; Skeldon, P.; Thomson, G.

    2015-01-01

    Roč. 162, č. 9 (2015), C487-C494 ISSN 0013-4651 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : alloying element * anodizing * ion beam analysis * magnesium * TEM Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 3.014, year: 2015 http://jes.ecsdl.org/content/162/9/C487.full

  18. Efficacy of Natural Polymer Derivatives on Soil Physical Properties and Erosion on an Experimental Loess Hillslope.

    Science.gov (United States)

    Liu, Jun'e; Wang, Zhanli; Li, Yuanyuan

    2017-12-22

    Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162) on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m²), three rainfall intensities (1, 1.5 and 2 mm/min) and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S.

  19. Efficacy of Natural Polymer Derivatives on Soil Physical Properties and Erosion on an Experimental Loess Hillslope

    Directory of Open Access Journals (Sweden)

    Jun’e Liu

    2017-12-01

    Full Text Available Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162 on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m2, three rainfall intensities (1, 1.5 and 2 mm/min and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S.

  20. Efficacy of Natural Polymer Derivatives on Soil Physical Properties and Erosion on an Experimental Loess Hillslope

    Science.gov (United States)

    Liu, Jun’e; Wang, Zhanli; Li, Yuanyuan

    2017-01-01

    Raindrops disperse large soil aggregates into smaller particles, which can clog soil pores, cause soil crusting, reduce rainfall infiltration and increase soil loss. It was found that natural polymer derivatives were effective in improving soil physical properties and decreasing soil erosion on an experimental loess hillslope. This study investigated the effect of new natural polymer derivatives (Jag S and Jag C162) on soil properties, rainfall infiltration and sediment yield at four rates of sprayed polymers (0, 1, 3 and 5 g/m2), three rainfall intensities (1, 1.5 and 2 mm/min) and a slope gradient of 15° with a silt loam soil through simulated rain. The results showed that both Jag S and Jag C162 significantly increased the shear strength and improved the aggregates composition of the soil surface. The water-stable soil aggregates >0.25 mm increased from 9% to 50% with increasing rates of Jag S and Jag C162. Jag S and Jag C162 also effectively increased rainfall infiltration and final infiltration rate, and reduced erosion compared to controls without natural polymer derivatives added. However, higher rates of Jag S produced lower infiltration rates. Although both Jag S and Jag C162 effectively influenced soil physical properties and erosion, the effect of Jag C162 was more significant than that of Jag S. PMID:29271899

  1. Thermodynamic study on the complexation of Trivalent actinide and lanthanide cation by N-donor ligands in homogeneous conditions; Etude thermodynamique de la complexation des ions actinide (III) et lanthanide (III) par des ligands polyazotes en milieu homogene

    Energy Technology Data Exchange (ETDEWEB)

    Miguirditchian, M

    2004-07-01

    Polydentate N-donor ligands, alone or combined with a synergic acid, may selectively extract minor actinides(III) from lanthanide(III) ions, allowing to develop separation processes of long-live radioelements. The aim of the researches carried out during this thesis was to better understand the chemical mechanisms of the complexation of f-elements by Adptz, a tridentate N-donor ligand, in homogeneous conditions. A thermodynamic approach was retained in order to estimate, from an energetic point of view, the influence of the different contributions to the reaction, and to acquire a complete set of thermodynamic data on this reaction. First, the influence of the nature of the cation on the thermodynamics was considered. The stability constants of the 1/1 complexes were systematically determined by UV-visible spectrophotometry for every lanthanide ion (except promethium) and for yttrium in a mixed solvent methanol/water in volume proportions 75/25%. The thermodynamic parameters ({delta}H{sup 0} {delta}{sup S}) of complexation were estimated by the van't Hoff method and by micro-calorimetry. The trends of the variations across the lanthanide series are compared with similar studies. The same methods were applied to the study of three actinide(III) cations: plutonium, americium and curium. The comparison of these values with those obtained for the lanthanides highlights the increase of stability of these complexes by a factor of 20 in favor of the actinide cations. This gap is explained by a more exothermic reaction and is associated, in the data interpretation, to a higher covalency of the actinide(III)-nitrogen bond. Then, the influence of the change of solvent composition on the thermodynamic of complexation was studied. The thermodynamic parameters of the complexation of europium(III) by Adptz were determined for several fractions of methanol. The stability of the complex formed increases with the percentage of methanol in the mixed solvent, owing to an

