Project W-320, 241-C-106 sluicing: Civil/structural calculations. Volume 6
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-24
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The purpose of this calculation is to conservatively estimate the weight of equipment and structures being added over Tank 241-C-106 as a result of Project W-320 and combine these weights with the estimated weights of existing structures and equipment as calculated in Attachment 1. The combined weights will be compared to the allowable live load limit to provide a preliminary assessment of loading conditions above Tank 241-C-106.
Project W-320, 241-C-106 sluicing supporting documentation bibliography
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the listing of documentation used to develop, or in support of Project W-320, readily retrievable. All documents are sorted by document number and list the document type. Tank 241-C-106 has been included on the High Heat Load Watch List
Project W-320, 241-C-106 sluicing piping calculations, Volume 7
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
The object of this report is to calculate the hydraulic forces imposed at the sluicer nozzle. This is required by Project W-320 waste retrieval for tank 241-C-106. The method of analysis used is Bernoulli's momentum equation for stead flow
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
International Nuclear Information System (INIS)
Hays, C.B.
1998-01-01
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
Energy Technology Data Exchange (ETDEWEB)
Hays, C.B.
1998-01-28
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Project management plan for Project W-320, Tank 241-C-106 sluicing. Revision 2
Energy Technology Data Exchange (ETDEWEB)
Phillips, D.R.
1994-07-01
A major mission of the US Department of Energy (DOE) is the permanent disposal of Hanford Site defense wastes by utilizing safe, environmentally acceptable, and cost-effective disposal methods that meet applicable regulations. The Tank Waste Remediation System (TWRS) Program was established at the Hanford Site to manage and control activities specific to the remediation of safety watch list tanks, including high-heat-producing tanks, and for the ultimate characterization, retrieval, pretreatment, and disposal of the low- and high-level fractions of the tank waste. Project W-320, Tank 241-C-106 Sluicing, provides the methodology, equipment, utilities, and facilities necessary for retrieving the high-heat waste from single-shell tank (SST) 24-C-106. Project W-320 is a fiscal year (FY) 1993 expense-funded major project, and has a design life of 2 years. Retrieval of the waste in tank 241-C-106 will be accomplished through mobilization of the sludge into a pumpable slurry using past-practice sluicing. The waste is then transferred directly to a double-shell tank for interim storage, subsequent pretreatment, and eventual disposal. A detailed description of the management organization and responsibilities of all participants is presented in this document.
Project management plan for Project W-320, Tank 241-C-106 sluicing. Revision 2
International Nuclear Information System (INIS)
Phillips, D.R.
1994-07-01
A major mission of the US Department of Energy (DOE) is the permanent disposal of Hanford Site defense wastes by utilizing safe, environmentally acceptable, and cost-effective disposal methods that meet applicable regulations. The Tank Waste Remediation System (TWRS) Program was established at the Hanford Site to manage and control activities specific to the remediation of safety watch list tanks, including high-heat-producing tanks, and for the ultimate characterization, retrieval, pretreatment, and disposal of the low- and high-level fractions of the tank waste. Project W-320, Tank 241-C-106 Sluicing, provides the methodology, equipment, utilities, and facilities necessary for retrieving the high-heat waste from single-shell tank (SST) 24-C-106. Project W-320 is a fiscal year (FY) 1993 expense-funded major project, and has a design life of 2 years. Retrieval of the waste in tank 241-C-106 will be accomplished through mobilization of the sludge into a pumpable slurry using past-practice sluicing. The waste is then transferred directly to a double-shell tank for interim storage, subsequent pretreatment, and eventual disposal. A detailed description of the management organization and responsibilities of all participants is presented in this document
Project W-320, 241-C-106 sluicing HVAC calculations, Volume 1
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the FDNW calculations for Project W-320, readily retrievable. The report contains the following calculations: Exhaust airflow sizing for Tank 241-C-106; Equipment sizing and selection recirculation fan; Sizing high efficiency mist eliminator; Sizing electric heating coil; Equipment sizing and selection of recirculation condenser; Chiller skid system sizing and selection; High efficiency metal filter shielding input and flushing frequency; and Exhaust skid stack sizing and fan sizing
Project W-320, 241-C-106 sluicing HVAC calculations, Volume 1
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-08-07
This supporting document has been prepared to make the FDNW calculations for Project W-320, readily retrievable. The report contains the following calculations: Exhaust airflow sizing for Tank 241-C-106; Equipment sizing and selection recirculation fan; Sizing high efficiency mist eliminator; Sizing electric heating coil; Equipment sizing and selection of recirculation condenser; Chiller skid system sizing and selection; High efficiency metal filter shielding input and flushing frequency; and Exhaust skid stack sizing and fan sizing.
Preliminary safety evaluation for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1994-01-01
This document presents the Preliminary Safety Evaluation for Project W-320, Tank 241-C-106 Waste Retrieval Sluicing System (WRSS). The US DOE has been mandated to develop plans for response to safety issues associated with the waste storage tanks at the Hanford Site, and to report the progress of implementing those plans to Congress. The objectives of Project W-230 are to design, fabricate, develop, test, and operate a new retrieval system capable of removing a minimum of about 75% of the high-heat waste contained in C-106. It is anticipated that sluicing operations can remove enough waste to reduce the remaining radiogenic heat load to levels low enough to resolve the high-heat safety issue as well as allow closure of the tank safety issue
Permitting plan for project W-320 tank 241-C-106 waste retrieval sluicing system (WRSS)
International Nuclear Information System (INIS)
Symons, G.A.
1997-01-01
This document describes the permitting plan for Project W-320, Tank 241-C-106 Waste Retrieval Sluicing System (WRSS). A comprehensive review of environmental regulations have indicated that several environmental reviews [e.g. National Environmental Policy Act (NEPA), State Environmental Policy Act (SEPA)], permits, and approvals are required prior to construction or operation of the facility. The environmental reviews, permits and approvals, as well the regulatory authority, potentially applicable to the Tank 241-C-106 WRSS include the following: for NEPA - U.S. Department of Energy-Headquarters: Action Description Memorandum, Environmental Assessment, Categorical Exclusion, and Environmental Impact Statement; and for SEPA - State of Washington Department of Ecology (Ecology) Determination of Nonsignificance, Mitigated Determination of Nonsignificance, Determination of Significance, and SEPA Environmental Checklist
Project W-320, 241-C-106 sluicing: Construction specification W-320-C2
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits
Project W-320, 241-C-106 sluicing: Construction specification W-320-C2
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-20
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits.
Project W-320, 241-C-106 sluicing: Construction specification W-320-C6
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits
Project W-320, 241-C-106 sluicing: Construction specification W-320-C5
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits
Project W-320, 241-C-106 sluicing: Construction specification W-320-C7
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits
Project W-320, 241-C-106 sluicing: Construction specification W-320-C5
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-20
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits.
Project W-320, 241-C-106 sluicing: Construction specification W-320-C7
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-20
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits.
Project W-320, 241-C-106 sluicing: Construction specification W-320-C6
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-20
This supporting document has been prepared to make the construction specifications for Project W-320 readily available. Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits.
Project W-320, 241-C-106 sluicing HVAC calculations, Volume 4
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-30
This supporting document has been prepared to make the FDNW calculations for Project W-320, readily retrievable. The report contains the following design calculations: Cooling load in pump pit 241-AY-102; Pressure relief seal loop design; Process building piping stress analysis; Exhaust skid maximum allowable leakage criteria; and Recirculation heat, N509 duct requirements.
Project W-320, 241-C-106 sluicing: Construction specification W-320-C1
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
Project W-320, Waste Retrieval Sluicing System (WRSS), specification is for procurement, fabrication and installation of equipment at the C Tank Farm, including Operator Station and some equipment just outside the C Tank Farm fence, necessary to support the sluicing operation. Work consists of furnishing labor, equipment, and materials to provide the means to procure materials and equipment, fabricate items, excavate and place concrete, and install equipment, piping, wiring, and structures in accordance with the Contract Documents. Major work elements include: Excavation for process and fire protection piping, electrical conduit trenches, and foundations for small structures; Placement of concrete cover blocks, foundations, and equipment pads; Procurement and installation of double walled piping, electrical conduit, fire and raw water piping, chilled water piping, and electrical cable; Procurement and installation of above-ground ventilation system piping between the (HVAC) Process building and Tank C-106; Core drill existing concrete; Furnish and installation of electrical distribution equipment; Installation of the concrete foundation, and assembly installation of the two Seismic Shutdown Systems with Environmental Enclosures; Fabrication and installation of in-pit pipe jumpers, including related valves, instruments and wiring; and Installation of a vertical submersible pump, horizontal booster pump, and winch assembly into tank access riser pits
Project W-320, 241-C-106 sluicing electrical calculations, Volume 2
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the FDNW calculations for Project W-320, readily retrievable. These calculations are required: To determine the power requirements needed to power electrical heat tracing segments contained within three manufactured insulated tubing assemblies; To verify thermal adequacy of tubing assembly selection by others; To size the heat tracing feeder and branch circuit conductors and conduits; To size protective circuit breaker and fuses; and To accomplish thermal design for two electrical heat tracing segments: One at C-106 tank riser 7 (CCTV) and one at the exhaust hatchway (condensate drain). Contents include: C-Farm electrical heat tracing; Cable ampacity, lighting, conduit fill and voltage drop; and Control circuit sizing and voltage drop analysis for the seismic shutdown system
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1996-01-01
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1996-01-25
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.
Tank 241C106 structural evaluation in support of Project W320 retrieval
International Nuclear Information System (INIS)
Wallace, D.A.
1994-10-01
Tank 241C106 structural evaluation to support W320. It includes ACI code input and riser evaluations. This work uses the in situ conditions established by Julyk to develop a three-dimensional model of the tank. Non-axisymmetric loads associated with retrieval activities are applied to assess their influence on structural integrity of the tank. This study addresses loads associated with normal opertion and credible accident scenarios. The concrete structure of tank C106 is classified as a Safety Class I non-reactor structure in accordance with the definition given in SDC 4.1. The operating specifications document (OSD) limits applicable to tank C106 include a live load limit for the C Tank Farm of 100 tons. For the technical basis of this limit, the OSD references SD-RE-TI-012, which qualifies the 100 tons as that distributed over a 10-ft radius. However, there is no specification for a uniform live load that would accompany natural hazard phenomena such as snow or ash fall. There is no specific guidance on crane loads applied at the surface outside the tank radius. Further, there is no record of any seismic analysis of tanks in the C Tank Farm. The analysis documented in this report evaluates nonseismic conditions that include a concentrated live load, a uniform live load, and a crane load, in addition to the in situ loads. The model documented in this study also is used to provide the nonseismic stress contribution to the seismic load combination documented by Wallace
W-320 Project thermal modeling
Energy Technology Data Exchange (ETDEWEB)
Sathyanarayana, K., Fluor Daniel Hanford
1997-03-18
This report summarizes the results of thermal analysis performed to provide a technical basis in support of Project W-320 to retrieve by sluicing the sludge in Tank 241-C-106 and to transfer into Tank 241-AY-102. Prior theraml evaluations in support of Project W-320 safety analysis assumed the availability of 2000 to 3000 CFM, as provided by Tank Farm Operations, for tank floor cooling channels from the secondary ventilation system. As this flow availability has no technical basis, a detailed Tank 241-AY-102 secondary ventilation and floor coating channel flow model was developed and analysis was performed. The results of the analysis show that only about 150 cfm flow is in floor cooLing channels. Tank 241-AY-102 thermal evaluation was performed to determine the necessary cooling flow for floor cooling channels using W-030 primary ventilation system for different quantities of Tank 241-C-106 sludge transfer into Tank 241-AY-102. These sludge transfers meet different options for the project along with minimum required modification of the ventilation system. Also the results of analysis for the amount of sludge transfer using the current system is presented. The effect of sludge fluffing factor, heat generation rate and its distribution between supernatant and sludge in Tank 241-AY-102 on the amount of sludge transfer from Tank 241-C-106 were evaluated and the results are discussed. Also transient thermal analysis was performed to estimate the time to reach the steady state. For a 2 feet sludge transfer, about 3 months time will be requirad to reach steady state. Therefore, for the purpose of process control, a detailed transient thermal analysis using GOTH Computer Code will be required to determine transient response of the sludge in Tank 241-AY-102. Process control considerations are also discussed to eliminate the potential for a steam bump during retrieval and storage in Tanks 241-C-106 and 241-AY-102 respectively.
Tank 241-C-106 in-tank imaging system operational test report
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106
Project W-320, 241-C-106 sluicing: Piping calculations. Volume 8
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The objective of this calculation is to perform the hydraulic analysis on the slurry line and the supernate line for W-320. This calculation will use the As-Built conditions of the slurry line and the supernate line. Booster Pump Curves vs System Curves shall be generated for the supernate system and the slurry system
Project W-320, 241-C-106 sluicing, master calculation list
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the Master Calculation List readily retrievable. The list gives the status of the calculation (as-built, not used, applied, etc.), the calculation title, its originator, comments, and report number under which it was issued. Tank 241-C-106 has been included on the High Heat Load Watch List
Project W-320, 241-C-106 sluicing: Piping calculations. Volume 4
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The objective of this calculation is to perform the structural analysis of the Pipe Supports designed for Slurry and Supernate transfer pipe lines in order to meet the requirements of applicable ASME codes. The pipe support design loads are obtained from the piping stress calculations W320-27-I-4 and W320-27-I-5. These loads are the total summation of the gravity, pressure, thermal and seismic loads. Since standard typical designs are used for each type of pipe support such as Y-Stop, Guide and Anchors, each type of support is evaluated for the maximum loads to which this type of supports are subjected. These loads are obtained from the AutoPipe analysis and used to check the structural adequacy of these supports
Project W-320, 241-C-106 sluicing: Piping calculations. Volume 4
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-24
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The objective of this calculation is to perform the structural analysis of the Pipe Supports designed for Slurry and Supernate transfer pipe lines in order to meet the requirements of applicable ASME codes. The pipe support design loads are obtained from the piping stress calculations W320-27-I-4 and W320-27-I-5. These loads are the total summation of the gravity, pressure, thermal and seismic loads. Since standard typical designs are used for each type of pipe support such as Y-Stop, Guide and Anchors, each type of support is evaluated for the maximum loads to which this type of supports are subjected. These loads are obtained from the AutoPipe analysis and used to check the structural adequacy of these supports.
Project W-320, tank 241-C-106 sluicing acceptance for beneficial use
International Nuclear Information System (INIS)
BAILEY, J.W.
1999-01-01
The purpose of this document is to identify the Project W-320 Chiller Documentation required to be turned over from the Projects Organization to Tank Farm Operations as part of the acceptance of the new equipment for beneficial use
Acceptance test report for the Tank 241-C-106 in-tank imaging system
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing
Project W-320 thermal hydraulic model benchmarking and baselining
International Nuclear Information System (INIS)
Sathyanarayana, K.
1998-01-01
Project W-320 will be retrieving waste from Tank 241-C-106 and transferring the waste to Tank 241-AY-102. Waste in both tanks must be maintained below applicable thermal limits during and following the waste transfer. Thermal hydraulic process control models will be used for process control of the thermal limits. This report documents the process control models and presents a benchmarking of the models with data from Tanks 241-C-106 and 241-AY-102. Revision 1 of this report will provide a baselining of the models in preparation for the initiation of sluicing
Tank 241-C-106 waste retrieval sluicing system process control plan
Energy Technology Data Exchange (ETDEWEB)
Carothers, K.G.
1998-07-25
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.
Tank 241-C-106 waste retrieval sluicing system process control plan
International Nuclear Information System (INIS)
Carothers, K.G.
1998-01-01
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity
W-320 Department of Health documentation
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
The purpose of this document is to gather information required to show that Project W-320 is in compliance with Washington State Department of Health requirements as specified in Radioactive Air Emissions Notice of Construction Project W-320, Tank 241-C-106 Sluicing, DOE/RL-95-45. Specifically, that W-320 is in compliance with ASME N509-1989 (Nuclear Power Plant Air-Cleaning Units and Components) and ASME N5 10-1989 (Testing of Nuclear Air Treatment Systems) for the 296-C-006 exhaust system
W-320 Department of Health documentation
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-08-07
The purpose of this document is to gather information required to show that Project W-320 is in compliance with Washington State Department of Health requirements as specified in Radioactive Air Emissions Notice of Construction Project W-320, Tank 241-C-106 Sluicing, DOE/RL-95-45. Specifically, that W-320 is in compliance with ASME N509-1989 (Nuclear Power Plant Air-Cleaning Units and Components) and ASME N5 10-1989 (Testing of Nuclear Air Treatment Systems) for the 296-C-006 exhaust system.
Project W-340 tank 241-C-106 manipulator system closeout summary
International Nuclear Information System (INIS)
McDaniel, L.B.
1995-02-01
This document summarizes the work that was ongoing when Project W-340 was put on hold. Project W-340: Tank 241-C-106 Manipulator Retrieval System, was a candidate FY98 Major System Acquisition. The project was to develop, procure and deploy a Long Reach Manipulator (LRM) waste retrieval system to provide an alternate method to completing the in-tank demonstration of Single Shell Tank waste retrieval technology. The need for enhanced capabilities derives from (1) the inability of the baseline technology to retrieve certain hard waste forms; (2) uncertainty in the quantity of leakage which will be allowed. Numerous studies over the years have identified an arm architecture as a promising retrieval technology to overcome these concerns. The W340 project was intended to further develop and demonstrate this alternative, as part of selecting the best approach for all tanks. Prior to completing the effort, it was determined that an LRM system was too architecture specific and was envisioned to be too expensive for a one time demonstration of retrieval technology. At the time the work was stopped, an effort was underway to broaden the project scope to allow alternatives to an arm-based system
Safety equipment list for 241-C-106 waste retrieval, Project W-320: Revision 1
International Nuclear Information System (INIS)
Conner, J.C.
1994-01-01
The goals of the C-106 sluicing operation are: (1) to stabilize the tank by reducing the heat load in the tank to less than 42 MJ/hr (40,000 Btu/hour), and (2) to initiate demonstration of single-shell tank (SST) retrieval technology. The purpose of this supporting document (SD) is as follows: (1) to provide safety classifications for items (systems, structures, equipment, components, or parts) for the waste retrieval sluicing system (WRSS), and (2) to document and methodology used to develop safety classifications. Appropriate references are made with regard to use of existing systems, structures, equipments, components, and parts for C-106 single-shell transfer tank located in the C Tank Farm, and 241-AY-102 (AY-102) double shell receiver tanks (DST) located in the Aging Waste Facility (AWF). The Waste Retrieval Sluicing System consists of two transfer lines that would connect the two tanks, one to carry the sluiced waste slurry to AY-102, and the other to return the supernatant liquid to C-106. The supernatant, or alternate fluid, will be used to mobilize waste in C-106 for the sluicing process. The equipment necessary for the WRSS include pumps in each tank, sluicers to direct the supernatant stream in C-106, a slurry distributor in AY-102, HVAC for C-106, instrumentation and control devices, and other existing components as required
Project W-320 Tank 106-C waste retrieval study analysis session report
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the Kaiser Engineers Hanford Company Project W-320 Tank 106-C Waste Retrieval Study Analysis Session Report readily retrievable. This facilitated session was requested by Westinghouse Hanford Company (WHC) to review the characterization data and select the best alternatives for a double-shell receiver tank and for a sluicing medium for Tank 106-C waste retrieval. The team was composed of WHC and Kaiser Engineers Hanford Company (KEH) personnel knowledgeable about tank farm operations, tank 106-C requirements, tank waste characterization and analysis, and chemical processing. This team was assembled to perform a structured decision analysis evaluation and recommend the best alternative-destination double-shell tank between tanks 101-AY and 102-AY, and the best alternative sluicing medium among dilute complexant (DC), dilute noncomplexant (DNC), and water. The session was facilitated by Richard Harrington and Steve Bork of KEH and was conducted at the Bookwalter Winery in Richland from 7:30 a.m. to 4:00 p.m. from July 27 through July 29, 1993. Attachment 1 (Scope Statement Sheet) identifies the team members, scope, objectives, and deliverables for the session
Permitting plan for Project W-340, Tank 241-C-106 manipulator retrieval arm
International Nuclear Information System (INIS)
Tollefson, K.S.
1995-01-01
This document describes the regulatory requirements and describes alternative strategies for obtaining permits and approvals for Project W-340, Tank 241-C-106 Manipulator Retrieval Arm. A comprehensive review of environmental regulations has indicated that several environmental reviews, permits, and approvals are required before design, construction, and operation of the facility. The environmental reviews, permits, and approvals, as well the regulatory authority potentially applicable to the Project W-340 Long Reach Manipulator Arm include the following: National Environmental Policy Act of 1969 -- US Department of Energy, Headquarters; State Environmental Policy Act of 1971 -- State of Washington Department of Ecology; Air Permitting; Dangerous Waste Permitting; Miscellaneous Reviews/Permits/Approvals. This document describes the environmental reviews, permits, and approval requirements for the project. It provides a summary of permit application data requirements, alternative strategies for permit completion and approval, as well as the estimated probability of success for each alternative strategy
International Nuclear Information System (INIS)
Van Vleet, R.J.
1997-01-01
This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST)
Energy Technology Data Exchange (ETDEWEB)
Van Vleet, R.J.
1997-08-05
This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST).
Operational test report - Project W-320 cathodic protection systems
International Nuclear Information System (INIS)
Bowman, T.J.
1998-01-01
Washington Administrative Code (WAC) 173-303-640 specifies that corrosion protection must be designed into tank systems that treat or store dangerous wastes. Project W-320, Waste Retrieval Sluicing System (WRSS), utilizes underground encased waste transfer piping between tanks 241-C-106 and 241-AY-102. Corrosion protection is afforded to the encasements of the WRSS waste transfer piping through the application of earthen ionic currents onto the surface of the piping encasements. Cathodic protection is used in conjunction with the protective coatings that are applied upon the WRSS encasement piping. WRSS installed two new two rectifier systems (46 and 47) and modified one rectifier system (31). WAC 173-303-640 specifies that the proper operation of cathodic protection systems must be confirmed within six months after initial installation. The WRSS cathodic protection systems were energized to begin continuous operation on 5/5/98. Sixteen days after the initial steady-state start-up of the WRSS rectifier systems, the operational testing was accomplished with procedure OTP-320-006 Rev/Mod A-0. This operational test report documents the OTP-320-006 results and documents the results of configuration testing of integrated piping and rectifier systems associated with the W-320 cathodic protection systems
Preliminary safety equipment list for Tank 241-C-106 Manipulator Retrieval System, Project W-340
International Nuclear Information System (INIS)
Guthrie, R.L.
1994-01-01
This document identifies the anticipated safety classification of the estimated major subsystems, based on the projected major functions, that will be used as guidance for the development of the conceptual design of the Manipulator Retrieval System for Tank 241-C-106. This document is intended to be updated as the design of the Manipulator Retrieval System evolves through the conceptual and definitive design phases. The Manipulator Retrieval System is to be capable of removing the hardened sludge heel at the bottom of single shell Tank 241-C-106 and to perform an overall clean out of the tank that leaves a maximum of 360 ft 3 (TPA milestone M-45-00). The thickness of the heel prior to initiation of waste retrieval with the Manipulator Retrieval System is estimated to be 1- to 2-ft. The Manipulator Retrieval System is currently in the pre-conceptual phase with no definitive systems or subsystems. The anticipated retrieval functions for the Manipulator Retrieval System is based on Table 6-2 of WHC-SD-W340-ES-001, Rev. 1. Projected equipment to accomplish these functions were based on the following systems and equipment: Rotary Mode Core Sampling Equipment (WHC-SD-WM-SEL-032); Light Duty Utility Arm System Equipment (WHC-SD-WM-SEL-034); Single Shell Tanks Equipment (WHC-SD-WM-SEL-020)
International Nuclear Information System (INIS)
Estey, S.D.
1997-01-01
This calculation note analyzes headspace concentrations of hydrogen dependent upon assumed ventilation flow rates provided for tanks 241-C-106 and 241-AY-102. The analyses are based on measured or estimated steady state hydrogen release rates. Tank 241-C-106 is analyzed prior to sluicing; tank 241-AY-102 is analyzed both prior to and after completion of sluicing. Specific analyses, using both best estimated and bounding hydrogen generation rates, include the minimum primary ventilation flow rates required in the tanks to ensure that the steady state hydrogen concentration in the respective tank headspace does not exceed 25% and 100% of the LFL. The headspace hydrogen concentration as a function of time as well as the time required to reach 25% and 100% of LFL upon complete loss of active ventilation, starting from the steady state hydrogen concentration based on a 200 CFM minimum flow rate in tank 241-C-106 and a 100 CFM minimum flow rate in tank241-AY-102. The headspace hydrogen concentration as a function of thee following partial loss of active ventilation (i.e., step changes to l60, l20, 80, and 40 CFM ventilation flow rates) in tank 241-C-106, staffing from a 200 CFM flow rate and the corresponding steady state hydrogen concentration based on the 200 CFM flow rate. The headspace hydrogen concentration as a function of the following partial loss of active ventilation i.e., step changes to 80, 60, 40, and 20 CFM ventilation flow rates) in tank 241-AY-102, starting from a 100 CFM flow rate and the corresponding steady state hydrogen concentration based on the 100 CFM flow rate
W-320 waste retrieval sluicing system transfer line flushing volume and frequency calculation
International Nuclear Information System (INIS)
Bailey, J.W.
1997-01-01
The calculations contained in this analysis document establish the technical basis for the volume, frequency, and flushing fluid to be utilized for routine Waste Retrieval Sluicing System (WRSS) process line flushes. The WRSS was installed by Project W-320, Tank 241-C-106 Sluicing. The double contained pipelines being flushed have 4 inch stainless steel primary pipes. The flushes are intended to prevent hydrogen buildup in the transfer lines and to provide ALARA conditions for maintenance personnel
Waste compatibility assessments to support project W-320
International Nuclear Information System (INIS)
BLAAK, T.M.
1999-01-01
The intent of this internal memo is to provide a recommendation for the transfer of tank 241-C-106 waste, Attachment 2, to tank 241-AY-102. This internal memo also identifies additional requirements which have been deemed necessary for safely receiving and storing the waste documented in Attachment 2 from tank 241-C-106 in tank 241-AY-102. This waste transfer is planned in support of tank 241-C-106 solids sluicing activities. Approximately 200,000 gallons of waste and flush water are expected to be pumped from tank 241-C-106 into tank 241-AY-102. Several transfers will be necessary to complete the sluicing of tank 241-C-106 solids. To assure ourselves that this waste transfer will not create any compatibility concerns, a waste compatibility assessment adhering to current waste compatibility requirements has been performed
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
International Nuclear Information System (INIS)
Himes, D.A.
1998-01-01
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
Energy Technology Data Exchange (ETDEWEB)
Himes, D.A.
1998-08-11
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological calculations for AY-102 and C-106HEPA filters and pre-filters
International Nuclear Information System (INIS)
Simpson, T.R.; Van Vleet, R.J.
1997-01-01
The high heat content solids in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W-320. Once sluicing operations are underway, the state of these tanks will be transformed from 'unagitated' to 'agitated'. This means that the partition fraction which described the aerosol content of the head space will increase from 1 X 10 - 20 to 1 X 10 -1 . This head space will become much more loaded with suspended material. The nature of this suspended material may change significantly, sluicing may inadvertently bring up radioactive solids which normally would lay under many meters of liquid supernate. It is an enabling assumption that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split; there is an unmitigated and mitigated composition. It is an enabling assumption that the sluicing line; the headspace in Tank 241-C-106, and the filters in Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split; there is an unmitigated and mitigated composition
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Acceptance test procedure, 241-SY-101/241-C-106 shot loading system
International Nuclear Information System (INIS)
Ostrom, M.J.
1994-01-01
This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations
Radiological and toxicological calculations for AY-102 and C-106HEPA filters and pre-filters
Energy Technology Data Exchange (ETDEWEB)
Simpson, T.R.; Van Vleet, R.J.
1997-07-01
The high heat content solids in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W-320. Once sluicing operations are underway, the state of these tanks will be transformed from `unagitated` to `agitated`. This means that the partition fraction which described the aerosol content of the head space will increase from 1 X 10{sup - 20} to 1 X 10{sup -1}. This head space will become much more loaded with suspended material. The nature of this suspended material may change significantly, sluicing may inadvertently bring up radioactive solids which normally would lay under many meters of liquid supernate. It is an enabling assumption that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split; there is an unmitigated and mitigated composition. It is an enabling assumption that the sluicing line; the headspace in Tank 241-C-106, and the filters in Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split; there is an unmitigated and mitigated composition.
C-106 tank sluicer control system
International Nuclear Information System (INIS)
Bellomy, J.R.
1997-01-01
Acceptance Test Report for the Sluicer Control System, Project W-320 This Acceptance Test Procedure (ATP) has been prepared to demonstrate that the C-Farm tank C-106 sluicer functions as required by the design criteria
Project W-320, WRSS PCP: Procedure implementation verification
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This document provides verification that the methodology for the safe retrieval of high-heat waste from Tank 241-C-106 as specified in the WRSS Process Control Plan HNF-SD-PCP-013, Revision 1, has been adequately implemented into the Tank Waste Remediation System (TWRS) operational procedures. Tank 241-C-106 is listed on the High Heat Load Watch List
International Nuclear Information System (INIS)
Harty, W.M.
1995-01-01
This supporting document establishes the As Low As Reasonable Achievable (ALARA) Plan to be followed during Sluicing Project W-320 design and construction activities to minimize personnel exposure to radiation and hazardous materials
Energy Technology Data Exchange (ETDEWEB)
Harty, W.M.
1995-06-06
This supporting document establishes the As Low As Reasonable Achievable (ALARA) Plan to be followed during Sluicing Project W-320 design and construction activities to minimize personnel exposure to radiation and hazardous materials.
International Nuclear Information System (INIS)
Crawford, B.A.
1996-01-01
This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined
Project W-320, operational test procedure OTP-320-003 test report
International Nuclear Information System (INIS)
Bevins, R.R.
1998-01-01
This report documents and summarizes the results of OTP-320-003 Project W-320 Operational Testing of the WRSS Supernate Transfer System. Project W-320 Operational Test OTP-320-003 was performed to verify components of the Waste Retrieval Sluicing System (WRSS) supernate transfer system functioned as designed following construction completion and turnover to operations. All equipment operation was performed by Tank Farms Operations personnel following the operational test procedure and referenced operating procedures. Supernate Transfer line Flushing System Testing was completed over the course of approximately 4 weeks as tank farm conditions and configuration, equipment availability, and operations resources allowed. All testing was performed with the 702-AZ ventilation system and the 296-P-16 ventilation systems in operation. Test procedure OTP-320-003 required two revisions during testing to incorporate Procedure Changes Authorizations (PCAs) necessary to facilitate testing. Various sections of testing are documented on each procedure revision. The completed test procedure is included as Attachment A. Exception Reports generated during the course of testing are included as Attachment B
Project W-320, waste retrieval sluicing system: BIO/SER implementation matrices
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This document provides verification that the safety related commitments specified in HNF-SD-WM-810-001, Addendum 1 for the Waste Retrieval Sluicing System, Project W-320 and Project W-320 Safety Evaluation Report (SER), have been implemented in the project hardware, procedures and administrative controls. Four appendices include matrices which show where the 810 commitments are implemented for limiting conditions of operation and surveillance requirements controls, administrative controls, defense-in-depth controls and controls discussed in 810 Addendum 1. A fifth appendix includes the implementation of Project W-320 SER issues and provisions
Project W-320, 241-C-106 waste retrieval spare parts list
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
Spare parts for equipment installed in the tank dome space or pump or valve pits should not be inventoried onsite due to the extensive, time-consuming work package planning, personnel/equipment mobilization, and funding requirements that are prerequisites to any repair or replacement. These issues provide adequate time to procure parts from offsite sources. All parts listed in this inventory can either be stocked in the DynCorp Tri-Cities Services, Inc., 2101-M Warehouse, or are available from the vendor/manufacturer
Project W-320, 241-C-106 waste retrieval spare parts list
Energy Technology Data Exchange (ETDEWEB)
Hays, W.H.
1998-03-23
Spare parts for equipment installed in the tank dome space or pump or valve pits should not be inventoried onsite due to the extensive, time-consuming work package planning, personnel/equipment mobilization, and funding requirements that are prerequisites to any repair or replacement. These issues provide adequate time to procure parts from offsite sources. All parts listed in this inventory can either be stocked in the DynCorp Tri-Cities Services, Inc., 2101-M Warehouse, or are available from the vendor/manufacturer.
Engineering Task Plan for Tank 241-C-106 contingency chiller definitive design
International Nuclear Information System (INIS)
Rensink, G.E.; Kriskovich, J.R.
1995-01-01
This document identifies the scope, cost, schedule and responsible organizations for completing a design of a contingency ventilation inlet air cooling system for Tank 241-C-106. The air cooling system, described in Rensink (1995), consists of a chiller, cooling coils, and supporting equipment that, when installed will be capable of assuring that the waste temperatures in Tank 241-C-106 are maintained within acceptable limits for safe storage. The effort described herein is scheduled for completion by May 31, 1995 to support Performance Based Incentive (PBI) Milestone SI-2x
Project W-320 SAR and process control thermal analyses
International Nuclear Information System (INIS)
Sathyanarayana, K.
1997-01-01
This report summarizes the results of thermal hydraulic computer modeling supporting Project W-320 for process control and SAR documentation. Parametric analyses were performed for the maximum steady state waste temperature. The parameters included heat load distribution, tank heat load, fluffing factor and thermal conductivity. Uncertainties in the fluffing factor and heat load distribution had the largest effect on maximum waste temperature. Safety analyses were performed for off normal events including loss of ventilation, loss of evaporation and loss of secondary chiller. The loss of both the primary and secondary ventilation was found to be the most limiting event with saturation temperature in the bottom waste reaching in just over 30 days. An evaluation was performed for the potential lowering of the supernatant level in tank 241-AY-102. The evaluation included a loss of ventilation and steam bump analysis. The reduced supernatant level decreased the time to reach saturation temperature in the waste for the loss of ventilation by about one week. However, the consequence of a steam bump were dramatically reduced
Project W-320, 241-C-106 sluicing civil/structural calculations, Volume 7
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
The structural skid supporting the Process Building and equipment is designed based on the criteria, codes and standards, referenced in the calculation. The final members and the associated elements satisfy the design requirements of the structure. Revision 1 incorporates vendor data for the weight of the individual equipment components. The updated information does not affect the original conclusion of the calculation, since the overall effect is a reduction in the total weight of the equipment and a nominal relocation of the center of gravity for the skid assembly
Project W-320, 241-C-106 sluicing civil/structural calculations, Volume 7
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-24
The structural skid supporting the Process Building and equipment is designed based on the criteria, codes and standards, referenced in the calculation. The final members and the associated elements satisfy the design requirements of the structure. Revision 1 incorporates vendor data for the weight of the individual equipment components. The updated information does not affect the original conclusion of the calculation, since the overall effect is a reduction in the total weight of the equipment and a nominal relocation of the center of gravity for the skid assembly.
Repository of not readily available documents for project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1997-04-18
The purpose of this document is to provide a readily available source of the technical reports needed for the development of the safety documentation provided for the waste retrieval sluicing system (WRSS), designed to remove the radioactive and chemical sludge from tank 241-C-106, and transport that material to double-shell tank 241-AY-102 via a new, temporary, shielded, encased transfer line.
Repository of not readily available documents for project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1997-01-01
The purpose of this document is to provide a readily available source of the technical reports needed for the development of the safety documentation provided for the waste retrieval sluicing system (WRSS), designed to remove the radioactive and chemical sludge from tank 241-C-106, and transport that material to double-shell tank 241-AY-102 via a new, temporary, shielded, encased transfer line
Single-Shell Tank (SST) Retrieval Project Plan for Tank 241-C-104 Retrieval
International Nuclear Information System (INIS)
DEFIGH PRICE, C.
2000-01-01
In support of the SST Interim Closure Project, Project W-523 ''Tank 241-C-104 Waste Retrieval System'' will provide systems for retrieval and transfer of radioactive waste from tank 241-C-104 (C-104) to the DST staging tank 241-AY-101 (AY-101). At the conclusion of Project W-523, a retrieval system will have been designed and tested to meet the requirements for Acceptance of Beneficial Use and been turned over to operations. Completion of construction and operations of the C-104 retrieval system will meet the recently proposed near-term Tri-Party Agreement milestone, M-45-03F (Proposed Tri-Party Agreement change request M-45-00-01A, August, 30 2000) for demonstrating limits of retrieval technologies on sludge and hard heels in SSTs, reduce near-term storage risks associated with aging SSTs, and provide feed for the tank waste treatment plant. This Project Plan documents the methodology for managing Project W-523; formalizes responsibilities; identifies key interfaces required to complete the retrieval action; establishes the technical, cost, and schedule baselines; and identifies project organizational requirements pertaining to the engineering process such as environmental, safety, quality assurance, change control, design verification, testing, and operational turnover
C-106 tank process ventilation test
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
Project W-320 Acceptance Test Report for tank 241-C-106, 296-C-006 Ventilation System Acceptance Test Procedure (ATP) HNF-SD-W320-012, C-106 Tank Process Ventilation Test, was an in depth test of the 296-C-006 ventilation system and ventilation support systems required to perform the sluicing of tank C-106. Systems involved included electrical, instrumentation, chiller and HVAC. Tests began at component level, moved to loop level, up to system level and finally to an integrated systems level test. One criteria was to perform the test with the least amount of risk from a radioactive contamination potential stand point. To accomplish this a temporary configuration was designed that would simulate operation of the systems, without being connected directly to the waste tank air space. This was done by blanking off ducting to the tank and connecting temporary ducting and an inlet air filter and housing to the recirculation system. This configuration would eventually become the possible cause of exceptions. During the performance of the test, there were points where the equipment did not function per the directions listed in the ATP. These events fell into several different categories. The first and easiest problems were field configurations that did not match the design documentation. This was corrected by modifying the field configuration to meet design documentation and reperforming the applicable sections of the ATP. A second type of problem encountered was associated with equipment which did not operate correctly, at which point an exception was written against the ATP, to be resolved later. A third type of problem was with equipment that actually operated correctly but the directions in the ATP were in error. These were corrected by generating an Engineering Change Notice (ECN) against the ATP. The ATP with corrected directions was then re-performed. A fourth type of problem was where the directions in the ATP were as the equipment should operate, but the design of
Baseline estimate of the retained gas volume in Tank 241-C-106
International Nuclear Information System (INIS)
Stewart, C.W.; Chen, G.
1998-06-01
This report presents the results of a study of the retained gas volume in Hanford Tank 241-C-106 (C-106) using the barometric pressure effect method. This estimate is required to establish the baseline conditions for sluicing the waste from C-106 into AY-102, scheduled to begin in the fall of 1998. The barometric pressure effect model is described, and the data reduction and detrending techniques are detailed. Based on the response of the waste level to the larger barometric pressure swings that occurred between October 27, 1997, and March 4, 1998, the best estimate and conservative (99% confidence) retained gas volumes in C-106 are 24 scm (840 scf) and 50 scm (1,770 scf), respectively. This is equivalent to average void fractions of 0.025 and 0.053, respectively
Hanford Tank 241-C-106: Residual Waste Contaminant Release Model and Supporting Data
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2005-01-01
CH2M HILL is producing risk/performance assessments to support the closure of single-shell tanks at the DOE's Hanford Site. As part of this effort, staff at PNNL were asked to develop release models for contaminants of concern that are present in residual sludge remaining in tank 241-C-106 (C-106) after final retrieval of waste from the tank. This report provides the information developed by PNNL
Energy Technology Data Exchange (ETDEWEB)
Minteer, D.J.
1995-01-23
The purpose of this analysis is to estimate the uncertainty in the measured quantity of water which typically leaves Tank 241-C-106 via the ventilation system each month. Such measurements are essential for heat removal estimation and tank liquid level verification purposes. The uncertainty associated with the current, infrequent, manual method of measurement (involves various psychrometric and pressure measurements) is suspected to be unreasonably high. Thus, the possible reduction of this uncertainty using a continuous, automated method of measurement will also be estimated. There are three major conclusions as a result of this analysis: (1) the uncertainties associated with the current (infrequent, manual) method of measuring the water which typically leaves Tank 241-C-106 per month via the ventilation system are indeed quite high (80% to 120%); (2) given the current psychrometric and pressure measurement methods and any tank which loses considerable moisture through active ventilation, such as Tank 241-C-106, significant quantities of liquid can actually leak from the tank before a leak can be positively identified via liquid level measurement; (3) using improved (continuous, automated) methods of taking the psychrometric and pressure measurements, the uncertainty in the measured quantity of water leaving Tank 241-C-106 via the ventilation system can be reduced by approximately an order of magnitude.
International Nuclear Information System (INIS)
Minteer, D.J.
1995-01-01
The purpose of this analysis is to estimate the uncertainty in the measured quantity of water which typically leaves Tank 241-C-106 via the ventilation system each month. Such measurements are essential for heat removal estimation and tank liquid level verification purposes. The uncertainty associated with the current, infrequent, manual method of measurement (involves various psychrometric and pressure measurements) is suspected to be unreasonably high. Thus, the possible reduction of this uncertainty using a continuous, automated method of measurement will also be estimated. There are three major conclusions as a result of this analysis: (1) the uncertainties associated with the current (infrequent, manual) method of measuring the water which typically leaves Tank 241-C-106 per month via the ventilation system are indeed quite high (80% to 120%); (2) given the current psychrometric and pressure measurement methods and any tank which loses considerable moisture through active ventilation, such as Tank 241-C-106, significant quantities of liquid can actually leak from the tank before a leak can be positively identified via liquid level measurement; (3) using improved (continuous, automated) methods of taking the psychrometric and pressure measurements, the uncertainty in the measured quantity of water leaving Tank 241-C-106 via the ventilation system can be reduced by approximately an order of magnitude
International Nuclear Information System (INIS)
Wang, O.S.; Bell, K.E.; Anderson, C.M.; Peffers, M.S.; Pulsipher, B.A.; Scott, J.L.
1994-01-01
The rate of heat generation for tank 241-C-106 at the Hanford Site is estimated at more then 100,000 Btu/h. The heat is generated primarily from the radioactive decay of 90 Sr waste that was inadvertently transferred into the tank in the late 1960s. If proper tank cooling is not maintained for this tank, heat-induced structural damage to the tank's concrete shell could result in the release of nuclear waste to the environment. Because of high-heat concerns in January 1991, tank 241-C-106 was designated as a Watch List tank and deemed as a Priority 1 safety issue. Waste Tank Safety Program (WTSP) is responsible for the resolution of this safety issue. Although forced cooling is effective for short term, the long-term resolution for tank cooling is waste retrieval. Single-shell Tank Retrieval Project (Retrieval) is responsible for the safe retrieval and transfer of radioactive waste from tank 241-C-106 to a selected double-shell tank. This data quality objective (DQO) study is an effort to determine engineering and design data needs for WTSP and assist Retrieval in designing contingency action retrieval systems. The 7-step DQO process is a tool developed by the Environmental Protection Agency with a goal of identifying needs and reducing costs. This report discusses the results of two DQO efforts for WTSP and Retrieval. The key data needs to support WTSP are thermal conductivity, permeability, and heat load profile. For the Retrieval support, there are nine and three data needs identified, respectively, for retrieval engineering system design and HVAC system design. The updated schedule to drill two core samples using rotary mode is set for March 1994. The analysis of the sample is expected to be completed by September 1994
Waste retrieval sluicing system data acquisition system acceptance test report
International Nuclear Information System (INIS)
Bevins, R.R.