  2. No cases of perioperative allergy to local anaesthetics in the Danish Anaesthesia Allergy Centre

    DEFF Research Database (Denmark)

    Kvisselgaard, A D; Krøigaard, M; Mosbech, H F

    2017-01-01

    BACKGROUND: Local anaesthetics (LA) are often suspected as possible causes of allergic reactions. The Danish Anaesthesia Allergy Centre (DAAC) is the national reference centre for investigation of perioperative allergic reactions. The purpose of this study was to investigate the incidence of Ig......E-mediated immediate type perioperative allergic reactions to LA. METHODS: In the period 2004-2013, a total of 409 patients (244 women/165 men; median age 49 years, range 1-86 years) were investigated in DAAC on suspicion of allergy associated with anaesthesia and surgery. A total of 162 (40%) patients were exposed...... were carried out on 162 patients (89 women/73 men; mean age 49 years, range 2-85 years) with the following drugs: Lidocaine n = 80 (49%), bupivacaine n = 82 (51%), ropivacaine n = 31 (19%) and mepivacaine n = 10 (6%). All 162 patients had negative subcutaneous provocation for all tested LA (95% CI: 0...

  3. Casting core for a cooling arrangement for a gas turbine component

    Science.gov (United States)

    Lee, Ching-Pang; Heneveld, Benjamin E

    2015-01-20

    A ceramic casting core, including: a plurality of rows (162, 166, 168) of gaps (164), each gap (164) defining an airfoil shape; interstitial core material (172) that defines and separates adjacent gaps (164) in each row (162, 166, 168); and connecting core material (178) that connects adjacent rows (170, 174, 176) of interstitial core material (172). Ends of interstitial core material (172) in one row (170, 174, 176) align with ends of interstitial core material (172) in an adjacent row (170, 174, 176) to form a plurality of continuous and serpentine shaped structures each including interstitial core material (172) from at least two adjacent rows (170, 174, 176) and connecting core material (178).

  4. Contaminação por chumbo na serrapilheira do Parque Nacional da Tijuca - RJ

    OpenAIRE

    Oliveira, Rogério Ribeiro de; Lacerda, Luiz Drude de

    1987-01-01

    As matas formadoras do Parque Nacional da Tijuca, Rio de Janeiro, apresentaram em sua serrapilheira um teor médio de chumbo de 16,2 µg/g ao longo de um ano. A entrada do metal no sistema via queda da serrapilheira foi de 140 g/ha/ano. O Pb atinge o sistema florestal pela deposição atmosférica, e tem origem provável na queima de combustíveis (gasolina e petróleo)Analysis of the litter layer of the Tijuca National Park rainforest revealed an average annual lead concentration of 16.2 µg/g. Rate ...

  5. John Rodgers WBAS, Honolulu, Hawaii. Revised Uniform Summary of Surface Weather Observations (RUSSWO), Parts A-F

    Science.gov (United States)

    1967-12-05

    4-’Al 0 SM40- INMAN’ - -a-. STATION O: STATION AME: LATITUDE: LONGITUDi. S N MONO STATION HISTORY AND WIND EQUIPMENT INFORMATION DATE OF fYEOF...75) 75,l a 60oo 15.5 16.2 16.2 16.5 16.5 76.5 16.5 16.5 16.5 165 76.o 1os5 16o5 16.5 16.5 16. C $ 000 71 a& Aw -jai -1 k. i, LC6 -m" go, to, IkeA

  6. Numerical analysis of a hypersonic turbulent and laminar flow using a commercial CFD solver

    Directory of Open Access Journals (Sweden)

    Pajčin Miroslav P.

    2017-01-01

    Full Text Available Computational fluid dynamics computations for two hypersonic flow cases using the commercial ANSYS FLUENT 16.2 CFD software were done. In this paper, an internal and external hypersonic flow cases were considered and analysis of the hypersonic flow using different turbulence viscosity models available in ANSYS FLUENT 16.2 as well as the laminar viscosity model were done. The obtained results were after compared and commented upon. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. 35035

  7. Measuring capital market efficiency: long-term memory, fractal dimension and approximate entropy

    Czech Academy of Sciences Publication Activity Database

    Krištoufek, Ladislav; Vošvrda, Miloslav

    2014-01-01

    Roč. 87, č. 7 (2014), "162-1"-"162-9" ISSN 1434-6028 R&D Projects: GA ČR(CZ) GBP402/12/G097 EU Projects: European Commission(XE) FP7/2007-2013 Program:FP7 Institutional support: RVO:67985556 Keywords : Statistical and Nonlinear Physics * fractal dimension * stock market efficiency Subject RIV: AH - Economics Impact factor: 1.345, year: 2014 http://library.utia.cas.cz/separaty/2014/E/kristoufek-0431151.pdf

  8. Download this PDF file

    African Journals Online (AJOL)

    a tu N = 30 oca a una ve. Ref. 12. 164.3. 102.8". 182.28. 160.8. 99 1". 162.09. 104.1. 154.7. 104.0. 120.3. 128.3. 16.0. 161.I. 116.0. 128.3. 165.0. 103.5. 183.0. 161.9. 99.7. 162.7. 104.8. 155.3. 104.5. 120.8. 129.1. 116.6. 161.4. 116.6. 129.1. Chemical shifts with the same subscript are interchangeable. The 'H NMR spectrum ...

  9. China Report, Agriculture, No. 255, 1981 Agricultural Yearbook.

    Science.gov (United States)

    1983-04-28

    Prevention and Control of Forest Insect Pests 161 Animal Husbandry Industry 162 The Rise of China’s Beef Cattle Industry 162 Quickening Development...and Research on Sichuan’s Peng [2766] Ducks Enterprise 477 Research on Gosling Plague 477 Medicinal Techniques for Livestock Castration 478 Forestry...inventory rate percent 62.1 62.3 2. Beef cattle sold or 10,000 slaughtered for per- head 332.2 296.8 35.4 11.9 sonal use during year 3. Mutton sheep

  10. Freqüência de anticorpos neutralizantes contra o vesiculovirus Piry, em doadores de sangue de Uberaba , Minas Gerais, Brasil Frequency of neutralizing antibodies to the vesiculovirus Piry, in blood donors from Uberaba, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    José Tavares-Neto

    1990-06-01

    Full Text Available Na cidade de Uberaba, Estado de Minas Gerais, dos 162 doadores de sangue, 13 (8,0% apresentaram anticorpos neutralizantes contra o vesiculovirus Piry. Nos indivíduos positivos foi estatisticamente mais freqüente o relato de residência anterior em área rural (p Thirteen (8.0% of 162 blood donors from Uberaba - Minas Gerais State showed neutralizing antibodies to the vesiculovirus Piry. The previous residence in rural area (p < 0.0001 and in the cities of the São Paulo State (p < 0.05 were statistically more frequent in the Piry seropositive group.

  11. Dragonflies (odonata) of Rufiji district, Tanzania with new records for ...

    African Journals Online (AJOL)

    The habitat specialists found in Ngumburuni forest and in the forests of the Kichi and Kiwengoma Hills are globally endangered species and require special attention with regard to conservation. Keywords: dragonflies; coastal forest; Tanzania; conservationJournal of East African Natural History Vol. 95 (2) 2006: pp. 139-162 ...

  12. Soil Profile Characteristics of a 25-Year-Old Windrowed Loblolly Pine Plantation in Louisiana

    Science.gov (United States)

    William B. Patterson; John C. Adams; Spencer E. Loe; R. Jarod Patterson

    2002-01-01

    Windrowing site preparation, the raking and piling of long rows of logging debris, has been reported to displace surface soil, redistribute nutrients, and reduce volume growth of southern pine forests. Many of these studies have reported short-term results, and there are few long-term studies of the effects of windrowing on soil properties and pine growth. A 16.2...

  13. Low incidence of children with acute epiglottis after introduction of vaccination

    DEFF Research Database (Denmark)

    Hermansen, Mette Nagstrup; Schmidt, Jesper Hvass; Krug, Andrea H

    2014-01-01

    for HIB. The average length of hospitalization was 6.1 days. The average stay in the intensive care unit was 1.2 days for patients who were not intubated and 4.0 days for patients who were intubated or tracheotomised. Six patients (16.2%) were intubated. One patient (2.7%) was directly tracheotomised...