1998-01-01
This document describes the test procedure for the Project W-320 Tank C-106 Sluicing Data Acquisition System (W-320 DAS). The Software Test portion will test items identified in the WRSS DAS System Description (SD), HNF-2115. Traceability to HNF-2115 will be via a reference that follows in parenthesis, after the test section title. The Field Test portion will test sensor operability, analog to digital conversion, and alarm setpoints for field instrumentation. The W-320 DAS supplies data to assist thermal modeling of tanks 241-C-106 and 241-AY-102. It is designed to be a central repository for information from sources that would otherwise have to be read, recorded, and integrated manually. Thus, completion of the DAS requires communication with several different data collection devices and output to a usable PC data formats. This test procedure will demonstrate that the DAS functions as required by the project requirements stated in Section 3 of the W-320 DAS System Description, HNF-2115
Preliminary analysis of tank 241-C-106 dryout due to large postulated leak and vaporization
Energy Technology Data Exchange (ETDEWEB)
Piepho, M.G.
1995-03-01
At the Hanford site in SE Washington, there are 149 single-shell tanks containing radionuclide wastes in the form of liquids, sludges and salt cakes. One of the tanks, tank 241-C-106, is heated to the boiling point due to radionuclide decay (primarily Sr-90). Water is added to the tank, which is ventilated, in order to cool the tank. This analysis assumes that there is a hypothetical large leak at the bottom of Tank 241-C-106 which initiates the dryout of the tank. The time required for a tank to dryout after a leak is of interest for safety reasons. As a tank dries outs, its temperature is expected to greatly increase, which could affect the structural integrity of the concrete tank dome. Hence, it is of interest to know how fast the temperature in a leaky tank increases, so that mitigation procedures can be planned and implemented in a timely manner. The objective of the study was to determine how long it would take for tank 241-C-106 to reach 350 degrees Fahrenheit (about 177 degrees Centigrade) after a postulated large leak develops at the bottom center of the tank.
International Nuclear Information System (INIS)
Harris, J.P.; Julyk, L.J.; Marlow, R.S.; Moore, C.J.; Day, J.P.; Dyrness, A.D.; Jagadish, P.; Shulman, J.S.
1993-10-01
The buried single-shell waste tank 241-C-106, located at the US Department of Energy's Hanford Site, has been a repository for various liquid radioactive waste materials since its construction in 1943. A first step toward waste tank remediation is demonstrating that remediation activities can be performed safely. Determination of the current structural capacity of this high-heat tank is an important element in this assessment. A structural finite-element model of tank 241-C-106 has been developed to assess the tank's structural integrity with respect to in situ conditions and additional remediation surface loads. To predict structural integrity realistically, the model appropriately addresses two complex issues: (1) surrounding soil-tank interaction associated with thermal expansion cycling and surcharge load distribution and (2) concrete-property degradation and creep resulting from exposure to high temperatures generated by the waste. This paper describes the development of the 241-C-106 structural model, analysis methodology, and tank-specific structural acceptance criteria
Safety evaluation for packaging transportation of equipment for tank 241-C-106 waste sluicing system
International Nuclear Information System (INIS)
Calmus, D.B.
1994-01-01
A Waste Sluicing System (WSS) is scheduled for installation in nd waste storage tank 241-C-106 (106-C). The WSS will transfer high rating sludge from single shell tank 106-C to double shell waste tank 241-AY-102 (102-AY). Prior to installation of the WSS, a heel pump and a transfer pump will be removed from tank 106-C and an agitator pump will be removed from tank 102-AY. Special flexible receivers will be used to contain the pumps during removal from the tanks. After equipment removal, the flexible receivers will be placed in separate containers (packagings). The packaging and contents (packages) will be transferred from the Tank Farms to the Central Waste Complex (CWC) for interim storage and then to T Plant for evaluation and processing for final disposition. Two sizes of packagings will be provided for transferring the equipment from the Tank Farms to the interim storage facility. The packagings will be designated as the WSSP-1 and WSSP-2 packagings throughout the remainder of this Safety Evaluation for Packaging (SEP). The WSSP-1 packagings will transport the heel and transfer pumps from 106-C and the WSSP-2 packaging will transport the agitator pump from 102-AY. The WSSP-1 and WSSP-2 packagings are similar except for the length
Project W-320, backup: 1000 CFM portable exhausters acceptance for beneficial use
International Nuclear Information System (INIS)
Nelson, O.D.
1998-01-01
This document is to identify the Project W-320 1000 CFM portable exhauster documentation required to be turned over from the Projects Organization to the Tank Farm Operations as part of the acceptance of the 1000 CFM portable exhausters for beneficial use
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-420. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance. This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
Project W320 52-inch diameter equipment container load test: Test report
International Nuclear Information System (INIS)
Bellomy, J.R.
1995-01-01
This test report summarizes testing activities and documents the results of the load tests performed on-site and off-site to structural qualify the 52-inch equipment containers designed and fabricated under Project W-320
Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout
Energy Technology Data Exchange (ETDEWEB)
Ewalt, J.R.
1993-09-01
In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.
Project W-314 specific test and evaluation plan for 241-AY-02A pump pit upgrade
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-02A Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-02A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Project W-314 specific test and evaluation plan for 241-AY-01A pump pit upgrade
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-0IA Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-01A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
International Nuclear Information System (INIS)
1995-02-01
The US Department of Energy (DOE) needs to take action to eliminate safety concerns with storage of the high-heat waste in Tank 241-C-106 (Tank C-106), and demonstrate a tank waste retrieval technology. This Environmental Assessment (EA) was prepared to analyze the potential impacts associated with the proposed action, past-practice sluicing of Tank C-106, an underground single-shell tank (SST). Past-practice sluicing is defined as the mode of waste retrieval used extensively in the past at the Hanford Site on the large underground waste tanks, and involves introducing a high-volume, low-pressure stream of liquid to mobilize sludge waste prior to pumping. It is proposed to retrieve the waste from Tank C-106 because this waste is classified not only as transuranic and high-level, but also as high-heat, which is caused by the radioactive decay of strontium. This waste characteristic has led DOE to place Tank C-106 on the safety ''Watchlist.''
Seismic evaluation of Tank 241C106 in support of retrieval activities
International Nuclear Information System (INIS)
Wallace, D.A.
1994-01-01
Tank 241C106 (C106) is a domed, single-shell high-level waste storage tank that has been in service in the 200 East Area of the Hanford Site since 1947. Tank C106 is one of twelve tanks in a 4 x 3 array with a 100-ft center-to-center spacing. Each of the tanks is approximately 75 ft in diameter, 24-ft high at the haunch, and 33-ft high at the dome apex. The level of waste in C106 and the associated thermal environment have varied throughout the life of the tanks with the peak temperature in the concrete reaching approximately 300 F at the base of the tank in the mid-1970's (Bander 1992). The calculated peak temperature in the concrete has decreased since that time to approximately 200 F. The peak temperature occurs at the inside bottom of the tank; concrete temperatures in the wall and dome are less than 130 F. The waste inside the tank is primarily solid matter approximately 7- to 8-ft deep. The tank is completely buried in dry, sandy soil to a depth of approximately 6 ft at the dome apex. The in situ evaluation of C106 documented in July 1994 includes only the effects of gravity and thermal loads. A preliminary seismic evaluation of C106 considering only horizontal excitation demonstrated the finite-element program SASSI (A System for Analysis of Soil-Structure Interaction) and provided an estimate of seismic effects including soil-to-structure interaction. This final seismic evaluation expands on the preliminary seismic evaluation to include further verification and refinement of analysis parameters, quantification to tank-to-tank and waste-to-tank interaction, and examination of the effects of vertical seismic excitation. The concrete structure of tank C106 is classified as a Safety Class 1 non-reactor structure
SAFETY EVALUATION OF OXALIC ACID WASTE RETRIEVAL IN SINGLE SHELL TANK (SST) 241-C-106
International Nuclear Information System (INIS)
SHULTZ, M.V.
2003-01-01
This report documents the safety evaluation of the process of retrieving sludge waste from single-shell tank 241-C-106 using oxalic acid. The results of the HAZOP, safety evaluation, and control allocation/decision are part of the report. This safety evaluation considers the use of oxalic acid to recover residual waste in single-shell tank (SST) 241-C-106. This is an activity not addressed in the current tank farm safety basis. This evaluation has five specific purposes: (1) Identifying the key configuration and operating assumptions needed to evaluate oxalic acid dissolution in SST 241-C-106. (2) Documenting the hazardous conditions identified during the oxalic acid dissolution hazard and operability study (HAZOP). (3) Documenting the comparison of the HAZOP results to the hazardous conditions and associated analyzed accident currently included in the safety basis, as documented in HNF-SD-WM-TI-764, Hazard Analysis Database Report. (4) Documenting the evaluation of the oxalic acid dissolution activity with respect to: (A) Accident analyses described in HNF-SD-WM-SAR-067, Tank Farms Final Safety Analysis Report (FSAR), and (B) Controls specified in HNF-SD-WM-TSR-006, Tank Farms Technical Safety Requirements (TSR). (5) Documenting the process and results of control decisions as well as the applicability of preventive and/or mitigative controls to each oxalic acid addition hazardous condition. This safety evaluation is not intended to be a request to authorize the activity. Authorization issues are addressed by the unreviewed safety question (USQ) evaluation process. This report constitutes an accident analysis
Project W-314 specific test and evaluation plan 241-AN-B valve pit
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-B Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Project W-314 specific test and evaluation plan for 241-AN-A valve pit
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
Project W-314 specific test and evaluation plan for 241-AN-A valve pit
International Nuclear Information System (INIS)
Hays, W.H.
1997-01-01
The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a ''lower tier'' document based on the W-314 Test and Evaluation Plan (TEP) This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the modifications of the AN-A valve pit. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the modifications to the 241-AN-A Valve Pit. The STEP will be utilized in conjunction with the TEP for verification and validation
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
Energy Technology Data Exchange (ETDEWEB)
HAMMERS, J.S.
1999-07-21
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades.
Project W-314 241-AN-A valve pit upgrade acceptance for beneficial use
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
This report identifies the responsibilities and requirements, applicable to the 241-AN-A Valve Pit Upgrades portion of Project W-314, for Acceptance for Beneficial Use in accordance with HNF-IP-0842, Vol IV, Sec 3.12. At project turnover, the end user accepts the affected Structures, Systems, and Components (SSCs) for beneficial use. This checklist is used to help the end user ensure that all documentation, training, and testing requirements are met prior to turnover. This checklist specifically identifies those items related to the upgrading of the 241-AN-A valve pit. The upgrades include: the installation of jumper/valve manifolds with position sensors, replacement pit leak detection systems, construction of replacement cover blocks, and electrical upgrades to support the instrumentation upgrades
241-AZ-101 pump removal trough analysis
International Nuclear Information System (INIS)
Coverdell, B.L.
1995-01-01
As part of the current Hanford mission of environmental cleanup, various long length equipment must be removed from highly radioactive waste tanks. The removal of equipment will utilize portions of the Equipment Removal System for Project W320 (ERS-W320), specifically the 50 ton hydraulic trailer system. Because the ERS-W320 system was designed to accommodate much heavier equipment it is adequate to support the dead weight of the trough, carriage and related equipment for 241AZ101 pump removal project. However, the ERS-W320 components when combined with the trough and its' related components must also be analyzed for overturning due to wind loads. Two troughs were designed, one for the 20 in. diameter carriage and one for the 36 in. diameter carriage. A proposed 52 in. trough was not designed and, therefore is not included in this document. In order to fit in the ERS-W320 strongback the troughs were design with the same widths. Structurally, the only difference between the two troughs is that more material was removed from the stiffener plates on the 36 in trough. The reduction in stiffener plate material reduces the allowable load. Therefore, only the 36 in. trough was analyzed
International Nuclear Information System (INIS)
McVeety, B.D.; Clauss, T.W.; Young, J.S.; Ligotke, M.W.; Goheen, S.C.; Lucke, R.B.; Pool, K.H.; McCulloch, M.; Fruchter, J.S.
1995-06-01
This document presents the details of the inorganic and organic analysis that was performed on samples from the headspace of Hanford waste tank 241-C-106. The results described were obtained to support the safety and toxicological evaluations. A summary of the results for the inorganic and organic analytes is included, as well as, a detailed description of the results which appears in the text
Energy Technology Data Exchange (ETDEWEB)
Esch, R.A.
1997-04-14
This report represents the Final Analytical Report on Tank Waste Remediation System (TWRS) Privatization Contractor Samples for Waste Envelope D. All work was conducted in accordance with ''Addendum 1 of the Letter of Instruction (LOI) for TWRS Privatization Contractor Samples Addressing Waste Envelope D Materials - Revision 0, Revision 1, and Revision 2.'' (Jones 1996, Wiemers 1996a, Wiemers 1996b) Tank 241-C-1 06 (C-106) was selected by TWRS Privatization for the Part 1A Envelope D high-level waste demonstration. Twenty bottles of Tank C-106 material were collected by Westinghouse Hanford Company using a grab sampling technique and transferred to the 325 building for processing by the Pacific Northwest National Laboratory (PNNL). At the 325 building, the contents of the twenty bottles were combined into a single Initial Composite Material. This composite was subsampled for the laboratory-scale screening test and characterization testing, and the remainder was transferred to the 324 building for bench-scale preparation of the Privatization Contractor samples.
International Nuclear Information System (INIS)
Stewart, C.W.; Erian, F.F.; Meyer, P.A.
1997-07-01
The retained gas volume can be estimated by several methods. All of these methods have significant uncertainties, but together they form a preponderance of evidence that describes the gas retention behavior of the tank. The methods are (1) an increase in nonconvective layer thickness; (2) a waste surface level rise (surface level effect [SLE] model); (3) the barometric pressure effect (BPE model); (4) direct void measurement; and (5) the consequences of the transfer process. The nonconvective layer thickness can be determined with sufficient accuracy to describe the overall waste configuration by means of temperature profiles or densitometer indications. However, the presence of a nonconvective layer does not necessarily indicate significant gas retention, and small changes in layer thickness that could quantify gas retention cannot be detected reliably with the methods available. The primary value of this measurement is in establishing the actual open-quotes fluffing factorclose quotes for thermal calculations. Surface level rise is not a useful measure of gas retention in Tank 241-C-106 (C-106) since the waste level fluctuates with regular makeup water additions. In Tank 241-AY-102 (AY-102) with the existing ventilation system it should be possible to determine the gas retention rate within 30-60% uncertainty from the surface level rise, should a significant rise be observed. The planned ventilation system upgrades in AY- 102 will greatly reduce the exhaust flow and the headspace humidity, and the evaporation rate should be significantly lower when transfers begin. This could reduce the uncertainty in gas retention rate estimates to around ± 10%
Hanford Tank 241-C-106: Impact of Cement Reactions on Release of Contaminants from Residual Waste
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2006-01-01
The CH2M HILL Hanford Group, Inc. (CH2M HILL) is producing risk/performance assessments to support the closure of single-shell tanks at the U.S. Department of Energy's Hanford Site. As part of this effort, staff at Pacific Northwest National Laboratory were asked to develop release models for contaminants of concern that are present in residual sludge remaining in tank 241-C-106 (C-106) after final retrieval of waste from the tank. Initial work to produce release models was conducted on residual tank sludge using pure water as the leaching agent. The results were reported in an earlier report. The decision has now been made to close the tanks after waste retrieval with a cementitious grout to minimize infiltration and maintain the physical integrity of the tanks. This report describes testing of the residual waste with a leaching solution that simulates the composition of water passing through the grout and contacting the residual waste at the bottom of the tank.
Tank 241-BY-106 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106
Tank 241-B-106 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-B-106
Tank 241-BY-106 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-106 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-106 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank characterization report for single-shell tank 241-T-106
International Nuclear Information System (INIS)
Jo, J.
1996-03-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-T-106. This report supports the requirements of Tri-Party Agreement Milestone M-44-09
Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102
Energy Technology Data Exchange (ETDEWEB)
BRIGGS, S.R.
2000-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS.
Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102
International Nuclear Information System (INIS)
BRIGGS, S.R.
2000-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS
Tank characterization report for single-shell tank 241-U-106
International Nuclear Information System (INIS)
Brown, T.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-U-106. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-U-106 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 of this report summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations regarding safety status and additional sampling. The appendixes contain supporting data and information. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ikology et al. 1996), Milestone M-44-10
Tank characterization report for single-shell tank 241-U-106
Energy Technology Data Exchange (ETDEWEB)
Brown, T.M.
1997-04-15
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-U-106. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-U-106 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 of this report summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations regarding safety status and additional sampling. The appendixes contain supporting data and information. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ikology et al. 1996), Milestone M-44-10.
Energy Technology Data Exchange (ETDEWEB)
LOCKREM, L.L.
1999-08-13
This data package presents sampling data and analytical results from the March 28, 1999, vapor sampling of Hanford Site single-shell tank 241-C-106 during active sluicing. Samples were obtained from the 296-C-006 ventilation system stack and ambient air at several locations. Characterization Project Operations (CPO) was responsible for the collection of all SUMMATM canister samples. The Special Analytical Support (SAS) vapor team was responsible for the collection of all triple sorbent trap (TST), sorbent tube train (STT), polyurethane foam (PUF), and particulate filter samples collected at the 296-C-006 stack. The SAS vapor team used the non-electrical vapor sampling (NEVS) system to collect samples of the air, gases, and vapors from the 296-C-006 stack. The SAS vapor team collected and analyzed these samples for Lockheed Martin Hanford Corporation (LMHC) and Tank Waste Remediation System (TWRS) in accordance with the sampling and analytical requirements specified in the Waste Retrieval Sluicing System Vapor Sampling and Analysis Plan (SAP) for Evaluation of Organic Emissions, Process Test Phase III, HNF-4212, Rev. 0-A, (LMHC, 1999). All samples were stored in a secured Radioactive Materials Area (RMA) until the samples were radiologically released and received by SAS for analysis. The Waste Sampling and Characterization Facility (WSCF) performed the radiological analyses. The samples were received on April 5, 1999.
Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds
Tank 241-U-106, cores 147 and 148, analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Steen, F.H.
1996-09-27
This document is the final report deliverable for tank 241-U-106 push mode core segments collected between May 8, 1996 and May 10, 1996 and received by the 222-S Laboratory between May 14, 1996 and May 16, 1996. The segments were subsampled and analyzed in accordance with the Tank 241-U-106 Push Mode Core Sampling and analysis Plan (TSAP), the Historical Model Evaluation Data Requirements (Historical DQO), Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) and the Safety Screening Data Quality Objective (DQO). The analytical results are included in Table 1.
Project W-320 acceptance test report for AY-farm electrical distribution
International Nuclear Information System (INIS)
Bevins, R.R.
1998-01-01
This Acceptance Test Procedure (ATP) has been prepared to demonstrate that the AY-Farm Electrical Distribution System functions as required by the design criteria. This test is divided into three parts to support the planned construction schedule; Section 8 tests Mini-Power Pane AY102-PPI and the EES; Section 9 tests the SSS support systems; Section 10 tests the SSS and the Multi-Pak Group Control Panel. This test does not include the operation of end-use components (loads) supplied from the distribution system. Tests of the end-use components (loads) will be performed by other W-320 ATPs
Engineering study of tank leaks related to hydraulic retrieval of sludge from tank 241-C-106
International Nuclear Information System (INIS)
Lowe, S.S.; Carlos, W.C.; Irwin, J.J.; Khaleel, R.; Kline, N.W.; Ludowise, J.D.; Marusich, R.M.; Rittman, P.D.
1993-01-01
This study evaluates hydraulic retrieval (sluicing) of the waste in single-shell tank 241-C-106 with respect to the likelihood of tank leaks, gross volumes of potential leaks, and their consequences. A description of hydraulic retrieval is developed to establish a baseline for the study. Leak models are developed based on postulated leak mechanisms to estimate the amount of waste that could potentially leak while sluicing. Transport models describe the movement of the waste constituents in the surrounding soil and groundwater after a leak occurs. Environmental impact and risk associated with tank leaks are evaluated. Transport of leaked material to the groundwater is found to be dependent on the rate of recharge of moisture in the soil for moderate-sized leaks. Providing a cover over the tank and surrounding area would eliminate the recharge. The bulk of any leaked material would remain in the vicinity of the tank for remedial action
International Nuclear Information System (INIS)
Reynolds, D.A.
1997-01-01
New data on tank 241-C-106 were obtained from grab sampling and from compatibility testing of tank C-106 and tank AY-102 wastes. All chemistry-associated and other compatibility Information compiled in this report strongly suggests that the sluicing of the contents of tank C-106, in accord with appropriate controls, will pose no unacceptable risk to workers, public safety, or the environment. In addition, it is expected that the sluicing operation will successfully resolve the High-Heat Safety Issue for tank C-106
Vapor and gas sampling of single-shell tank 241-S-106 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-S-106. This document presents In Situ vapor Sampling System (ISVS) data resulting from the June 13, 1996 sampling of SST 241-S-106. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which'supplied and analyzed the sample media
Tank 241-U-106 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
This report presents the details of the Hanford waste tank characterization study for tank 241-U-106. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected to determine the potential risks to tank farm workers due to fugitive emissions from the tank
Biosorption of radionuclide Americium-241 by A. niger spore and hyphae
International Nuclear Information System (INIS)
Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling
2002-01-01
The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident
Tank 241-SX-106 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
This report presents the details of the Hanford waste tank characterization study for tank 241-SX-106. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedure that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to tank farm workers due to fugitive emissions from the tank
International Nuclear Information System (INIS)
LOCKREM, L.L.
1999-01-01
This data package presents sampling data and analytical results from the March 28, 1999, vapor sampling of Hanford Site single-shell tank 241-C-106 during active sluicing. Samples were obtained from the 296-C-006 ventilation system stack and ambient air at several locations. Characterization Project Operations (CPO) was responsible for the collection of all SUMMATM canister samples. The Special Analytical Support (SAS) vapor team was responsible for the collection of all triple sorbent trap (TST), sorbent tube train (STT), polyurethane foam (PUF), and particulate filter samples collected at the 296-C-006 stack. The SAS vapor team used the non-electrical vapor sampling (NEVS) system to collect samples of the air, gases, and vapors from the 296-C-006 stack. The SAS vapor team collected and analyzed these samples for Lockheed Martin Hanford Corporation (LMHC) and Tank Waste Remediation System (TWRS) in accordance with the sampling and analytical requirements specified in the Waste Retrieval Sluicing System Vapor Sampling and Analysis Plan (SAP) for Evaluation of Organic Emissions, Process Test Phase III, HNF-4212, Rev. 0-A, (LMHC, 1999). All samples were stored in a secured Radioactive Materials Area (RMA) until the samples were radiologically released and received by SAS for analysis. The Waste Sampling and Characterization Facility (WSCF) performed the radiological analyses. The samples were received on April 5, 1999
Project W-030 safety class upgrade summary report
International Nuclear Information System (INIS)
Kriskovich, J.R.
1998-01-01
This document presents a summary of safety class criteria for the 241-AY/AZ Tank Farm primary ventilation system upgrade under Project W-030, and recommends acceptance of the system as constructed, based on a review of supporting documentation
International Nuclear Information System (INIS)
Park, Gwi Tae; Lee, Sang Rak
1998-01-01
This book is divided into four parts, which introduces TMS320C31 with C language. The first part deals with digital signal processor on what is DPS?, types of DPS and structure of TMS320C31. The second part introduces program development by C language, cstartup cord and C compiler. The third part describes OS30, Emile 30 and BIOS. The last part is for application board design of T31 and test examples of T31 board : external flag test, ram test, external read port test and communication test.
AX Tank Farm waste retrieval alternatives cost estimates
International Nuclear Information System (INIS)
Krieg, S.A.
1998-01-01
This report presents the estimated costs associated with retrieval of the wastes from the four tanks in AX Tank Farm. The engineering cost estimates developed for this report are based on previous cost data prepared for Project W-320 and the HTI 241-C-106 Heel Retrieval System. The costs presented in this report address only the retrieval of the wastes from the four AX Farm tanks. This includes costs for equipment procurement, fabrication, installation, and operation to retrieve the wastes. The costs to modify the existing plant equipment and systems to support the retrieval equipment are also included. The estimates do not include operational costs associated with pumping the waste out of the waste receiver tank (241-AY-102) between AX Farm retrieval campaigns or transportation, processing, and disposal of the retrieved waste
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24
International Nuclear Information System (INIS)
Rieck, C.A.
1996-02-01
This document provides a description of work for the design and construction of a waste retrieval system for Tank 241-SY-102. The description of work includes a working estimate and schedule, as well as a narrative description and sketches of the waste retrieval system. The working estimate and schedule are within the established baselines for the Tank 241-SY-102 retrieval system. The technical baseline is provided in Functional Design Criteria, WHC-SD-W211-FDC-001, Revision 2
International Nuclear Information System (INIS)
Yun, Deok Yong
1999-06-01
The contents of this book are explanation of basic conception for DSP, perfect a complete master of TMS320C31, I/O interface design and memory, practice with PC print port, basic programing skill, assembly and C programing technique, timer and interrupt application skill, serial communication programing technique, application of digital conditioning and application of digital servo control. This book is divided into two parts, which is about TMS320C31 master of theory and application.
Ferrocyanide Safety Program: Thermal analysis of Tank 241-BY-106
International Nuclear Information System (INIS)
McLaren, J.M.
1993-05-01
An analysis was conducted of tank 241-BY-106 to determine the conditions required for an uneven distribution of heat generation (e.g., a hotspot) that would produce temperatures of concern (considered to be 220 degree C [418 degree F]). Two types of hotspots were investigated. One was 1 meter square, 7.62 cm (3 in.) thick, that was placed on the bottom of the tank two-thirds of the radial distance from the center to the edge of the tank. The other was a 1 meter cube placed in the same location. It was found that the concentrations of heat-producing material required to reach a maximum temperature of 220 degree C (418 degree F) were greater than 160 times that of the material surrounding the hotspot. A transient case was also studied, where a hotspot was formed over 5 years. The 1 meter cube hotspot was used. It was determined that the maximum temperature reached was less than the steady-state analysis under the same conditions. The maximum temperature was reached in 5.5 years. The change in the surface temperature was slow enough that the hotspot could not be detected in less than 3 years. The steady-state analysis showed that a large pattern of thermocouple trees would be required to detect a hotspot by this means. The steady-state analysis showed that a hotspot with temperatures that approached 220 degree C (418 degree F) could probably be detected by surface temperature measurements
Design review report for ecn 638521 (241-SX-106 cover plate installation)
Energy Technology Data Exchange (ETDEWEB)
MCVEY, C.B.
1998-10-01
The design for the cover plates on 241-SX-106 was reviewed on 9/10/98. All comments were resolved to the satisfaction of the reviewers. A design calculation for seismic movement was performed and resulted the a design addition to prevent cover block movement. Also calculations were performed for radiological design and are included. The formal design review has no outstanding action items remaining and supports the use of 2 inch steel cover plates to provide personnel shielding and spray knock down protection (as required by the BIO).
Software pi/4 DQPSK Modem: A Student Project Using the TMS320-C6201 EVM Board
Weiss, S; Braithwaite, SJ; Stewart, RD
2000-01-01
This paper reports on a student project performed at the University of Southampton jointly by 4th year MEng students within the course "Advanced Radio Communications". The aim was to design a software modem capable of transmitting 16kb/s of data, whereby random number generation, advanced modulation, pulse shaping, synchronisation, and error counting techniques had to be applied. The ultimate aim was the implementation on a Texas Instruments TMS320-C6201 EVM board, which dictated some of the ...
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.
2007-09-13
As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.
High-level waste leakage from the 241-T-106 tank at Hanford
International Nuclear Information System (INIS)
Routson, R.C.; Price, W.H.; Brown, D.J.; Fecht, K.R.
1979-02-01
The history, status, fate, and impact of the 4.34 x 10 5 -liter (115,000-gal) radioactive waste tank leak from the 241-T-106 tank have been studied since 1973. As of May 1978, the maximum detected depth of the 1-microcurie per liter (μCi/l) concentration of 106 Ru penetration was 33 meters (108 ft) below the ground surface or 29 meters (95 ft) above the regional water table. This maximum depth of penetration was detected in two of the dry wells in the 241-T tank farm. In no other well has radioactivity greater than 1.0-μCi/l been found deeper than 29 meters (95 ft). This is approximately 43% of the distance from the bottom of the tank to the water table. The maximum horizontal movement of the 1-μCi/l 106 Ru concentration front from the tank was approximately 23 meters (75 ft) at a depth of 25 meters (82 ft). This distance is approximately equal to the diameter of the tank. The rate of frontal movement of radioactivity was qualitatively estimated. A large portion of the movement occurred in 1973, prior to the publication of an initial tank leak status report. From 1973 to 1974, detectable lateral movement occurred in at least some sediment layers. From 1974 to 1978, movement could not generally be detected. However, migration in wells near the leak perimeter was detected in 1978, and the probable cause defined. Calculations on vadose zone moisture and wetting frontal movement were found to be essentially in qualitative agreement in their assessed lack of movement of any waste above concentration guidelines to the Hanford ground water. Thus, during the hazardous lifetime of the fission products, there will likely be no amount of radioactivity enter the Hanford ground water. Therefore, there appears to be no impact of the leak on the Columbia River
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
Software configuration plan for the 1,000 CFM portable exhauster's small logic control system
International Nuclear Information System (INIS)
Kaiser, T.D.
1998-01-01
This document describes the formal documentation for maintaining the control system associated with the 1,000 CFM portable exhauster's. The objective of the software configuration control plan is to provide assurances that the portable exhauster's control system will be operable for the duration of 241-C-106 and 241-AY-102 operations (project 320). The design was based upon the criteria documented in the portable exhauster functional design criteria (HNF-SD-WM-DB-035) and procurement specification (HNF-S-0490) for the exhauster interlock systems
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
The purpose of the test was to verify that the AN Tank Farm Manifold Valves can be manually manipulated to the required operating position and that the electrical and visual indications accurately reflect that position. Physical locking devices were also verified to function. The Acceptance Test Procedure HNF-4642, 241-AN-A Valve Pit Manifold Valves and Position Indication was conducted between 23 June and 10 August 1999 at the 200E AN Tank Farm. The test has no open test exceptions. The test was conducted prior to final engineering ''as built'' activities being completed, this had an impact on the procedure and test results, ECN 653752 was written to correct the mismatch between the procedure and actual field conditions. P and ID H-14-100941 was changed via ECN-W-314-4C-120. All components, identified in the procedure, were not found to be labeled and identified as written in the procedure, temporary tags were used for operational identification. A retest of valve ANA-WT-V 318 was required because it was removed from its installed position and modified after testing was completed
Engineering study for ISSTRS design concept
Energy Technology Data Exchange (ETDEWEB)
Hertzel, J.S.
1997-01-31
Los Alamos Technical Associates, Inc., is pleased to transmit the attached Conceptual Design Package for the Initial Single Shell Tank Retrieval System (ISSTRS), 90% Conceptual Design Review. The package includes the following: (1) ISSTRS Trade Studies: (a) Retrieval Facility Cooling Requirements; (b) Equipment Re-usability between Project W-320 and Tanks 241-C-103 and 241-C-1 05; (c) Sluice Line Options; and (d) Options for the Location of Tanks AX-103 and A-1 02 HVAC Equipment; (2) Drawings; (3) Risk Management Plan; (4) 0850 Interface Control Document; (5) Requirements Traceability Report; and (6) Project Design Specification.
International Nuclear Information System (INIS)
King, C.M.; Bryan, S.A.
1999-01-01
This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature
Energy Technology Data Exchange (ETDEWEB)
Mahoney, L.A.; Antoniak, Z.I.; Bates, J.M.
1997-12-01
This report provides the results obtained for the single-shell tanks (SSTs) sampled with the Retained Gas Sampler (RGS) during 1997: Tanks 241-U-103, 241-S-106, 241-BY-101, and 241-BY-109. The RGS is a modified version of the core sampler used at Hanford. It is designed specifically to be used in concert with the gas extraction equipment in the hot cell to capture and extrude a gas-containing waste sample in a hermetically sealed system. The four tanks represent several different types of flammable gas SSTs. Tank U-103 is on the Flammable Gas Watch List (FGWL) and is one of the highest-priority group of SSTs that show evidence of significant gas retention. Tank S-106, though not a FGWL tank, has a uniquely high barometric pressure response and continuing rapid surface level rise, indicating a large and increasing volume of retained gas. Tanks BY-101 and BY-109 are not on the FGWL but were chosen to test the effect of recent salt-well pumping on gas retention. Section 2 of this report provides an overview of the process by which retained gases in the Hanford tanks are sampled and analyzed. A detailed description of the procedure used to reduce and analyze the data is provided in Section 3. Tank-by-tank results are covered in Section 4 (with the data presented in the order in which the tanks were sampled), and an RGS system performance overview is given in Section 5. Section 6 presents conclusions from these analyses and recommendations for further research. The cited references are listed in Section 7. Appendix A describes the procedures used to extract gas and ammonia from the samples, Appendix B contains detailed laboratory data from each of the tanks, and Appendix C gives field sampling data.
International Nuclear Information System (INIS)
Mahoney, L.A.; Antoniak, Z.I.; Bates, J.M.
1997-12-01
This report provides the results obtained for the single-shell tanks (SSTs) sampled with the Retained Gas Sampler (RGS) during 1997: Tanks 241-U-103, 241-S-106, 241-BY-101, and 241-BY-109. The RGS is a modified version of the core sampler used at Hanford. It is designed specifically to be used in concert with the gas extraction equipment in the hot cell to capture and extrude a gas-containing waste sample in a hermetically sealed system. The four tanks represent several different types of flammable gas SSTs. Tank U-103 is on the Flammable Gas Watch List (FGWL) and is one of the highest-priority group of SSTs that show evidence of significant gas retention. Tank S-106, though not a FGWL tank, has a uniquely high barometric pressure response and continuing rapid surface level rise, indicating a large and increasing volume of retained gas. Tanks BY-101 and BY-109 are not on the FGWL but were chosen to test the effect of recent salt-well pumping on gas retention. Section 2 of this report provides an overview of the process by which retained gases in the Hanford tanks are sampled and analyzed. A detailed description of the procedure used to reduce and analyze the data is provided in Section 3. Tank-by-tank results are covered in Section 4 (with the data presented in the order in which the tanks were sampled), and an RGS system performance overview is given in Section 5. Section 6 presents conclusions from these analyses and recommendations for further research. The cited references are listed in Section 7. Appendix A describes the procedures used to extract gas and ammonia from the samples, Appendix B contains detailed laboratory data from each of the tanks, and Appendix C gives field sampling data
Interband transitions in 106Pd, 152Sm, 152Gd and 182W
International Nuclear Information System (INIS)
Kartashov, V.M.; Oborovskij, A.I.; Troitskaya, A.G.
1990-01-01
Internal transitions in 106 Pd, 152 Sm, 152 Gd, 182 W nuclei, observed during decay of 152,152m Eu, 182,183 Ta, 106m Ag, are studied. The experimental characteristics of E0-transitions and E0-components of E0+M1+E2 type transitions in the studied nuclei, relative intensities of internal conversion electron lines during 182 Ta decay, multipolar composition and forbidden factor for 182 W and 183 W low-energy transitions, characteristics of transitions are presented
Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code
International Nuclear Information System (INIS)
Antoniak, Z.I.; Recknagle, K.P.
1995-07-01
The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
Test plan for Enraf Series 854 level gauge testing in Tank 241-S-106
International Nuclear Information System (INIS)
Barnes, G.A.
1994-01-01
An Enraf Series 854 level gauge was installed on Tank 241-S-106 (S-106) during the first week of June 1994. On August 11, 1994, the gauge's measuring wire broke. An investigation has been started to determine how the wire broke. This test plan identifies a qualification test that is part of this investigation. This test will also provide evidence as to the location and extent of potential corrosion on the measuring wire due to tank environment. The results from this testing will provide data for better material selections. This test will involve placing the existing Enraf Series 854 level gauge back into service with the same type of measuring wire (316 stainless steel) that originally broke on August 11, 1994. The gauge will be operated for 14 days. At the end of the 14-day test, the wire shall be sent to Pacific Northwest Laboratory (PNL) for analysis
Tank characterization data report: Tank 241-C-112
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.
Tank characterization data report: Tank 241-C-112
International Nuclear Information System (INIS)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable
Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2014-09-04
This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Sorption of 241Am by Aspergillus niger spore and hyphae
International Nuclear Information System (INIS)
Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao
2004-01-01
Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)
Qualification test for the Flexible Receiver. Revision 1
International Nuclear Information System (INIS)
Keller, C.M.
1994-01-01
This document provides the test plan and procedures to certify and design verify the 42 in. and 4 in. -- 6 in. Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and Az-101
TWRS privatization support project waste characterization database development
International Nuclear Information System (INIS)
1995-11-01
Pacific Northwest National Laboratory requested support from ICF Kaiser Hanford Company in assembling radionuclide and chemical analyte sample data and inventory estimates for fourteen Hanford underground storage tanks: 241-AN-102, -104, -105, -106, and -107, 241-AP-102, -104, and -105, 241-AW-101, -103, and -105, 241 AZ-101 and -102; and 241-C-109. Sample data were assembled for sixteen radionuclides and thirty-five chemical analytes. The characterization data were provided to Pacific Northwest National Laboratory in support of the Tank Waste Remediation Services Privatization Support Project. The purpose of this report is to present the results and document the methodology used in preparing the waste characterization information data set to support the Tank Waste Remediation Services Privatization Support Project. This report describes the methodology used in assembling the waste characterization information and how that information was validated by a panel of independent technical reviewers. Also, contained in this report are the various data sets created: the master data set, a subset, and an unreviewed data set. The master data set contains waste composition information for Tanks 241-AN-102 and -107, 241-AP-102 and -105, 241-AW-101; and 241-AZ-101 and -102. The subset contains only the validated analytical sample data from the master data set. The unreviewed data set contains all collected but unreviewed sample data for Tanks 241-AN-104, -105, and -106; 241-AP-104; 241-AW-103 and-105; and 241-C-109. The methodology used to review the waste characterization information was found to be an accurate, useful way to separate the invalid or questionable data from the more reliable data. In the future, this methodology should be considered when validating waste characterization information
Energy Technology Data Exchange (ETDEWEB)
RIECK, C.A.
1999-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability
Project W-314 specific test and evaluation plan for SN-633 transfer line (241-AX-B to 241-AY-02A)
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-633 transfer line by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP). This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the addition of transfer line SN-633. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the transfer line addition. The STEP will be utilized in conjunction with the TEP for verification and validation
Qualification test for the flexible receiver. Revision 2
Energy Technology Data Exchange (ETDEWEB)
Tedeschi, D.J.
1994-12-12
This document provides the test plan and procedures to certify and design verify the 42{double_prime} and 4{double_prime}-6{double_prime} Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and AZ-101.
Qualification test for the flexible receiver. Revision 2
International Nuclear Information System (INIS)
Tedeschi, D.J.
1994-01-01
This document provides the test plan and procedures to certify and design verify the 42 double-prime and 4 double-prime-6 double-prime Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and AZ-101
Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-07-30
This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Project management plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1995-01-01
This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service
Energy Technology Data Exchange (ETDEWEB)
FULLER, R.K.
1999-02-23
This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.
International Nuclear Information System (INIS)
FULLER, R.K.
1999-01-01
This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document
Biosorption of americium-241 by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali
2003-01-01
As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)
Evaluation of tank waste transfers at 241-AW tank farm
International Nuclear Information System (INIS)
Willis, W.L.
1998-01-01
A number of waste transfers are needed to process and feed waste to the private contractors in support of Phase 1 Privatization. Other waste transfers are needed to support the 242-A Evaporator, saltwell pumping, and other ongoing Tank Waste Remediation System (TWRS) operations. The purpose of this evaluation is to determine if existing or planned equipment and systems are capable of supporting the Privatization Mission of the Tank Farms and continuing operations through the end of Phase 1B Privatization Mission. Projects W-211 and W-314 have been established and will support the privatization effort. Equipment and system upgrades provided by these projects (W-211 and W-314) will also support other ongoing operations in the tank farms. It is recognized that these projects do not support the entire transfer schedule represented in the Tank Waste Remediation system Operation and Utilization Plan. Additionally, transfers surrounding the 241-AW farm must be considered. This evaluation is provided as information, which will help to define transfer paths required to complete the Waste Feed Delivery (WFD) mission. This document is not focused on changing a particular project, but it is realized that new project work in the 241-AW Tank Farm is required
2010-03-04
... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...
Vapor space characterization of waste Tank 241-SX-106: Results from samples collected on 3/24/95
International Nuclear Information System (INIS)
Klinger, G.S.; Clauss, T.W.; Litgotke, M.W.
1995-11-01
This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-SX-106 (referred to as Tank SX-106). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, 4 were observed above the 5-ppbv reporting cutoff. Three tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. The 7 organic analytes identified are listed in Table 1 and account for approximately 100% of the total organic components in Tank SX-106. Carbon dioxide (CO 2 ) was the only permanent gas detected. Tank SX-106 is on the Ferrocyanide Watch List
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-10-28
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-01-01
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy
Energy Technology Data Exchange (ETDEWEB)
DEXTER, M.L.
1999-11-15
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.
International Nuclear Information System (INIS)
DEXTER, M.L.
1999-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year
International Nuclear Information System (INIS)
Evans, J.C.; Pool, K.H.; Thomas, B.L.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-S-106 (Tank S-106) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in the same table. Detailed descriptions of the analytical results appear in the appendices
International Nuclear Information System (INIS)
Boes, K.A.
1998-01-01
This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's AN Valve Pit Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314, Tank Farm Restoration and Safe Operations, is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farms' waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first package to be performed is the AN Valve Pit Upgrades package. The scope of the modifications includes new pit cover blocks, valve manifolds, leak detectors, transfer line connections (for future planned transfer lines), and special protective coating for the 241-AN-A and 241-AN-B valve pits
Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102
International Nuclear Information System (INIS)
CONNER, J.M.
1999-01-01
High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)
Bench-scale enhanced sludge washing and gravity settling of Hanford Tank C-106 Sludge
International Nuclear Information System (INIS)
Brooks, K.P.; Myers, R.L.; Rappe, K.G.