  14. Nikkaji Dictionary: デヒドロノルケタミン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term デヒドロノルケタミン 名詞 一般 * * * * デヒドロノルケタミン ... Nikkaji J1.942.162G 200906034696900980 C CA06 UNKNOWN_1 デヒドロノルケタミン

  15. Search Results | Page 13 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 121 - 130 of 162 ... New South Africa–Canada Research Chairs Initiative ... the need to build local capacities in emergency and postemergency situations. ... has integrated information and communication technologies (ICTs) to help improve service delivery, build local capacity for primary health care, and address the ...

  16. Why are journals from less-developed countries constrained to low ...

    African Journals Online (AJOL)

    Citation Reports, the top dermatology journal in the 2013. IF ranks is Journal of Investigative Dermatology, which has an IF of 6.37. By contrast, the IFs of the top four journals in the oncology category range from 23.89 to 162.50. But are journals classified by the Web of Science in one category homogeneous enough with ...

  17. Proceedings of the IRPA regional symposium on radiation protection in neighbouring countries of Central Europe

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-12-31

    At the Symposium, a total of 169 papers were presented at six sessions: 1. General aspects of radiation protection; 2. Natural radiation exposure; 3. Radiation protection at workplaces; 4. Environmental aspects of radiation protection; 5. Instrumentation of methods; 6. Non-ionizing radiation protection. Of the papers, 162 were input to INIS. (A.K.)

  18. Proceedings of the IRPA regional symposium on radiation protection in neighbouring countries of Central Europe

    International Nuclear Information System (INIS)

    1998-01-01

    At the Symposium, a total of 169 papers were presented at six sessions: 1. General aspects of radiation protection; 2. Natural radiation exposure; 3. Radiation protection at workplaces; 4. Environmental aspects of radiation protection; 5. Instrumentation of methods; 6. Non-ionizing radiation protection. Of the papers, 162 were input to INIS. (A.K.)

  19. Disease: H01682 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available tting of euvolemia, without evidence of renal disease or thyroxine or cortisol deficiency. Treatment options...rmone: current and future management options. ... JOURNAL ... Eur J Endocrinol 162 Suppl 1:S13-8 (2010) DOI:10.1

  20. NJP VOLUME 41 NO 3

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-02-11

    Feb 11, 2014 ... compared with non-infants (21.1% [8/38] vs. 8.6%. [14/162]; odds .... formulated in tablet form, does not achieve optimal blood levels,2 and .... school children in Enugu. Orient J. Med 2005 ... Nelson Textbook of. Paediatrics ...

  1. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    shyn

    2015-08-05

    Aug 5, 2015 ... of oils of Shea nut, Sesamum indicum, Cucurbita pepo,. Cucumis melo ..... 1.62 mgKOH/g) which is lower than that of olive oil 17. mgKOH/g (Oyedele ..... Oyedele AO (2002). The Skin Tolerance of Shea Fat Employed as.

  2. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides...

  3. Download this PDF file

    African Journals Online (AJOL)

    Annals of Pediatric Surgery 2016, 12:162–163 ... management of different medical and surgical pediatric conditions. ... After induction of anesthesia, a size 12F NGT was inserted ... tube is the main risk factor predisposing to self-tube knotting ...

  4. Measurement of formation cross sections of short-lived nuclei by 14 MeV neutron. Nd, Sm, Dy, Er, Yb

    Energy Technology Data Exchange (ETDEWEB)

    Sakane, H.; Yamamoto, H.; Kawade, K. [Nagoya Univ. (Japan). School of Engineering; Iida, T.; Takahashi, A.