1997-01-01
This report summarizes the results of a bench-scale sludge pretreatment demonstration of the Hanford baseline flowsheet using liter-quantities of sludge from Hanford Site single-shell tank 241-C-106 (tank C-106). The leached and washed sludge from these tests provided Envelope D material for the contractors supporting Tank Waste Remediation System (TWRS) Privatization. Pretreatment of the sludge included enhanced sludge washing and gravity settling tests and providing scale-up data for both these unit operations. Initial and final solids as well as decanted supernatants from each step of the process were analyzed chemically and radiochemically. The results of this work were compared to those of Lumetta et al. (1996a) who performed a similar experiment with 15 grams of C-106, sludge. A summary of the results are shown in Table S.1. Of the major nonradioactive components, those that were significantly removed with enhanced sludge washing included aluminum (31%), chromium (49%), sodium (57%), and phosphorus (35%). Of the radioactive components, a significant amount of 137 Cs (49%) were removed during the enhanced sludge wash. Only a very small fraction of the remaining radionuclides were removed, including 90 Sr (0.4%) and TRU elements (1.5%). These results are consistent with those of the screening test. All of the supernatants (both individually and as a blend) removed from these washing steps, once vitrified as LLW glasses (at 20 wt% Na 2 O), would be less than NRC Class C in TRU elements and less than NRC Class B in 90 Sr
International Nuclear Information System (INIS)
Ligotke, M.W.; Lucke, R.B.; Pool, K.H.
1995-10-01
This report describes inorganic and organic analyses results from in situ samples obtained from the headspace of the Hanford waste storage Tank 241-U-106 (referred to as Tank U-106). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not performed. In addition, the authors looked for the 39 TO-14 compounds plus an additional 14 target analytes. Of these, six were observed above the 5-ppbv reporting cutoff. Ten organic tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv in two or more of the three samples collected and are reported with concentrations that are semiquantitative estimates based on internal standard response factors. The 10 organic analytes with the highest estimated concentrations are listed in Table 1 and account for approximately 89% of the total organic components in Tank U-106. Methyl isocyanate, a compound of possible concern in Tank U-106, was not detected. Tank U-106 is on the Organic Watch List
Computer software configuration description, 241-AY and 241-AZ tank farm MICON automation system
International Nuclear Information System (INIS)
Winkelman, W.D.
1998-01-01
This document describes the configuration process, choices and conventions used during the Micon DCS configuration activities, and issues involved in making changes to the configuration. Includes the master listings of the Tag definitions, which should be revised to authorize any changes. Revision 3 provides additional information on the software used to provide communications with the W-320 project and incorporates minor changes to ensure the document alarm setpoint priorities correctly match operational expectations
Inorganic, radioisotopic and organic analysis of 241-AP-101 tank waste
International Nuclear Information System (INIS)
SK Fiskum; PR Bredt; JA Campbell; LR Greenwood; OT Farmer; GJ Lumetta; GM Mong; RT Ratner; CZ Soderquist; RG Swoboda; MW Urie; JJ Wagner
2000-01-01
Battelle received five samples from Hanford waste tank 241-AP-101, taken at five different depths within the tank. No visible solids or organic layer were observed in the individual samples. Individual sample densities were measured, then the five samples were mixed together to provide a single composite. The composite was homogenized and representative sub-samples taken for inorganic, radioisotopic, and organic analysis. All analyses were performed on triplicate sub-samples of the composite material. The sample composite did not contain visible solids or an organic layer. A subsample held at 10 C for seven days formed no visible solids. The characterization of the 241-AP-101 composite samples included: (1) Inductively-coupled plasma spectrometry for Ag, Al, Ba, Bi, Ca, Cd, Cr, Cu, Fe, K, La, Mg, Mn, Na, Nd, Ni, P, Pb, Pd, Ru, Rh, Si, Sr, Ti, U, Zn, and Zr (Note: Although not specified in the test plan, As, B, Be, Co, Li, Mo, Sb, Se, Sn, Tl, V, W, and Y were also measured and reported for information only) (2) Radioisotopic analyses for total alpha and total beta activities, 3 H, 14 C, 60 Co, 79 Se, 90 Sr, 99 Tc as pertechnetate, 106 Ru/Rh, 125 Sb, 134 Cs, 137 Cs, 152 Eu, 154 Eu, 155 Eu, 238 Pu, 239+240 Pu, 241 Am, 242 Cm, and 243+244 Cm; (3) Inductively-coupled plasma mass spectrometry for 237 Np, 239 Pu, 240 Pu, 99 Tc, 126 Sn, 129 I, 231 Pa, 233 U, 234 U, 235 U, 236 U, 238 U, 241 AMU, 242 AMU, 243 AMU, As, B, Be, Ce, Co, Cs, Eu, I, Li, Mo, Pr, Rb, Sb, Se, Ta, Te, Th, Tl, V, and W; (4) total U by kinetic phosphorescence analysis; (5) Ion chromatography for Cl, F, NO 2 , NO 3 , PO 4 , SO 4 , acetate, formate, oxalate, and citrate; (6) Density, inorganic carbon and organic carbon by two different methods, mercury, free hydroxide, ammonia, and cyanide. The 241-AP-101 composite met all contract limits (molar ratio of analyte to sodium or ratio of becquerels of analyte to moles of sodium) defined in Specification 7 for Envelope A. Except for a few cases, the
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2007-05-23
This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Energy Technology Data Exchange (ETDEWEB)
Serne, R. Jeffrey; Bjornstad, Bruce N.; Horton, Duane G.; Lanigan, David C.; Schaef, Herbert T.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Geiszler, Keith N.; Baum, Steven R.; Valenta, Michelle M.; Kutnyakov, Igor V.; Vickerman, Tanya S.; Orr, Robert D.; Brown, Christopher F.
2008-09-11
This report was revised in September 2008 to remove acid-extractable sodium data from Tables 4.8, 4.28, and 4.52. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in September 2004. The overall goal of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities at Hanford. To meet this goal, CH2M HILL Hanford Group, Inc. tasked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediments from within Waste Management Area (WMA) T-TX-TY. This report is the second of two reports written to present the results of these analyses. Specifically, this report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from boreholes C4104 and C4105 in the T Tank Farm, and from borehole 299-W-11-39 installed northeast of the T Tank Farm. Finally, the measurements on sediments from borehole C4104 are compared with a nearby borehole drilled in 1993, 299- W10-196, through the tank T-106 leak plume.
Generation of 320 mW at 10.20 μm based on CdSe long-wave infrared crystal
Wang, Jian; Yuan, Ligang; Zhang, Yingwu; Chen, Guo; Cheng, Hongjuan; Gao, Yanzhao
2018-06-01
CdSe single crystal, with the sizes of ∼54 mm in diameter and ∼25 mm in length, was grown by a high pressure vertical gradient freeze (HPVGF) technique using (0 0 1)-oriented seed. The CdSe crystal was characterized with transmission spectrophotometer. The transmission spectra showed that the infrared transmission was above 68% and the mean absorption coefficient was 0.041 cm-1 in the range of 2.5-20 μm. Using fabricated CdSe crystal with the dimensions of 6 mm × 10 mm × 44 mm, we demonstrated an optical parametric oscillator (OPO) pumped by a 2.05 μm Ho:YLF laser at a pulse repetition frequency of 5 kHz. Up to 320 mW output was obtained at the idler wavelength of 10.20 μm with a pump power of 18.06 W. 320 mW at 10.20 μm, to our knowledge, was the highest power obtained with a 2.05 μm laser-pumped CdSe OPO.
Directory of Open Access Journals (Sweden)
Bohannon Sean B
2004-12-01
Full Text Available Abstract Background Homozygosity or compound heterozygosity for coding region mutations of the hemojuvelin gene (HJV in whites is a cause of early age-of-onset iron overload (juvenile hemochromatosis, and of hemochromatosis phenotypes in some young or middle-aged adults. HJV coding region mutations have also been identified recently in African American primary iron overload and control subjects. Primary iron overload unexplained by typical hemochromatosis-associated HFE genotypes is common in white and black adults in Alabama, and HJV I222N and G320V were detected in a white Alabama juvenile hemochromatosis index patient. Thus, we estimated the frequency of the HJV missense mutations I222N and G320V in adult whites and African Americans from Alabama general population convenience samples. Methods We evaluated the genomic DNA of 241 Alabama white and 124 African American adults who reported no history of hemochromatosis or iron overload to detect HJV missense mutations I222N and G320V using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP technique. Analysis for HJV I222N was performed in 240 whites and 124 African Americans. Analysis for HJV G320V was performed in 241 whites and 118 African Americans. Results One of 240 white control subjects was heterozygous for HJV I222N; she was also heterozygous for HFE C282Y, but had normal serum iron measures and bone marrow iron stores. HJV I222N was not detected in 124 African American subjects. HJV G320V was not detected in 241 white or 118 African American subjects. Conclusions HJV I222N and G320V are probably uncommon causes or modifiers of primary iron overload in adult whites and African Americans in Alabama. Double heterozygosity for HJV I222N and HFE C282Y may not promote increased iron absorption.
Design review report: 200 East upgrades for Project W-314, tank farm restoration and safe operations
International Nuclear Information System (INIS)
Boes, K.A.
1998-01-01
This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's 200 East (200E) Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314 is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farm waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first design package (AN Valve Pit Upgrades) was completed in November 1997, and the associated design verification activities are documented in HNF-1893. The second design package, 200 East (200E) Upgrades, was completed in March 1998. This design package identifies modifications to existing valve pits 241-AX-B and 241-A-B, as well as several new waste transfer pipelines to be constructed within the A Farm Complex of the 200E Area. The scope of the valve pit modifications includes new pit cover blocks, valve
International Nuclear Information System (INIS)
Hays, W.H.
1998-01-01
This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the installation of the SN-635 transfer line for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-635 transfer line and the tie in of SN-633 to the AY-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)
TWRS privatization support project waste characterization database development. Volume 1
International Nuclear Information System (INIS)
Brevick, C.H.
1995-11-01
Pacific Northwest National Laboratory requested support from ICF Kaiser Hanford Company in assembling radionuclide and chemical analyte sample data and inventory estimates for fourteen Hanford under-ground storage tanks: 241-AN-102, -104, -105, -106, and -107, 241-AP-102, -104, and -105; 241-AW-101, -103, and -105, 241-AZ-101 and-102; and 241-C-109. Sample data were assembled for sixteen radio nuclides and thirty five chemical analytes. The characterization data were provided to Pacific Northwest National Laboratory in support of the Tank Waste Remediation Services Privatization Support Project. The purpose of this report is to present the results and document the methodology used in preparing the waste characterization information data set to support the Tank Waste Remediation Services Privatization Support Project. This report describes the methodology used in assembling the waste characterization information and how that information was validated by a panel of independent technical reviewers. Also, contained in this report are the various data sets created., the master data set, a subset, and an unreviewed data set
Tank 241-C-101 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-101
Tank 241-C-105 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-105
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
International Nuclear Information System (INIS)
Wilson, T.R.; Hanson, C.
1994-01-01
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
Energy Technology Data Exchange (ETDEWEB)
Wilson, T.R.; Hanson, C.
1994-10-03
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.
Tank 241-C-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in Program Plan for the Resolution of Tank Vapor Issues (Osborne and Huckaby 1994). Tank 241-C-108 was vapor sampled in accordance with Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution (Osborne et al., 1994)
Tank 241-C-104 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-104 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-104 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103
International Nuclear Information System (INIS)
Kos, S.E.
1995-12-01
Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked
Thermal stability of the C106 dye in robust electrolytes
DEFF Research Database (Denmark)
Lund, Torben; Phuong, Nguyen Tuyet; Pechy, Peter
-MPN) introduced by Gao et al. in 2008. [1]. Figure 1 Thermal degradation of C106 bound to TiO2 at 80 ºC in dark as a function of heating time. ● C106 = RuLL´(NCS)2 ■ RuLL´(NCS)(NBB)+ ▲ RuLL´(NCS)(3-MPN)+ The C106 dye was attached to the surface of TiO2 nano-particles and stable colloidal solutions...... of the particles were prepared in electrolyte mixture B. The solutions were thermally treated at 80 ◦C for 0-2000 hours followed by dye extraction and analysis by HPLC coupled to UV/Vis and electro spray mass spectrometry [2]. Figure 1 shows the concentration profiles of C106 samples prepared under ambient...... and glove box conditions as a function of the heating time. Preparation of the samples under strict atmospheric moisture control in a glove box gives the best results with a steady state surface concentration of 80% intact C106 and 20% NBB substitution product after ~1500 hours of heating at 80 ºC. If dye...
International Nuclear Information System (INIS)
Parazin, R.J.
1998-01-01
This supplement to the Project W-519 Conceptual Design will identify a means to provide RW and Electrical services to serve the needs of the TWRS Privatization Contractor (PC) at AP Tank Farm as directed by DOE-RL. The RW will serve the fire suppression and untreated process water requirements for the PC. The purpose of this CDR supplement is to identify Raw Water (RW) and Electrical service line routes to the TWRS Privatization Contractor (PC) feed delivery tanks, AP-106 and/or AP-108, and establish associated cost impacts to the Project W-519 baseline
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
24 CFR 241.1005 - Definitions.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
International Nuclear Information System (INIS)
Mangeng, C.A.; Thayer, G.R.
1984-05-01
This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues
Safety equipment list for the 241-SY-101 RAPID mitigation project
Energy Technology Data Exchange (ETDEWEB)
MORRIS, K.L.
1999-06-29
This document provides the safety classification for the safety (safety class and safety RAPID Mitigation Project. This document is being issued as the project SEL until the supporting authorization basis documentation, this document will be superseded by the TWRS SEL (LMHC 1999), documentation istlralized. Upon implementation of the authorization basis significant) structures, systems, and components (SSCS) associated with the 241-SY-1O1 which will be updated to include the information contained herein.
Safety equipment list for the 241-SY-101 RAPID mitigation project
International Nuclear Information System (INIS)
Morris, K.L.
1999-01-01
This document provides the safety classification for the safety (safety class and safety RAPID Mitigation Project. This document is being issued as the project SEL until the supporting authorization basis documentation, this document will be superseded by the TWRS SEL (LMHC 1999), documentation istlralized. Upon implementation of the authorization basis significant) structures, systems, and components (SSCS) associated with the 241-SY-1O1 which will be updated to include the information contained herein
International Nuclear Information System (INIS)
Klinger, G.S.; Lucke, R.B.; McVeety, B.D.
1995-07-01
This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-U-106 (referred to as Tank U-106). The results described here were obtained to support safety and toxicological evaluations. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O) Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. The NH 3 concentration was 16% greater than that determined from an ISS sample obtained in August 1994; the H 2 O concentration was about 10% less. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, 5 were observed in two or more canisters above the 5-ppbv reporting cutoff. Eleven organic tentatively identified compounds (TICS) were observed in two or more canisters above the reporting cutoff of (ca.) 10 ppbv and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. The 10 organic analytes with the highest estimated concentrations account for approximately 90% of the total organic components in Tank U-106. Three permanent gases, nitrous oxide (N 2 O), hydrogen (H 2 ) and carbon dioxide (COD were also detected
Solid Phase Characterization of Tank 241-C-105 Grab Samples
International Nuclear Information System (INIS)
Ely, T. M.; LaMothe, M. E.; Lachut, J. S.
2016-01-01
The solid phase characterization (SPC) of three grab samples from single-shell Tank 241-C-105 (C-105) that were received at the laboratory the week of October 26, 2015, has been completed. The three samples were received and broken down in the 11A hot cells.
International Nuclear Information System (INIS)
Sathyanarayana, K.
1997-01-01
This report describes the results of thermal hydraulic analysis performed to provide data in support of Project W-030 to startup new 702-AZ Primary Ventilation System. During the startup of W-030 system, the ventilation system will be operating in bypass mode. In bypass made of operation, the system is capable of supplying 1000 cfm total flow for all four AWF doubleshell tanks. The design of the W-030 system is based on the assumption that both the recirculation loop of the primary ventilation system and the secondary ventilation which provides cooling would be operating. However, during the startup neither the recirculation system nor the secondary ventilation system will be operating. A minimum flow of 100 cfm is required to prevent any flammable gas associated risk. The remaining 600 cfm flow can be divided among the four tanks as necessary to keep the peak sludge temperatures below the operating temperature limit. For the purpose of determining the minimum flow required for cooling each tank, the thermal hydraulic analysis is performed to predict the peak sludge temperatures in AY/AZ tanks under different ventilation flows. The heat load for AZ farm tanks is taken from characterization reports and for the AY farm tanks, the heat load was estimated by thermal analysis using the measured waste temperatures and the waste liquid evaporation rates. The tank 241-AZ-101 and the tank 241-AZ-102 have heat loads of 241,600 and 199,500 Btu/hr respectively. The tank 241-AY-101 and tank 241-AY-102 have heat loads of 41,000 and 33,000 Btu/hr respectively. Using the ambient meteorological conditions of temperature and relative humidity for the air and tank, some soil surface and the sludge levels reported in recent documents, the peak sludge and supernatant temperatures were predicted for various primary ventilation flows ranging from 100 to 400 cfm for AZ tanks and 100 and 150 cfm for AY tanks. The results of these thermal hydraulic analyses are presented. Based on the
Implementation guide for Hanford Tanks Initiative C-106 heel retrieval contract management HNF-2511
International Nuclear Information System (INIS)
McDaniel, L.B.
1998-01-01
This report is an Implementation Guide for Hanford Tanks Initiative C-106 heel retrieval contract management HNF-2511 to provide a set of uniform instructions for managing the two contractors selected. The primary objective is to produce the necessary deliverables and services for the HTI project within schedule and budget
EnviroTeach, 1992
1992-01-01
Introduces networking projects for studying rivers and water quality. Describes two projects in South Africa (Project W.A.T.E.R and SWAP) associated with the international network, Global Rivers Environmental Education Network. Discusses water test kits and educational material developed through Project W.A.T.E.R. (Water Awareness through…
Tank 241-C-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103
Tank 241-C-108 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-108 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank characterization report for single-shell tank 241-C-204
International Nuclear Information System (INIS)
Conner, J.M.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-C-204. This report supports the requirements of Tri Party Agreement Milestone M 44 09
2011-11-29
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project Nos. 13213-002; 14271-000] Lock 14 Hydro Partners; FFP Project 106 LLC; Notice of Competing Preliminary Permit Applications Accepted..., 2011, Lock 14 Hydro Partners (Lock 14), and FFP Project 106 LLC (FFP 106) filed preliminary permit...
Smith, K N; Iwanejko, L; Loeillet, S; Fabre, F; Nicolas, A
1999-09-15
In the context of the EUROFAN project, we have carried out the systematic disruption of seven ORFs on chromosome IV of Saccharomyces cerevisiae using the long flanking homology technique to replace each ORF with the KanMX cassette. Targeted disruption of YDL057w, YDL012c, or YDL010w with YDL009c (the two ORFs overlap) confers no overt defects in haploid growth on a variety of media at different temperatures, in mating, or in the sporulation of diploids homozygous for the disruption. By contrast, YDL008w and YDL003w disruptants are non-viable. The product of YDL008w (elsewhere identified as APC11) is a component of the anaphase promoting complex. YDL003w (also termed MCD1) is a homologue of Schizosaccharomyces pombe rad21, an essential gene implicated in DNA double-strand break repair and nuclear organization in fission yeast. In budding yeast, this ORF has been shown by several laboratories to encode a protein involved in sister chromatid cohesion and chromosome condensation. The remaining ORF, YDL005c (also termed MED2), encodes a component of the transcriptional activator complex known as Mediator. Disruption of YDL005c confers a modest slow growth phenotype on rich medium and a more severe phenotype on minimal medium, aberrant cellular morphology, and mating defects; diploids homozygous for the disruption cannot sporulate. Copyright 1999 John Wiley & Sons, Ltd.
Test plan for tank 241-C-104 retrieval testing
International Nuclear Information System (INIS)
HERTING, D.L.
1999-01-01
Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document
Test Plan for Tank 241-C-104 Retrieval Testing
International Nuclear Information System (INIS)
HERTING, D.L.
1999-01-01
Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document
International Nuclear Information System (INIS)
Serne, R JEFFREY.; Bjornstad, Bruce N.; Horton, Duane G.; Lanigan, David C.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; LeGore, Virginia L.; Geiszler, Keith N.; Baum, Steven R.; Valenta, Michelle M.; Kutnyakov, Igor V.; Vickerman, Tanya S.; Orr, Robert D.; Brown, Christopher F.
2004-01-01
This report contains geologic, geochemical, and physical characterization data collected on sediment recovered from boreholes C4104 and C4105 in the T Tank Farm, and 299-W-11-39 installed northeast of the T Tank Farm. The measurements on sediments from borehole C4104 are compared to a nearby borehole 299-W10-196 placed through the plume from the 1973 T-106 tank leak. This report also presents the data in the context of sediment types, the vertical extent of contamination, the migration potential of the contaminants, and the likely source of the contamination in the vadose zone and groundwater below the T Tank Farm. Sediment samples were characterized for: moisture content, gamma-emission radionuclides, one-to-one water extracts (which provide soil pH, electrical conductivity, cation, trace metal, radionuclide and anion data), total carbon and inorganic carbon content, and 8 M nitric acid extracts (which provide a measure of the total leachable sediment content of contaminants). Overall, our analyses showed that common ion exchange is a key mechanism that influences the distribution of contaminants within that portion of the vadose zone affected by tank liquor. We observed slight elevated pH values in samples from borehole C4104. The sediments from the three boreholes, C4104, C4105, and 299-W10-196 do show that sodium-, nitrate-, and sulfate-dominated fluids are present below tank T-106 and have formed a salt plume. The fluids are more dilute than tank fluids observed below tanks at the SX and BX Tank Farms and slightly less than those from the most saline porewater found in contaminated TX tank farm sediments. The boreholes could not penetrate below the gravel-rich strata of the Ringold Formation Wooded Island member (Rwi) (refusal was met at about 130 ft bgs); therefore, we could not identify the maximum vertical penetration of the tank related plumes. The moisture content, pH, electrical conductivity, nitrate, and technetium-99 profiles versus depth in the three
Energy Technology Data Exchange (ETDEWEB)
Serne, R JEFFREY.; Bjornstad, Bruce N.; Horton, Duane G.; Lanigan, David C.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; LeGore, Virginia L.; Geiszler, Keith N.; Baum, Steven R.; Valenta, Michelle M.; Kutnyakov, Igor V.; Vickerman, Tanya S.; Orr, Robert D.; Brown, Christopher F.
2004-09-01
This report contains geologic, geochemical, and physical characterization data collected on sediment recovered from boreholes C4104 and C4105 in the T Tank Farm, and 299-W-11-39 installed northeast of the T Tank Farm. The measurements on sediments from borehole C4104 are compared to a nearby borehole 299-W10-196 placed through the plume from the 1973 T-106 tank leak. This report also presents the data in the context of sediment types, the vertical extent of contamination, the migration potential of the contaminants, and the likely source of the contamination in the vadose zone and groundwater below the T Tank Farm. Sediment samples were characterized for: moisture content, gamma-emission radionuclides, one-to-one water extracts (which provide soil pH, electrical conductivity, cation, trace metal, radionuclide and anion data), total carbon and inorganic carbon content, and 8 M nitric acid extracts (which provide a measure of the total leachable sediment content of contaminants). Overall, our analyses showed that common ion exchange is a key mechanism that influences the distribution of contaminants within that portion of the vadose zone affected by tank liquor. We observed slight elevated pH values in samples from borehole C4104. The sediments from the three boreholes, C4104, C4105, and 299-W10-196 do show that sodium-, nitrate-, and sulfate-dominated fluids are present below tank T-106 and have formed a salt plume. The fluids are more dilute than tank fluids observed below tanks at the SX and BX Tank Farms and slightly less than those from the most saline porewater found in contaminated TX tank farm sediments. The boreholes could not penetrate below the gravel-rich strata of the Ringold Formation Wooded Island member (Rwi) (refusal was met at about 130 ft bgs); therefore, we could not identify the maximum vertical penetration of the tank related plumes. The moisture content, pH, electrical conductivity, nitrate, and technetium-99 profiles versus depth in the three
Tank characterization report for single-shell tank 241-C-109
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.
1997-05-23
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices.
Tank characterization report for single-shell tank 241-C-109
International Nuclear Information System (INIS)
Simpson, B.C.
1997-01-01
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices
Granulometric data 241-C Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 500 sediment samples collected during the drilling of wells in the 241-C Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 500 sediment samples are documented in this report
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
The purpose of the test was to verify that the AN Tank Farm B Pit Leak Detector components are functionally integrated and operate in accordance with engineering design specifications. The Acceptance Test Procedure HNF-4646,241-AN-B-Pit Leak Detection ANB-WT-LDSTA-231 was conducted between 26 June and 02 July 1999 at the 200E AN Tank Farm. The test has been completed with no open test exceptions. The test was conducted prior to final engineering ''as built'' activities being completed this had no impact on the procedure or test results. All components, identified in the procedure were found to be labeled and identified as written in the procedure
Tank characterization report for single-shell tank 241-C-110. Revision 1
International Nuclear Information System (INIS)
Benar, C.J.
1997-01-01
One of the major functions of the Tank Waste Remediation System (IWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-C-110. The objectives of this report are to use characterization data in response to technical issues associated with 241-C-110 waste and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. While only the results from recent sample events will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-C-110 are provided included surveillance information, records pertaining to waste transfers and tank operations, and 1124 expected tank contents derived from a process knowledge model. The sampling events are listed, as well as sample data obtained before 1989. The results of the 1992 sampling events are also reported in the data package. The statistical analysis and numerical manipulation of data used in issue resolution are reported in Appendix C. Appendix D contains the evaluation to establish the best basis for the inventory estimate and the statistical analysis performed for this evaluation. A bibliography that resulted from an in-depth literature search of all known information sources applicable to tank 241-C-110 and its respective waste types is contained in Appendix E
Hanford tank initiative test facility site selection study
International Nuclear Information System (INIS)
Staehr, T.W.
1997-01-01
The Hanford Tanks Initiative (HTI) project is developing equipment for the removal of hard heel waste from the Hanford Site underground single-shell waste storage tanks. The HTI equipment will initially be installed in the 241-C-106 tank where its operation will be demonstrated. This study evaluates existing Hanford Site facilities and other sites for functional testing of the HTI equipment before it is installed into the 241-C-106 tank
Superconductivity in the W-Tc and W2C-Tc systems
International Nuclear Information System (INIS)
Giorgi, A.L.
1985-01-01
A series of compositions in the W-Tc, W 2 C-Re and W 2 C-Tc systems were prepared and examined for superconductivity. The crystal structure, lattice parameters and superconducting transition temperatures of the W 2 C-Tc are reported for the first time. Similar measurements were made on the W-Tc and W 2 C-Re systems and the results compared with previous published results for these systems. 7 refs., 2 figs., 2 tabs
HTI retrieval demonstration project execution plan
International Nuclear Information System (INIS)
Ellingson, D.R.
1997-01-01
This plan describes the process for demonstrating the retrieval of difficult Hanford tank waste forms utilizing commercial technologies and the private sector to conduct the operations. The demonstration is to be conducted in Tank 241-C-106
Project Specific Quality Assurance Plan Project (QAPP) W-211 Initial Tank Retrieval Systems (ITRS)
International Nuclear Information System (INIS)
HALL, L.R.
2000-01-01
This Quality Assurance Program Plan (QAPP) provides information on how the Project Hanford Quality Assurance Program is implemented by CH2M HILL Hanford Group Inc (CHG) for managing the Initial Tank Retrieval Systems (ITRS), Project W-211. This QAPP is responsive to the CHG Quality Assurance Program Description (QAPD) (LMH-MP-599) which provides direction for compliance to 10 CFR 830 120, ''Nuclear Safety Management, Quality Assurance Requirements'', and DOE Order 5700 6C, ''Quality Assurance'' Project W-211 modifies existing facilities and provides systems for retrieval of radioactive wastes from selected double-shell tanks (DST). The contents of these tanks are a combination of supernatant liquids and settled solids. To retrieve waste from the tanks, it is first necessary to mix the liquid and solids prior to transferring the slurry to alternative storage or treatment facilities. The ITRS will provide systems to mobilize the settled solids and transfer the wastes out of the tanks. In so doing, ITRS provides feed for future processing plants, allows for consolidation of tank solids to manage space within existing DST storage capacity, and supports continued safe storage of tank waste. This project includes the design, procurement, construction, startup and turnover of these retrieval systems This QAPP identifies organizational structures and responsibilities. Implementing procedures used by CHG project management can be found in the CHG Quality Assurance Program (CHG QAP) Implementation Matrix located in HNF-IP-0842, Volume XI, Attachment Proposed verification and inspection activities for critical items within the scope of project W-211 are identified in Attachment 1 W-211. Project participants will identify the implementing procedures used by their organization within their QAF'Ps. This project specific QAPP is used to identify requirements in addition to the QAPD and provide, by reference, additional information to other project documents
Czech Academy of Sciences Publication Activity Database
Alishahi, M.; Mirzaei, S.; Souček, P.; Zábranský, L.; Buršíková, V.; Stupavska, M.; Peřina, Vratislav; Balázsi, K.; Czigany, Z.; Vašina, P.
2018-01-01
Roč. 340, č. 4 (2018), s. 103-111 ISSN 0257-8972 R&D Projects: GA MŠk LM2015056 Institutional support: RVO:61389005 Keywords : magnetron sputtering * W-B-C * microstructure * hardness * fracture resistance Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 2.589, year: 2016
International Nuclear Information System (INIS)
Rui Wu; Sandstroem, Rolf; Seitisleam, Facredin
2004-02-01
Uni-axial creep and creep crack growth (CCG) tests at 320 deg C and 340 deg C as well as post test metallography have been carried out in a low alloy reactor pressure vessel steel (ASTM A508 class 2) having simulated coarse grained heat affected zone microstructure. The CCG behaviour is studied in terms of steady crack growth rate, creep fracture parameter C*, stress intensity factor and reference stress at given testing conditions. It has been found that CCG does occur at both tested temperatures. The lifetimes for the CCG tests are considerably shorter than those for the uni-axial creep tests. This is more pronounced at longer lifetimes or lower stresses. Increasing temperature from 320 deg C to 340 deg C causes a reduction of lifetime by approximately a factor of five and a corresponding increase of steady crack growth rate. For the CCG tests, there are three regions when the crack length is plotted against time. After incubation, the crack grows steadily until it accelerates when rupture is approached. Notable crack growth takes place at later stage of the tests. No creep cavitation is observed and transgranular fracture is dominant for the uni-axial creep specimens. In the CT specimens the cracks propagate intergranularly, independent of temperature and time. Some relations between time to failure, reference stress and steady crack growth rate are found for the CCG tests. A linear extrapolation based on the stress-time results indicates that the reference stress causing failure due to CCG at a given lifetime of 350,000 hours at 320 deg C is clearly lower than both yield and tensile strengths, on which the design stress may have based. Therefore, caution must be taken to prevent premature failure due to low temperature CCG. Both uni-axial and CCG tests on real welded joint at 320 deg C, study of creep damage zone at crack tip as well as numerical simulation are recommended for future work
Tank characterization report for single-shell tank 241-C-104
Energy Technology Data Exchange (ETDEWEB)
Baldwin, J.H.
1997-05-21
A major function of the Tank Waste Remediation System is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-104. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-C-104 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1996) milestone M-44-10.
Tank 241-S-106, cores 183, 184 and 187 analytical results for the final report
International Nuclear Information System (INIS)
Esch, R.A.
1997-01-01
This document is the final laboratory report for tank 241-S-106 push mode core segments collected between February 12, 1997 and March 21, 1997. The segments were subsampled and analyzed in accordance with the Tank Push Mode Core Sampling and Analysis Plan (TSAP), the Tank Safety Screening Data Quality Objective (Safety DQO), the Historical Model Evaluation Data Requirements (Historical DQO) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO). The analytical results are included in Table 1. Six of the twenty-four subsamples submitted for the differential scanning calorimetry (DSC) analysis exceeded the notification limit of 480 Joules/g stated in the DQO. Appropriate notifications were made. Total Organic Carbon (TOC) analyses were performed on all samples that produced exotherms during the DSC analysis. All results were less than the notification limit of three weight percent TOC. No cyanide analysis was performed, per agreement with the Tank Safety Program. None of the samples submitted for Total Alpha Activity exceeded notification limits as stated in the TSAP. Statistical evaluation of results by calculating the 95% upper confidence limit is not performed by the 222-S Laboratory and is not considered in this report. No core composites were created because there was insufficient solid material from any of the three core sampling events to generate a composite that would be representative of the tank contents
24 CFR 241.830 - Definition of default.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...
Systems engineering study: tank 241-C-103 organic skimming,storage, treatment and disposal options
Energy Technology Data Exchange (ETDEWEB)
Klem, M.J.
1996-10-23
This report evaluates alternatives for pumping, storing, treating and disposing of the separable phase organic layer in Hanford Site Tank 241-C-103. The report provides safety and technology based preferences and recommendations. Two major options and several varations of these options were identified. The major options were: 1) transfer both the organic and pumpable aqueous layers to a double-shell tank as part of interim stabilization using existing salt well pumping equipment or 2) skim the organic to an above ground before interim stabilization of Tank 241-C-103. Other options to remove the organic were considered but rejected following preliminary evaluation.
Tank characterization report for double-shell tank 241-AP-101. Revision 1
International Nuclear Information System (INIS)
Conner, J.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes m support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for double-shell tank 241-AP-101. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-AP-101 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 provides the best-basis inventory estimate, and Section 4.0 makes recommendations about safety status and additional sampling needs. The appendixes contain supporting data and information. This report supported the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-05. The characterization information in this report originated from sample analyses and known historical sources. Appendix A provides historical information for tank 241-AP-101 including surveillance, information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a model based upon process knowledge. Appendix B summarizes recent sampling events and historical sampling information. Tank 241-AP-101 was grab sampled in November 1995, when the tank contained 2,790 kL (737 kgal) of waste. An addition1034al 1,438 kL (380 kgal) of waste was received from tank 241-AW-106 in transfers on March 1996 and January 1997. This waste was the product of the 242-A Evaporator Campaign 95-1. Characterization information for the additional 1,438 kL (380 kgal) was obtained using grab sampling data from tank 241-AW-106 and a slurry sample from the evaporator. Appendix C reports on the statistical analysis and numerical manipulation of data used in
Thermal stability of the DSC ruthenium dye C106 in robust electrolytes
DEFF Research Database (Denmark)
Lund, Torben; Phuong, Nguyen Tuyet; Pechy, Peter
2014-01-01
We have investigated the thermal stability of the heteroleptic ruthenium complex C106 employed as a sensitizer in dye-sensitized solar cells. The C106 was adsorbed on TiO2 particles and exposed to 2 different iodide/triidode based redox electrolytes A and B at 80 °C for up to 1500 h in sealed glass......) substitution products 3 and 4 formed by replacement of the thiocyanate ligand by NBB after 1500 h of heating at 80 °C. Samples prepared under ambient conditions gave a steady state C106 concentration of 60% of the initial value and 40% substitution products. The C106 degradation was found to be independent...... of the degree of dye loading of the TiO2 particles and the ratio between the amount of dyed TiO2 particles and electrolyte volume. Assuming that this substitution is the predominant loss mechanism in a DSC during thermal stress, we estimate the reduction in the DSC efficiency after long term heat to be 12...
International Nuclear Information System (INIS)
Callaway, W.S.; Huber, H.J.
2010-01-01
Based on an ENRAF waste surface measurement taken February 1, 2009, double-shell tank (DST) 241-AN-106 (AN-106) contained approximately 278.98 inches (793 kgal) of waste. A zip cord measurement from the tank on February 1, 2009, indicated a settled solids layer of 91.7 inches in height (280 kgal). The supernatant layer in February 2009, by difference, was approximately 187 inches deep (514 kgal). Laboratory results from AN-106 February 1, 2009 (see Table 2) grab samples indicated the supernatant was below the chemistry limit that applied at the time as identified in HNF-SD-WM-TSR-006, Tank Farms Technical Safety Requirements, Administrative Control (AC) 5.16, 'Corrosion Mitigation Controls.' (The limits have since been removed from the Technical Safety Requirements (TSR) and are captured in OSD-T-151-00007, Operating Specifications for the Double-Shell Storage Tanks.) Problem evaluation request WRPS-PER-2009-0218 was submitted February 9, 2009, to document the finding that the supernatant chemistry for grab samples taken from the middle and upper regions of the supernatant was noncompliant with the chemistry control limits. The lab results for the samples taken from the bottom region of the supernatant met AC 5.16 limits.
Energy Technology Data Exchange (ETDEWEB)
CALLAWAY WS; HUBER HJ
2010-07-01
Based on an ENRAF waste surface measurement taken February 1, 2009, double-shell tank (DST) 241-AN-106 (AN-106) contained approximately 278.98 inches (793 kgal) of waste. A zip cord measurement from the tank on February 1, 2009, indicated a settled solids layer of 91.7 inches in height (280 kgal). The supernatant layer in February 2009, by difference, was approximately 187 inches deep (514 kgal). Laboratory results from AN-106 February 1, 2009 (see Table 2) grab samples indicated the supernatant was below the chemistry limit that applied at the time as identified in HNF-SD-WM-TSR-006, Tank Farms Technical Safety Requirements, Administrative Control (AC) 5.16, 'Corrosion Mitigation Controls.' (The limits have since been removed from the Technical Safety Requirements (TSR) and are captured in OSD-T-151-00007, Operating Specifications for the Double-Shell Storage Tanks.) Problem evaluation request WRPS-PER-2009-0218 was submitted February 9, 2009, to document the finding that the supernatant chemistry for grab samples taken from the middle and upper regions of the supernatant was noncompliant with the chemistry control limits. The lab results for the samples taken from the bottom region of the supernatant met AC 5.16 limits.
International Nuclear Information System (INIS)
Horton, D.G.; Johnson, V.G.
2000-01-01
Three new Resource Conservation and Recovery Act (RCRA) groundwater monitoring wells were installed at the single-shell tank farm Waste Management Area (WMA) S-SX in October 1999 through February 2000 in fulfillment of Tri-Party Agreement (Ecology 1996) milestone M-24-41. The wells are 299-W22-48, 299-W22-49, and 299-W22-50. Well 299-W22-48 is located east of the southeast corner of 241-S tank farm and is a new downgradient well in the monitoring network. Well 299-W22-49 is located on the east side of the 241-SX tank farm, adjacent to well 299-W22-39, which it replaces in the monitoring network. Well 299-W22-50 is located at the southeast corner of the 241-SX tank farm and is a replacement for downgradient monitoring well 299-W22-46, which is going dry. The original assessment monitoring plan for WMA S-SX was issued in 1996 (Caggiano 1996). That plan was updated for the continued assessment at WMA S-SX in 1999 (Johnson and Chou 1999). The updated plan provides justification for the new wells. The new wells were constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, the updated assessment plan for WMA S-SX (Johnson and Chou 1999), and the description of work for well drilling and construction. This document compiles information on the drilling and construction, well development, pump installation, and sediment and groundwater sampling applicable to the installation of wells 299-W22-48, 299-W22-49 and 299-W22-50. Appendix A contains the Well Summary Sheets (as-built diagrams), the Well Construction Summary Reports, and the geologist's logs. Appendix B contains results of laboratory analyses of the physical properties of sediment samples obtained during drilling. Appendix C contains borehole geophysical logs, and Appendix D contains the analytical results from groundwater samples obtained during well drilling and construction
Energy Technology Data Exchange (ETDEWEB)
DG Horton; VG Johnson
2000-05-18
Three new Resource Conservation and Recovery Act (RCRA) groundwater monitoring wells were installed at the single-shell tank farm Waste Management Area (WMA) S-SX in October 1999 through February 2000 in fulfillment of Tri-Party Agreement (Ecology 1996) milestone M-24-41. The wells are 299-W22-48, 299-W22-49, and 299-W22-50. Well 299-W22-48 is located east of the southeast corner of 241-S tank farm and is a new downgradient well in the monitoring network. Well 299-W22-49 is located on the east side of the 241-SX tank farm, adjacent to well 299-W22-39, which it replaces in the monitoring network. Well 299-W22-50 is located at the southeast corner of the 241-SX tank farm and is a replacement for downgradient monitoring well 299-W22-46, which is going dry. The original assessment monitoring plan for WMA S-SX was issued in 1996 (Caggiano 1996). That plan was updated for the continued assessment at WMA S-SX in 1999 (Johnson and Chou 1999). The updated plan provides justification for the new wells. The new wells were constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, the updated assessment plan for WMA S-SX (Johnson and Chou 1999), and the description of work for well drilling and construction. This document compiles information on the drilling and construction, well development, pump installation, and sediment and groundwater sampling applicable to the installation of wells 299-W22-48, 299-W22-49 and 299-W22-50. Appendix A contains the Well Summary Sheets (as-built diagrams), the Well Construction Summary Reports, and the geologist's logs. Appendix B contains results of laboratory analyses of the physical properties of sediment samples obtained during drilling. Appendix C contains borehole geophysical logs, and Appendix D contains the analytical results from groundwater samples obtained during well drilling and construction.
Fully Integrated 1.7GHz, 188dBc/Hz FoM, 0.8V, 320uW LC-tank VCO and Frequency Divider
DEFF Research Database (Denmark)
Midtgaard, Jesper Stolpe; Jeppesen, Thomas; Christensen, Kåre Tais
2005-01-01
This paper presents a 0.13μm CMOS 1.7GHz VCO with frequency divider, suitable for ultra-low-power hearing-aid applications. The circuit has a 16% tuning range, a minimum power consumption of 320μW from a 0.8V power supply, power-supply and temperature compensation, an excellent 188dBc/Hz figure...
CSER 96-014: criticality safety of project W-151, 241-AZ-101 retrieval system process test
Energy Technology Data Exchange (ETDEWEB)
Vail, T.S., Fluor Daniel Hanford
1997-02-06
This Criticality Safety Evaluation Report (CSER) documents a review of the criticality safety implications of a process test to be performed in tank 241-AZ-101 (101-AZ). The process test will determine the effectiveness of the retrieval system for mobilization of solids and the practicality of the system for future use in the underground storage tanks at Hanford. The scope of the CSER extends only to the testing and operation of the mixer pumps and does not include the transfer of waste from the tank. Justification is provided that a nuclear criticality is extremely unlikely, if not impossible, in this tank.
Vapor characterization of Tank 241-C-103
International Nuclear Information System (INIS)
Huckaby, J.L.; Story, M.S.
1994-06-01
The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program
Vapor characterization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L. [Westinghouse Hanford Co., Richland, WA (United States); Story, M.S. [Northwest Instrument Systems, Inc. Richland, WA (United States)
1994-06-01
The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program.
Tribological Behavior of Plasma-Sprayed Al2O3-20 wt.%TiO2 Coating
Cui, Shiyu; Miao, Qiang; Liang, Wenping; Zhang, Zhigang; Xu, Yi; Ren, Beilei
2017-05-01
Al2O3-20 wt.% TiO2 ceramic coatings were deposited on the surface of Grade D steel by plasma spraying of commercially available powders. The phases and the microstructures of the coatings were investigated by x-ray diffraction and scanning electron microscopy, respectively. The Al2O3-20 wt.% TiO2 composite coating exhibited a typical inter-lamellar structure consisting of the γ-Al2O3 and the Al2TiO5 phases. The dry sliding wear behavior of the coating was examined at 20 °C using a ball-on-disk wear tester. The plasma-sprayed coating showed a low wear rate ( 4.5 × 10-6 mm3 N-1 m-1), which was matrix ( 283.3 × 10-6 mm3 N-1 m-1), under a load of 15 N. In addition, the tribological behavior of the plasma-sprayed coating was analyzed by examining the microstructure after the wear tests. It was found that delamination of the Al2TiO5 phase was the main cause of the wear during the sliding wear tests. A suitable model was used to simulate the wear mechanism of the coating.