    1997-03-01

    Eight neutron activation cross sections producing the nuclei with half-lives between 3 min and 24 min were obtained at the energy range between 13.4 and 14.9 MeV by activation method. The cross sections were {sup 146}Nd(n,p){sup 146}Pr, {sup 154}Sm(n,{alpha}){sup 151}Nd, {sup 162}Dy(n,p){sup 162}Tb, {sup 163}Dy(n,np){sup 162}Tb, {sup 163}Dy(n,p){sup 163}Tb, {sup 164}Dy(n,p){sup 164}Tb, {sup 170}Er(n,{alpha}){sup 167}Dy, {sup 174}Yb(n,p){sup 170}Tm. {sup 163}Dy(n,np){sup 162}Tb (T{sub 1/2}=7.7 min) was obtained for the first time. Present results are compared with previous results and the evaluated data of JENDL-3 and ENDF/B-VI. There are some discrepancies between present results and the JENDL-3 and ENDF/B-VI. (author)

  5. Psychometrical Assessment and Item Analysis of the General Health Questionnaire in Victims of Terrorism

    Science.gov (United States)

    Delgado-Gomez, David; Lopez-Castroman, Jorge; de Leon-Martinez, Victoria; Baca-Garcia, Enrique; Cabanas-Arrate, Maria Luisa; Sanchez-Gonzalez, Antonio; Aguado, David

    2013-01-01

    There is a need to assess the psychiatric morbidity that appears as a consequence of terrorist attacks. The General Health Questionnaire (GHQ) has been used to this end, but its psychometric properties have never been evaluated in a population affected by terrorism. A sample of 891 participants included 162 direct victims of terrorist attacks and…

  6. Cox's regression model for dynamics of grouped unemployment data

    Czech Academy of Sciences Publication Activity Database

    Volf, Petr

    2003-01-01

    Roč. 10, č. 19 (2003), s. 151-162 ISSN 1212-074X R&D Projects: GA ČR GA402/01/0539 Institutional research plan: CEZ:AV0Z1075907 Keywords : mathematical statistics * survival analysis * Cox's model Subject RIV: BB - Applied Statistics, Operational Research

  7. Growth and development of vimba bream (Vimba vimba) larvae in relation to feeding duration with live and/or dry starter feed

    Czech Academy of Sciences Publication Activity Database

    Hamáčková, J.; Prokeš, Miroslav; Kozák, P.; Peňáz, Milan; Stanny, L. A.; Policar, T.; Baruš, Vlastimil

    2009-01-01

    Roč. 287, 1-2 (2009), s. 158-162 ISSN 0044-8486 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : ASTA starter feed * Artemia salina * Total length * Weight * Level of ontogeny Subject RIV: GL - Fishing Impact factor: 1.925, year: 2009

  8. High-activity MgO-supported CoMo Hydrodesulfurization Catalysts Prepared by Non-aqueous Impregnation

    Czech Academy of Sciences Publication Activity Database

    Kaluža, Luděk; Gulková, Daniela; Vít, Zdeněk; Zdražil, Miroslav

    2015-01-01

    Roč. 162, JAN 2015 (2015), s. 430-436 ISSN 0926-3373 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : CoMo/MgO * benzothiophene hydrodesulfurization * non-aqueous impregnation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 8.328, year: 2015

  9. Prevalence and correlates of psychiatric morbidity among caregivers ...

    African Journals Online (AJOL)

    sacrifices made by family caregivers, the adverse ... disorders seen among caregivers, depression was reported to be one of ... In a study of over 2000 families caring for a family member .... deficit/hyperactivity disorder [16.2%]; autism [6.8%]; mood disorder ... with a spectrum of disorders including depression, age-related.

  10. Entwicklungen im tschechischen internationalen Gesellschaftsrecht

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika

    2007-01-01

    Roč. 27, č. 2 (2007), s. 162-167 ISSN 0720-6585 R&D Projects: GA ČR GA407/05/2008 Institutional research plan: CEZ:AV0Z70680506 Keywords : private international law * international company law * conflict of law s Subject RIV: AG - Legal Sciences

  11. BDML Metadata: 385 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available fused reconstruction of early Drosophila wild-type development D. melanogaster nuclear positions drosophila...bic.riken.jp/data/bdml/DM_PJK/drosophila_fused.bdml0.18.zip http://ssbd.qbic.riken.jp/search/10180487-6e38-4234-ba5b-b162e0bf0d39/ ...