Acceptance for Beneficial Use (ABU) Update for 241-AW-104 Waste Transfer Project
International Nuclear Information System (INIS)
MEWES, B.S.
2001-01-01
In October of 2000 an Engineering Task Plan (ETP), RPP-6869, was drafted to define objectives, document requirements, and define organizational responsibilities for the purpose of design installation and turnover of the 241-AW-104 Pump Replacement Project The ETP included an Acceptance for Beneficial Use (ABU) checklist, which delineated all tasks necessary to turn the 241-AW-104 Replaced Transfer Pump over to Operations, Maintenance, and Plant Engineering Signature approval of the respective Engineering Data Transmittal (EDT 630501) signified agreement that the ABU checklist was all-inclusive. In January 2001 an additional EDT (EDT 624153) was drafted to define completed ABU items, provide corresponding supporting documentation, and status open items in need of completion. This supporting document is to serve two purposes: (1) update ABU checklist items completed since January 2001, and (2) define remaining ABU checklist items in need of completion
Investigation of Tank 241-AN-101 Floating Solids
Energy Technology Data Exchange (ETDEWEB)
Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)
2017-10-30
Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.
Characterization of Direct Push Vadose Zone Sediments from the T and TY Waste Management Areas
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Valenta, Michelle M.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Iovin, Cristian; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-06-08
This report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from 5 direct push characterization holes emplaced to investigate vadose zone contamination associated with leaks from tanks 241-TY-105 (UPR-200-W-152) and 241-TY-106 (UPR-200-W-153). Tank 241-TY-105 is estimated to have leaked 35,000 gal of tributyl phosphate (TBP) waste from the uranium recovery process to the vadose zone in 1960. Tank 241-TY-106 is estimated to have leaked 20,000 gal of TBP-uranium recovery waste to the vadose zone in 1959. Although several drywells in the vicinity of tank 241-TY-106 contain measurable quantities of cesium-137 and/or cobalt-60, their relatively low concentrations indicate that the contaminant inventory in the vadose zone around tank 241-TY-106 is quite small. Additionally, this report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from 7 direct push characterization holes emplaced to investigate vadose zone contamination associated with an overfill event and leak from tank 241-T-101.
International Nuclear Information System (INIS)
1993-01-01
The action proposed is to sample the vapor space and liquid waste and perform other supporting activities in Tank 241-C-103 located in the 241-C Tank Farm on the Hanford Site. Operations at Tank 241-C-103 are curtailed because of an unreviewed safety question (USQ) concerning flammability issues of the organic waste in the tank. This USQ must be resolved before normal operation and surveillance of the tank can resume. In addition to the USQ, Tank 241-C-103 is thought to be involved in several cases of exposure of individuals to noxious vapors. This safety issue requires the use of supplied air for workers in the vicinity of the tank. Because of the USQ, the US Department of Energy proposes to characterize the waste in the vapor space and the organic and aqueous layers, to determine the volume of the organic layer. This action is needed to: (1) assess potential risks to workers, the public, and the environment from continued routine tank operations and (2) provide information on the waste material in the tank to facilitate a comprehensive safety analysis of this USQ. The information would be used to determine if a flammable condition within the tank is credible. This information would be used to prevent or mitigate an accident during continued waste storage and future waste characterization. Alternatives to the proposed activities have been considered in this analysis
Waste Tank Organic Safety Project: Analysis of liquid samples from Hanford waste tank 241-C-103
International Nuclear Information System (INIS)
Pool, K.H.; Bean, R.M.
1994-03-01
A suite of physical and chemical analyses has been performed in support of activities directed toward the resolution of an Unreviewed Safety Question concerning the potential for a floating organic layer in Hanford waste tank 241-C-103 to sustain a pool fire. The analysis program was the result of a Data Quality Objectives exercise conducted jointly with staff from Westinghouse Hanford Company and Pacific Northwest Laboratory (PNL). The organic layer has been analyzed for flash point, organic composition including volatile organics, inorganic anions and cations, radionuclides, and other physical and chemical parameters needed for a safety assessment leading to the resolution of the Unreviewed Safety Question. The aqueous layer underlying the floating organic material was also analyzed for inorganic, organic, and radionuclide composition, as well as other physical and chemical properties. This work was conducted to PNL Quality Assurance impact level III standards (Good Laboratory Practices)
49 CFR 241.17 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...
Aaboud, Morad; Abbott, Brad; Abdallah, Jalal; Abdinov, Ovsat; Abeloos, Baptiste; Aben, Rosemarie; AbouZeid, Ossama; Abraham, Nicola; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Ali, Babar; Aliev, Malik; Alimonti, Gianluca; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allen, Benjamin William; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Alstaty, Mahmoud; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antel, Claire; Antonelli, Mario; Antonov, Alexey; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Armitage, Lewis James; Arnaez, Olivier; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Artz, Sebastian; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Augsten, Kamil; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Balunas, William Keaton; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisits, Martin-Stefan; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barranco Navarro, Laura; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Bechtle, Philip; Beck, Hans~Peter; Becker, Kathrin; Becker, Maurice; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bedognetti, Matteo; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, Andrew Stuart; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Belyaev, Nikita; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez, Jose; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Beringer, Jürg; Berlendis, Simon; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertram, Iain Alexander; Bertsche, Carolyn; Bertsche, David; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethani, Agni; Bethke, Siegfried; Bevan, Adrian John; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bielski, Rafal; Biesuz, Nicolo Vladi; Biglietti, Michela; Bilbao De Mendizabal, Javier; Billoud, Thomas Remy Victor; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biondi, Silvia; Bisanz, Tobias; Bjergaard, David Martin; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Blunier, Sylvain; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Boerner, Daniela; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bokan, Petar; Bold, Tomasz; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Bortfeldt, Jonathan; Bortoletto, Daniela; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Bossio Sola, Jonathan David; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Boutle, Sarah Kate; Boveia, Antonio; Boyd, James; Boyko, Igor; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Broughton, James; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruni, Lucrezia Stella; Brunt, Benjamin; Bruschi, Marco; Bruscino, Nello; Bryant, Patrick; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Budagov, Ioulian; Buehrer, Felix; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burgard, Carsten Daniel; Burghgrave, Blake; Burka, Klaudia; Burke, Stephen; Burmeister, Ingo; Burr, Jonathan Thomas Peter; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calace, Noemi; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Callea, Giuseppe; Caloba, Luiz; Calvente Lopez, Sergio; Calvet, David; Calvet, Samuel; Calvet, Thomas Philippe; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminal Armadans, Roger; Camincher, Clement; Campana, Simone; Campanelli, Mario; Camplani, Alessandra; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Carbone, Ryne Michael; Cardarelli, Roberto; Cardillo, Fabio; Carli, Ina; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Casper, David William; Castaneda-Miranda, Elizabeth; Castelijn, Remco; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavallaro, Emanuele; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerda Alberich, Leonor; Cerio, Benjamin; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Stephen Kam-wah; Chan, Yat Long; Chang, Philip; Chapman, John Derek; Charlton, Dave; Chatterjee, Avishek; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Che, Siinn; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Shenjian; Chen, Shion; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Huajie; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiarelli, Giorgio; Chiodini, Gabriele; Chisholm, Andrew; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chomont, Arthur Rene; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocca, Claudia; Ciocio, Alessandra; Cirotto, Francesco; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Michael; Clark, Philip James; Clarke, Robert; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Colasurdo, Luca; Cole, Brian; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consorti, Valerio; Constantinescu, Serban; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cormier, Kyle James Read; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crawley, Samuel Joseph; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cueto, Ana; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cúth, Jakub; Czirr, Hendrik; Czodrowski, Patrick; D'amen, Gabriele; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dado, Tomas; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Dann, Nicholas Stuart; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Merlin; Davison, Peter; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Benedetti, Abraham; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Maria, Antonio; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Dehghanian, Nooshin; Deigaard, Ingrid; Del Gaudio, Michela; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Denysiuk, Denys; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Dette, Karola; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Clemente, William Kennedy; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dolejsi, Jiri; Dolezal, Zdenek; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Du, Yanyan; Duarte-Campderros, Jorge; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudder, Andreas Christian; Duffield, Emily Marie; Duflot, Laurent; Dührssen, Michael; Dumancic, Mirta; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dutta, Baishali; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edwards, Nicholas Charles; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellajosyula, Venugopal; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Ennis, Joseph Stanford; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Federica; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farina, Christian; Farina, Edoardo Maria; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fawcett, William James; Fayard, Louis; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Flaschel, Nils; Fleck, Ivor; Fleischmann, Philipp; Fletcher, Gareth Thomas; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Forcolin, Giulio Tiziano; Formica, Andrea; Forti, Alessandra; Foster, Andrew Geoffrey; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; Fressard-Batraneanu, Silvia; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fusayasu, Takahiro; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gach, Grzegorz; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Louis Guillaume; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gascon Bravo, Alberto; Gasnikova, Ksenia; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Gecse, Zoltan; Gee, Norman; Geich-Gimbel, Christoph; Geisen, Marc; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Geng, Cong; Gentile, Simonetta; Gentsos, Christos; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghasemi, Sara; Ghazlane, Hamid; Ghneimat, Mazuza; Giacobbe, Benedetto; Giagu, Stefano; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gignac, Matthew; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuli, Francesco; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Giulia; Gonella, Laura; Gongadze, Alexi; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goudet, Christophe Raymond; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Graber, Lars; Grabowska-Bold, Iwona; Gradin, Per Olov Joakim; Grafström, Per; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Gratchev, Vadim; Gravila, Paul Mircea; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Grefe, Christian; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Grevtsov, Kirill; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Groh, Sabrina; Grohs, Johannes Philipp; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guan, Wen; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Guo, Yicheng; Gupta, Ruchi; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Hadef, Asma; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Haney, Bijan; Hanisch, Stefanie; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hartmann, Nikolai Marcel; Hasegawa, Makoto; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hayakawa, Daiki; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Jochen Jens; Heinrich, Lukas; Heinz, Christian; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Henkelmann, Steffen; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Herget, Verena; Hernández Jiménez, Yesenia; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooberman, Benjamin Henry; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Hu, Shuyang; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Huo, Peng; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Introzzi, Gianluca; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Ishijima, Naoki; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ito, Fumiaki; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Paul; Jain, Vivek; Jakobi, Katharina Bianca; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanneau, Fabien; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Hai; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Johansson, Per; Johns, Kenneth; Johnson, William Joseph; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Sarah; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Jovicevic, Jelena; Ju, Xiangyang; Juste Rozas, Aurelio; Köhler, Markus Konrad; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kaji, Toshiaki; Kajomovitz, Enrique; Kalderon, Charles William; Kaluza, Adam; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneti, Steven; Kanjir, Luka; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kaplan, Laser Seymour; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karentzos, Efstathios; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kasahara, Kota; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Kato, Chikuma; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazanin, Vassili; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Kentaro, Kawade; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khader, Mazin; Khalil-zada, Farkhad; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kido, Shogo; Kilby, Callum; Kim, Hee Yeun; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Knapik, Joanna; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koehler, Nicolas Maximilian; Koffas, Thomas; Koffeman, Els; Koi, Tatsumi; Kolanoski, Hermann; Kolb, Mathis; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Kowalewska, Anna Bozena; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozakai, Chihiro; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kravchenko, Anton; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuechler, Jan Thomas; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kukla, Romain; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lammers, Sabine; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lanfermann, Marie Christine; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Lazzaroni, Massimo; Le, Brian; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Quilleuc, Eloi; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Benoit; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Lerner, Giuseppe; Leroy, Claude; Lesage, Arthur; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Dave; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Changqiao; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Qi; Li, Shu; Li, Xingguo; Li, Yichen; Liang, Zhijun; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Lindquist, Brian Edward; Lionti, Anthony Eric; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Hongbin; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanlin; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loew, Kevin Michael; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Longo, Luigi; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lopez Solis, Alvaro; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Haonan; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luedtke, Christian; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Luzi, Pierre Marc; Lynn, David; Lysak, Roman; Lytken, Else; Lyubushkin, Vladimir; Ma, Hong; Ma, Lian Liang; Ma, Yanhui; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Maček, Boštjan; Machado Miguens, Joana; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeda, Junpei; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Maneira, José; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manousos, Athanasios; Mansoulie, Bruno; Mansour, Jason Dhia; Mantifel, Rodger; Mantoani, Matteo; Manzoni, Stefano; Mapelli, Livio; Marceca, Gino; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martinez Outschoorn, Verena; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mc Fadden, Neil Christopher; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McClymont, Laurie; McDonald, Emily; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melini, Davide; Mellado Garcia, Bruce Rafael; Melo, Matej; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer Zu Theenhausen, Hanno; Miano, Fabrizio; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mistry, Khilesh; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Molander, Simon; Moles-Valls, Regina; Monden, Ryutaro; Mondragon, Matthew Craig; Mönig, Klaus; Monk, James; Monnier, Emmanuel; Montalbano, Alyssa; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Mori, Daniel; Mori, Tatsuya; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munoz Sanchez, Francisca Javiela; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Muškinja, Miha; Myagkov, Alexey; Myska, Miroslav; Nachman, Benjamin Philip; Nackenhorst, Olaf; Nagai, Koichi; Nagai, Ryo; Nagano, Kunihiro; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Narrias Villar, Daniel Isaac; Naryshkin, Iouri; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nguyen Manh, Tuan; Nickerson, Richard; Nicolaidou, Rosy; Nielsen, Jason; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Norjoharuddeen, Nurfikri; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nurse, Emily; Nuti, Francesco; O'grady, Fionnbarr; O'Neil, Dugan; O'Rourke, Abigail Alexandra; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Oleiro Seabra, Luis Filipe; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onogi, Kouta; Onyisi, Peter; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Pacheco Rodriguez, Laura; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palazzo, Serena; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Adam Jackson; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pascuzzi, Vincent; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Penc, Ondrej; Peng, Cong; Peng, Haiping; Penwell, John; Peralva, Bernardo; Perego, Marta Maria; Perepelitsa, Dennis; Perez Codina, Estel; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petroff, Pierre; Petrolo, Emilio; Petrov, Mariyan; Petrucci, Fabrizio; Pettersson, Nora Emilia; Peyaud, Alan; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pilcher, James; Pilkington, Andrew; Pin, Arnaud Willy J; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pires, Sylvestre; Pirumov, Hayk; Pitt, Michael; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pozo Astigarraga, Mikel Eukeni; Pralavorio, Pascal; Pranko, Aliaksandr; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Puddu, Daniele; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Raine, John Andrew; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Ratti, Maria Giulia; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Ravinovich, Ilia; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Reale, Marilea; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reichert, Joseph; Reisin, Hernan; Rembser, Christoph; Ren, Huan; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rifki, Othmane; Rijssenbeek, Michael; Rimoldi, Adele; Rimoldi, Marco; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Rizzi, Chiara; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodina, Yulia; Rodriguez Perez, Andrea; Rodriguez Rodriguez, Daniel; Roe, Shaun; Rogan, Christopher Sean; Røhne, Ole; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosenthal, Oliver; Rosien, Nils-Arne; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Jonatan; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryu, Soo; Ryzhov, Andrey; Rzehorz, Gerhard Ferdinand; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saha, Puja; Sahinsoy, Merve; Saimpert, Matthias; Saito, Tomoyuki; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Salazar Loyola, Javier Esteban; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sammel, Dirk; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Savic, Natascha; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schachtner, Balthasar Maria; Schaefer, Douglas; Schaefer, Leigh; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schier, Sheena; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt-Sommerfeld, Korbinian Ralf; Schmieden, Kristof; Schmitt, Christian; Schmitt, Stefan; Schmitz, Simon; Schneider, Basil; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schott, Matthias; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schuh, Natascha; Schulte, Alexandra; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shaikh, Nabila Wahab; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyed Ruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sickles, Anne Marie; Sidebo, Per Edvin; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silverstein, Samuel; Simak, Vladislav; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simon, Manuel; Sinervo, Pekka; Sinev, Nikolai; Sioli, Maximiliano; Siragusa, Giovanni; Sivoklokov, Serguei; Sjölin, Jörgen; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Slovak, Radim; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smiesko, Juraj; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Sokhrannyi, Grygorii; Solans Sanchez, Carlos; Solar, Michael; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Son, Hyungsuk; Song, Hong Ye; Sood, Alexander; Sopczak, Andre; Sopko, Vit; Sorin, Veronica; Sosa, David; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spangenberg, Martin; Spanò, Francesco; Sperlich, Dennis; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; St Denis, Richard Dante; Stabile, Alberto; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Giordon; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Stärz, Steffen; Staszewski, Rafal; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Suchek, Stanislav; Sugaya, Yorihito; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Svatos, Michal; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Masahiro; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tapia Araya, Sebastian; Tapprogge, Stefan; Tarem, Shlomit; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Aaron; Taylor, Geoffrey; Taylor, Pierre Thor Elliot; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira-Dias, Pedro; Temming, Kim Katrin; Temple, Darren; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tisserant, Sylvain; Todome, Kazuki; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Baojia(Tony); Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Trofymov, Artur; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tseng, Jeffrey; Tsiareshka, Pavel; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsui, Ka Ming; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tu, Yanjun; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turgeman, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tyndel, Mike; Ucchielli, Giulia; Ueda, Ikuo; Ughetto, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valdes Santurio, Eduardo; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Graaf, Harry; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vasquez, Jared Gregory; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veeraraghavan, Venkatesh; Veloce, Laurelle Maria; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigani, Luigi; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vittori, Camilla; Vivarelli, Iacopo; Vlachos, Sotirios; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wallangen, Veronica; Wang, Chao; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Tingting; Wang, Wenxiao; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Washbrook, Andrew; Watkins, Peter; Watson, Alan; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Michael David; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Whallon, Nikola Lazar; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilk, Fabian; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winston, Oliver James; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wolf, Tim Michael Heinz; Wolter, Marcin Wladyslaw; Wolters, Helmut; Worm, Steven D; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamaguchi, Daiki; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yang, Zongchang; Yao, Weiming; Yap, Yee Chinn; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yuen, Stephanie P; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zakharchuk, Nataliia; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zeng, Jian Cong; Zeng, Qi; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Guangyi; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Rui; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Mingliang; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zwalinski, Lukasz
2016-08-31
Searches for exclusively produced $W$ boson pairs in the process $pp(\\gamma\\gamma) \\rightarrow pW^+W^-p$ and exclusively produced Higgs boson in the process $pp(gg) \\rightarrow pHp$ have been performed using $e^{\\pm}\\mu^{\\mp}$ final states. These measurements use 20.2 fb$^{-1}$ of $pp$ collisions collected by the ATLAS experiment at a center-of-mass energy $\\sqrt{s}=8$ TeV at the LHC. Exclusive production of $W^+W^-$ consistent with the Standard Model prediction is found with 3.0$\\sigma$ significance. The exclusive $W^+W^-$ production cross-section is determined to be $\\sigma (\\gamma\\gamma\\rightarrow W^{+}W^{-}\\rightarrow e^{\\pm}\\mu^{\\mp} X) = 6.9 \\pm 2.2 (\\mathrm{stat.}) \\pm 1.4 (\\mathrm{sys.})$ fb, in agreement with the Standard Model prediction. Limits on anomalous quartic gauge couplings are set at 95\\% confidence-level as $-1.7 \\times 10^{-6} < a_0^W/\\Lambda^2 < 1.7 \\times 10^{-6}$ GeV$^{-2}$and $-6.4 \\times 10^{-6} < a_C^W/\\Lambda^2 < 6.3 \\times 10^{-6}$ GeV$^{-2}$. A 95\\% confidence-level u...
Characterization of Material from Wells 299-W10-35 (C7573) and 299-W14-74 (C7024)
International Nuclear Information System (INIS)
Tilton, Fred A.; Wellman, Dawn M.; Bovaird, Chase C.; Strandquist, Sara C.
2011-01-01
The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological) and, if the material is biological, to identify the microorganisms present. Extraction and injection wells 299-W10-35 (C7573) and 299-W14-74 (C7024) possess unknown material attached to the well screens (Figure 1). Both wells are located on the Hanford Site. Well 299-W10-35 (C7573) is located west of the 218-W-3A dry waste burial ground, west of Dayton Avenue, and north of 23rd Street and has accumulated white material on the screen and in the sump. Well 299-W14-74 (C7024) is located south of 23rd Street and east of Beloit Avenue. There are two types of material: one is reddish/orange (hypothesized to be iron-utilizing bacterial colonies) and the other is white and may or may not be biological. CH2M HILL Plateau Remediation Company (CHPRC) is conducting onsite sampling for total organic carbon, calcium carbonate, and metals. Table 1 presents chemical data for the groundwater samples associated with these materials. The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological), and if the material is biological, to identify the microorganisms present.
Tank 241-C-107 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
This report presents the details of the Hanford waste tank characterization study for tank 241-C-107. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to tank farm workers due to fugitive emissions from the tank
Tank 241-C-102 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
This report presents the details of the Hanford waste tank characterization study for tank 241-C-102. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to tank farm workers due to fugitive emissions from the tank
Nozzle evaluation for Project W-314
International Nuclear Information System (INIS)
Galbraith, J.D.
1998-01-01
Revisions to the waste transfer system piping to be implemented by Project W-314 will eliminate the need to access a majority of interfarm jumper connections associated with specific process pits. Additionally, connections that formerly facilitated waste transfers from the Plutonium-Uranium Extraction (PUREX) Plant are no longer required. This document identified unneeded process pit jumper connections, describes former designated routing, denotes current status (i.e., open or blanked), and recommends appropriate disposition for all. Blanking of identified nozzles should be accomplished by Project W-314 upon installation of jumpers and acceptance by Tank Waste Remediation System (TWRS) Tank Farm Operations
Progress toward resolution of vapor problems associated with tank 241-C-103
International Nuclear Information System (INIS)
Huckaby, J.L.; Babad, H.; Story, M.S.