  12. Perceived Parenting Styles, Personality Traits and Sleep Patterns in Adolescents

    Science.gov (United States)

    Brand, Serge; Hatzinger, Martin; Beck, Johannes; Holsboer-Trachsler, Edith

    2009-01-01

    The present study examined the role of parenting styles with respect to adolescents' sleep patterns and symptoms of depression and anxiety. A total of 246 adolescents (age: 17.58 [plus or minus] 1.62) took part in the study. They completed several questionnaires with regard to parenting styles and to symptoms of anxiety and depression;…

  13. Alzheimer's disease biomarkers detection in human samples by efficient capturing through porous magnetic microspheres and labelling with electrocatalytic gold nanoparticles

    Czech Academy of Sciences Publication Activity Database

    de la Escosura-Muniz, A.; Plichta, Zdeněk; Horák, Daniel; Merkoci, A.

    2015-01-01

    Roč. 67, 15 May (2015), s. 162-169 ISSN 0956-5663 R&D Projects: GA MŠk 7E12053 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : porous magnetic microspheres * gold nanoparticles * electrochemical immunoassay Subject RIV: CD - Macromolecular Chemistry Impact factor: 7.476, year: 2015

  14. The application of high-resolution IR spectroscopy and isotope labeling for detailed investigation of TiO2/gas interface reactions

    Czech Academy of Sciences Publication Activity Database

    Civiš, Svatopluk; Ferus, Martin; Zukalová, Markéta; Kavan, Ladislav; Zelinger, Zdeněk

    2013-01-01

    Roč. 36, č. 1 (2013), s. 159-162 ISSN 0925-3467 R&D Projects: GA ČR GAP208/10/2302; GA ČR GA13-07724S Institutional support: RVO:61388955 Keywords : isotope exchange * titania * isotope labeling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.075, year: 2013

  15. Assessing the State of Procurement Knowledge Production: Implications for the Federal Government

    Science.gov (United States)

    2011-12-01

    Entrepreneurship Theory and Practice, 28(2), 145–162. doi:10.1046/j.1540- 6520.2003.00036.x. Ausink, J. A., Baldwin, L. H. & Paul, C. (2004). Air Force...communication in franchise structures. Journal of Business Research, 36(1), 67–79. Gonzalez-Padron, T., Hult, G. T. M., & Calantone, R. (2008). Exploiting

  16. Steinernema beitlechemi n. sp., a new entomopathogenic nematode (Nematoda: Steinernematidae) from South Africa

    Czech Academy of Sciences Publication Activity Database

    Çimen, H.; Půža, Vladimír; Nermuť, Jiří; Hatting, J.; Ramakuwela, T.; Faktorová, Lucie; Hazir, S.

    2016-01-01

    Roč. 18, č. 4 (2016), s. 439-453 ISSN 1388-5545 R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : description * molecular * morphology Subject RIV: EG - Zoology Impact factor: 1.162, year: 2016

  17. South African Journal of Higher Education - Vol 21, No 1 (2007)

    African Journals Online (AJOL)

    Burnout and engagement in university students: A psychometric analysis of the MBI-SS and UWES-S · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Mostert, J Pienaar, C Gauche, LTB Jackson, 147-162 ...

  18. Clarice Lispector: narración, cuerpo y deseo

    Directory of Open Access Journals (Sweden)

    Roberto Vincenti

    2009-01-01

    Full Text Available http://dx.doi.org/10.5007/2176-8522.2009n9p162 La narrativa de Clarice Lispector despliega nuevas representaciones del cuerpo y el deseo femenino ante una modernidad amenazante. Su prosa revela en las grietas de lo cotidiano el instante fugaz que redime la existencia.

  19. 24 CFR 891.745 - Replacement reserve.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Replacement reserve. 891.745... and Individuals-Section 162 Assistance § 891.745 Replacement reserve. The general requirements for the replacement reserve are provided in § 891.605. For projects funded under §§ 891.655 through 891.790, the...

  20. Nudasporestrobus ningxicus gen. et sp. nov., a novel sigillarian megasporangiate cone from the Bashkirian (Early Pennsylvanian) of Ningxia, northwestern China

    Czech Academy of Sciences Publication Activity Database

    Feng, Z.; Wang, J.; Bek, Jiří

    2008-01-01

    Roč. 149, 3-4 (2008), s. 150-162 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z30130516 Keywords : lycopsids * in situ spores * sigillarian * monosporangiate Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.325, year: 2008