1994-02-01
Noxious and flammable gases and vapors associated with high-level radioactive waste storage tank 241-C-103 at the Hanford Site are discussed. Focus is on the Westinghouse Hanford Company strategy to characterize the tank headspace. The sampling and analysis methodology is described. Sampling limitations, devices, and equipment are discussed. Results to date are given
Toxicologic evaluation of analytes from Tank 241-C-103
International Nuclear Information System (INIS)
Mahlum, D.D.; Young, J.Y.; Weller, R.E.
1994-11-01
Westinghouse Hanford Company requested PNL to assemble a toxicology review panel (TRP) to evaluate analytical data compiled by WHC, and provide advice concerning potential health effects associated with exposure to tank-vapor constituents. The team's objectives would be to (1) review procedures used for sampling vapors from tanks, (2) identify constituents in tank-vapor samples that could be related to symptoms reported by workers, (3) evaluate the toxicological implications of those constituents by comparison to establish toxicological databases, (4) provide advice for additional analytical efforts, and (5) support other activities as requested by WHC. The TRP represents a wide range of expertise, including toxicology, industrial hygiene, and occupational medicine. The TRP prepared a list of target analytes that chemists at the Oregon Graduate Institute/Sandia (OGI), Oak Ridge National Laboratory (ORNL), and PNL used to establish validated methods for quantitative analysis of head-space vapors from Tank 241-C-103. this list was used by the analytical laboratories to develop appropriate analytical methods for samples from Tank 241-C-103. Target compounds on the list included acetone, acetonitrile, ammonia, benzene, 1, 3-butadiene, butanal, n-butanol, hexane, 2-hexanone, methylene chloride, nitric oxide, nitrogen dioxide, nitrous oxide, dodecane, tridecane, propane nitrile, sulfur oxide, tributyl phosphate, and vinylidene chloride. The TRP considered constituent concentrations, current exposure limits, reliability of data relative to toxicity, consistency of the analytical data, and whether the material was carcinogenic or teratogenic. A final consideration in the analyte selection process was to include representative chemicals for each class of compounds found
46 CFR 120.320 - Generators and motors.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Generators and motors. 120.320 Section 120.320 Shipping... and Distribution Systems § 120.320 Generators and motors. (a) Each generator and motor must be: (1) In... generator and motor must be designed for an ambient temperature of 50 °C (122 °F) except that: (1) If the...
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
This Software Configuration Management Plan (SCMP) provides the instructions for change control of the W-211 Project, Retrieval Control System (RCS) software after initial approval/release but prior to the transfer of custody to the waste tank operations contractor. This plan applies to the W-211 system software developed by the project, consisting of the computer human-machine interface (HMI) and programmable logic controller (PLC) software source and executable code, for production use by the waste tank operations contractor. The plan encompasses that portion of the W-211 RCS software represented on project-specific AUTOCAD drawings that are released as part of the C1 definitive design package (these drawings are identified on the drawing list associated with each C-1 package), and the associated software code. Implementation of the plan is required for formal acceptance testing and production release. The software configuration management plan does not apply to reports and data generated by the software except where specifically identified. Control of information produced by the software once it has been transferred for operation is the responsibility of the receiving organization
Rapid nickel diffusion in cold-worked carbon steel at 320-450 °C
Arioka, Koji; Iijima, Yoshiaki; Miyamoto, Tomoki
2015-11-01
The diffusion coefficient of nickel in cold-worked carbon steel was determined with the diffusion couple method in the temperature range between 320 and 450 °C. Diffusion couple was prepared by electro-less nickel plating on the surface of a 20% cold-worked carbon steel. The growth in width of the interdiffusion zone was proportional to the square root of diffusion time to 12,000 h. The diffusion coefficient (DNi) of nickel in cold-worked carbon steel was determined by extrapolating the concentration-dependent interdiffusion coefficient to 0% of nickel. The temperature dependence of DNi is expressed by DNi = (4.5 + 5.7/-2.5) × 10-11 exp (-146 ± 4 kJ mol-1/RT) m2s-1. The value of DNi at 320 °C is four orders of magnitude higher than the lattice diffusion coefficient of nickel in iron. The activation energy 146 kJ mol-1 is 54% of the activation energy 270.4 kJ mol-1 for lattice diffusion of nickel in the ferromagnetic state iron.
Tank 241-C-107 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
The Defense Nuclear Facilities Safety Board (DNFSB) has advised the US Department of Energy (DOE) to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The data quality objective (DQO) process was chosen as a tool to be used to identify sampling and analytical needs for the resolution of safety issues. As a result, a revision in the Federal Facility Agreement and Consent Order (Tri-Party Agreement or TPA) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process... Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for the Tank 241-C-107 (C-107) sampling activities. Currently tank C-107 is categorized as a sound, low-heat load tank with partial isolation completed in December 1982. The tank is awaiting stabilization. Tank C-107 is expected to contain three primary layers of waste. The bottom layer should contain a mixture of the following wastes: ion exchange, concentrated phosphate waste from N-Reactor, Hanford Lab Operations, strontium semi-works, Battelle Northwest, 1C, TBP waste, cladding waste, and the hot semi-works. The middle layer should contain strontium recovery supernate. The upper layer should consist of non-complexed waste
The I-35W bridge Project Website
DEFF Research Database (Denmark)
Kampf, Constance
How can websites be used to rebuild trust? In August 2007, the Interstate Highway 35-W bridge in Minneapolis, MN collapsed during rush hour. Although many people were rescued and casualties were as limited as could be expected due to quick and effective intervention, the image of a major bridge...... collapsing during rush hour damaged the Minnesota Department of Transportation's reputation and resulted in the loss of public trust for the organization. The ensuing bridge reconstruction project included a project website intended to rebuild this trust through transparency, community involvement......, and the use of multimodal features. This paper looks at the I35-W bridge reconstruction project in Minneapolis through web-based communication by the Minnesota Department of Transportation (MnDOT) about the project. The MnDOT bridge reconstruction website will be examined using a combination of 1). Weick...
Engineering Task Plan for a vapor treatment system on Tank 241-C-103
International Nuclear Information System (INIS)
Conrad, R.B.
1995-01-01
This Engineering Task Plan describes tasks and responsibilities for the design, fabrication, test, and installation of a vapor treatment system (mixing system) on Tank 241-C-103. The mixing system is to be installed downstream of the breather filter and will use a mixing blower to reduce the chemical concentrations to below allowable levels
Srivastava, Ruby
2018-01-01
The electronic and optoelectronic properties of [A.2AP(w)/A*.2AP(WC)/C.2AP(w)/C*.2AP(WC)/C.A(w)/ C*.A(WC)]-Au8 metal-mismatch nucleobase complexes are investigated by means of density functional theory and time-dependent methods. We selected these mispairs as 2-aminopurine (2AP) produces incorporation errors when binding with cytosine (C) into the wobble (w) C.2AP(w) mispair, and is tautomerised into Watson-Crick (WC)-like base mispair C*.2AP(WC) and less effectively produces A.2AP(w)/A*.2AP(WC) mispairs. The vertical ionisation potential, vertical electron affinity, hardness and electrophilicity index of these complexes have also been discussed. The modifications of energy levels and charge density distributions of the frontier orbitals are also analysed. The absorption spectra of these complexes lie in the visible region, which suggests their application in fluorescent-bio imaging. The mechanism of cooperativity effect is studied by molecular orbital potential (MEP), atoms-in-molecules (AIM) and natural bond orbital analyses. Most metalated pairs have smaller HOMO-LUMO band gaps than the isolated mismatch nucleobases which suggest interesting consequences for electron transfer through DNA duplexes.
Implementasi Encoder dan Decoder Cyclic Redundancy Check Pada TMS320C6416T
Directory of Open Access Journals (Sweden)
Grace Natalia
2014-03-01
Full Text Available CRC merupakan metode yang paling populer digunakan saat ini karena kemampuanya paling baik dalam mendeteksi error. Pada Tugas Akhir ini memaparkan bagaimana CRC diimplementasikan pada TMS320C6416T. Evaluasi yang akan diteliti yaitu kinerja proses encoder dan decoder CRC sebagai fungsi Eb/No dari error per blok melalui kanal ideal AWGN dengan modulasi BPSK serta melihat seberapa besar kemampuan CRC dalam mendeteksi kesalahan. Pengujian yang dilakukan melalui simulink matlab dan implementasi secara real ke dalam TMS320C6416T. Adapun kode CRC yang dipilih yaitu CRC-8 dan CRC-16 dimana pada implementasi pada TMS dilakukan pengiriman sebesar 100.000 bit dalam 12.500 frame. Hasil pengujian yang diperoleh yaitu jumlah error yang dideteksi pada CRC-8 rata-rata jumlah error adalah 2.750 frame dan rata-rata jumlah error bit informasi 1.957 bit. Sedangkan untuk CRC-16 rata-rata jumlah error adalah 3.520 frame dan rata-rata jumlah error per bit informasi yaitu 1.971 bit. Dari pengujian membuktikan bahwa kemampuan CRC-16 dalam menjaga keamanan data bit informasi jauh lebih baik dibandingkan dengan CRC-8.
Project W-420 stack monitoring system upgrades
International Nuclear Information System (INIS)
CARPENTER, K.E.
1999-01-01
This project will execute the design, procurement, construction, startup, and turnover activities for upgrades to the stack monitoring system on selected Tank Waste Remediation System (TWRS) ventilation systems. In this plan, the technical, schedule, and cost baselines are identified, and the roles and responsibilities of project participants are defined for managing the Stack Monitoring System Upgrades, Project W-420
Acceptance test procedure for Project W-049H
International Nuclear Information System (INIS)
Buckles, D.I.
1994-01-01
The Acceptance Test Procedure (ATP) program for Project W-049H (200 Area Treated Effluent Disposal Facility [TEDF]) covers three activities as follows: (1) Disposal System; (2) Collection System; and (3) Instrumentation and Control System. Each activity has its own ATP. The purpose of the ATPs is to reverify that the systems have been constructed in accordance with the construction documents and to demonstrate that the systems function as required by the Project criteria. The Disposal System ATP covers the testing of the following: disposal line flowmeters, room air temperatures in the Disposal Station Sampling Building, effluent valves and position indicators, disposal pond level monitors, automated sampler, pressure relief valves, and overflow diversion sluice gates. The Collection System ATP covers the testing of the two pump stations and all equipment installed therein. The Instrumentation and Control (I and C) ATP covers the testing of the entire TEDF I and C system. This includes 3 OCS units, modem, and GPLI cabinets in the ETC control room; 2 pump stations; disposal station sampling building; and all LCUs installed in the field
Ferrocyanide safety program: Heat load and thermal characteristics determination for selected tanks
International Nuclear Information System (INIS)
McLaren, J.M.; Cash, R.J.
1993-11-01
An analysis was conducted to determine the heat loads, conductivities, and heat distributions of waste tanks 241-BY-105, -106, -108, -110, -111, and 241-C-109 at the Hanford Site. The heat distribution of tank 241-BY-111 was determined to be homogeneously distributed throughout the sludge contained in the tank. All of the other tanks, with the exception of 241-C-109, showed evidence of a heat-producing layer at the bottom of the tanks. No evidence of a heat-producing layer in a position above the bottom was found. The thermal conductivities were determined to be within the ranges found by previous laboratory and computer analysis. The heat loads of the tanks were found to be below 2.81 kW (9,600 Btu/hr)
Chemistry gains a new element: Z=106
International Nuclear Information System (INIS)
Gaeggeler, H.W.; Eichler, B.; Tuerler, A.
1997-01-01
Even though 112 chemical elements are presently known, for elements with atomic numbers above 105 only nuclear decay properties have been investigated so far. Such data allow to proof the existence of a given nuclide, but they do not yield any information with respect to the position of a chemical element in the Periodic Table. We have performed ever first chemical investigations of element 106. According to the Periodic Table element 106 should be a member of group 6, having similar chemical properties as W, Mo and Cr. Two different techniques were applied to separate and identify element 106: a liquid chromatography system (ARCA = Automated Rapid Chemistry Apparatus) and a continuous isothermal chromatography device (OLGA = On-Line Gaschemistry Apparatus). With ARCA about 5'000 separations on small cation exchange columns (Aminex A6) with a 0.1 M HNO 3 /5.10 -4 M Hf solution were performed and with OLGA the gas adsorption behaviour of oxychlorides on quartz columns using Cl 2 /SOCl 2 /O 2 as reactive gas were studied. On the basis of only ten detected atoms, it was possible to proof that element 106 forms complexes which are eluted at positions similar to those of Mo and W. In addition, in the gas phase element 106 forms oxychlorides of lower volatility compared to those of Mo and W. (author) 1 ref
Leak behaviors of steam generator tube-to-tubesheet joints from room temperature to 320 °C
International Nuclear Information System (INIS)
Bahn, Chi Bum; Majumdar, Saurin; Kasza, Ken E.; Shack, William J.
2013-01-01
To address concerns about excessive leakage from throughwall cracks in nuclear reactor tube-to-tubesheet joints under accident conditions, leak rates were measured experimentally by using tube-to-collar joint specimens and nitrogen gas. Rates were dependent on differential pressure between the tube internal surface and the crevice (i.e., the tube-to-collar interface region) and on temperature. As specimen temperature was raised to 320 °C, leak rates decreased gradually due to changes in gas properties and to differential thermal expansion between the Alloy 600 tubes and the SA508 collars. The leak rates did not change even after repeated temperature excursions to 320 °C, suggesting that thermally induced creep and subsequent contact pressure relaxation is negligible below that temperature. When considering factors that could increase flow resistance, such as oxidation, or debris on top of the tubesheet, the measured leak rates in this work are considered to be conservative. The test results were further used to validate the contact pressure calculation and a leak rate model. Highlights: ► Leak rates were measured by using tube-to-collar joint specimens. ► Leak rates were dependent on differential pressure between tube internal and joint interface. ► Leak rates decreased gradually as specimen temperature was raided to 320 °C. ► Differential thermal expansion between Alloy 600 tube and SA508 collar plays a major role on the leak behavior.
Acceptance Test Report for 241-U compressed air system
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027
Characterization of Material from Wells 299-W10-35 (C7573) and 299-W14-74 (C7024)
Energy Technology Data Exchange (ETDEWEB)
Tilton, Fred A.; Wellman, Dawn M.; Bovaird, Chase C.; Strandquist, Sara C.
2011-07-15
The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological) and, if the material is biological, to identify the microorganisms present.
Tank 241-C-111 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
This report presents the details of the Hanford waste tank characterization study for tank 241-C-111. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to tank farm workers due to fugitive emissions from the tank
Advanced conceptual design report solid waste retrieval facility, phase I, project W-113
International Nuclear Information System (INIS)
Smith, K.E.
1994-01-01
Project W-113 will provide the equipment and facilities necessary to retrieve suspect transuranic (TRU) waste from Trench 04 of the 218W-4C burial ground. As part of the retrieval process, waste drums will be assayed, overpacked, vented, head-gas sampled, and x-rayed prior to shipment to the Phase V storage facility in preparation for receipt at the Waste Receiving and Processing Facility (WRAP). Advanced Conceptual Design (ACD) studies focused on project items warranting further definition prior to Title I design and areas where the potential for cost savings existed. This ACD Report documents the studies performed during FY93 to optimize the equipment and facilities provided in relation to other SWOC facilities and to provide additional design information for Definitive Design
Fractal Communication System Using Digital Signal Processing Starter Kit (DSK TMS320c6713
Directory of Open Access Journals (Sweden)
Arsyad Ramadhan Darlis
2015-12-01
Full Text Available In 1992, Wornell and Oppenheim did research on a modulation which is formed by using wavelet theory. In some other studies, proved that this modulation can survive on a few channels and has reliability in some applications. Because of this modulation using the concept of fractal, then it is called as fractalmodulation. Fractal modulation is formed by inserting information signal into fractal signals that are selffractal similary. This modulation technique has the potential to replace the OFDM (Orthogonal Frequency Division Multiplexing, which is currently used on some of the latest telecommunication technologies. The purpose of this research is to implement the fractal communication system using Digital Signal Processing Starter Kit (DSK TMS320C6713 without using AWGN and Rayleigh channel in order to obtain the ideal performance of the system. From the simulation results using MATLAB7.4. it appears that this communication system has good performance on some channels than any other communication systems. While in terms of implementation by using (DSK via TMS320C6713 Code Composer Studio (CCS, it can be concluded that thefractal communication system has a better execution time on some tests.
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
International Nuclear Information System (INIS)
JOHNSTON GA
2008-01-01
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D and D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D and D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D and D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and Liability Act of 1980
Gu, Yajuan; Chang, Xiaodan; Dai, Shan; Song, Qinghua; Zhao, Hongshan; Lei, Pengcheng
2017-09-10
Xeroderma pigmentosum (XP) is a rare, recessive hereditary disease characterized by sunlight hypersensitivity and high incidence of skin cancer with clinical and genetic heterogeneity. We collected two unrelated Chinese patients showing typical symptoms of XPC without neurologic symptoms. Direct sequencing of XPC gene revealed that patient 1 carried IVS1+1G>A and c.958 C>T mutations, and patient 2 carried c.545_546delTA and c.2257_2258insC mutations. All these four mutations introduced premature terminal codons (PTCs) in XPC gene. The nonsense mutation c.958 C>T yielded truncated mutant Q320X, and we studied its function for global genome repair kinetics. Overexpressed Q320X mutant can localize to site of DNA damage, but it is defective in CPD and 6-4PP repair. Readthrough of PTCs is a new approach to treatment of genetic diseases. We found that aminoglycosides could significantly increase the full length protein expression of Q320X mutant, but NER defects were not rescued in vitro. Copyright © 2017 Elsevier B.V. All rights reserved.
Kinerja Modulasi BPSK Modem Software Defined Radio Pada DSK TMS320C6713
Sari, Sapriesty Nainy
2016-01-01
— Software Defined Radio (SDR) is a signal processing technology that optimizes the use of PC as a device supporting. With the application of SDR in wireless communication system so it will provide possibility and flexibility on manipulating DSP without the need of hardware changes. SDR modems are designed to take advantage of Digital Signal Processor Starter Kit (DSK) TMS320C6713 for baseband signal processing. In the implementation phase, the DSK is programmed directly using Matlab Simulink...
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Characterization of Direct Push Vadose Zone Sediments from the 241-U Single-Shell Tank Farm
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Valenta, Michelle M.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Iovin, Cristian; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-12-20
The overall goals of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., are 1) to define risks from past and future single-shell tank farm activities, 2) to identify and evaluate the efficacy of interim measures, and 3) to aid, via collection of geochemical information and data, the future decisions that must be made by the U.S. Department of Energy (DOE) regarding the near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas (WMAs). For a more complete discussion of the goals of the Tank Farm Vadose Zone Project, see the overall work plan, Phase 1 RCRA Facility Investigation/Corrective Measures Study Work Plan for the Single-Shell Tank Waste Management Areas (DOE 1999). Specific details on the rationale for activities performed at WMA U are found in Crumpler (2003). To meet these goals, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory (PNNL) to perform detailed analyses of vadose zone sediment collected within the U Single-Shell Tank Farm. Specifically, this report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from ten direct push characterization holes emplaced to investigate vadose zone contamination associated with potential leaks within the 241-U Single-Shell Tank Farm. Specific tanks targeted during this characterization campaign included tanks 241-U-104/241-U-105, 241-U-110, and 241-U-112. Additionally, this report compiles data from direct push samples collected north of tank 241-U-201, as well as sediment collected from the background borehole (C3393). After evaluating all the characterization and analytical data, there is no question that the vadose zone in the vicinity of tanks 241-U-104 and 241-U-105 has been contaminated by tank-related waste. This observation is not new, as gamma logging of drywells in the area has identified uranium contamination at the
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-08-05
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-07-29
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
Tank 241-C-111 headspace gas and vapor sample results - August 1993 samples
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Tank 241-C-111 is on the ferrocyanide Watch List. Gas and vapor samples were collected to assure safe conditions before planned intrusive work was performed. Sample analyses showed that hydrogen is about ten times higher in the tank headspace than in ambient air. Nitrous oxide is about sixty times higher than ambient levels. The hydrogen cyanide concentration was below 0.04 ppbv, and the average NO x concentration was 8.6 ppmv
Project W-211 initial tank retrieval systems year 2000 compliance assessment project plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-211. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance
Project W-049H disposal facility test report
International Nuclear Information System (INIS)
Buckles, D.I.
1995-01-01
The purpose of this Acceptance Test Report (ATR) for the Project W-049H, Treated Effluent Disposal Facility, is to verify that the equipment installed in the Disposal Facility has been installed in accordance with the design documents and function as required by the project criteria
Tank farm restoration and safe operation, Project W-314, upgrade scope summary report (USSR)
International Nuclear Information System (INIS)
Gilbert, J.L.
1998-01-01
The revision to the Project W-314 Upgrade Scope Summary Report (USSR), incorporates changes to the project scope from customer guidance. Included are incorporation of the recommendations from HNF-2500, agreements regarding interfaces with Project W-211, and assumption of scope previously assigned to Project W-454
Waste retrieval sluicing system campaign number 1 solids volume transferred calculation
International Nuclear Information System (INIS)
BAILEY, J.W.
1999-01-01
This calculation has been prepared to document the volume of sludge removed from tank 241-C-106 during Waste Retrieval Sluicing System (WRSS) Sluicing Campaign No.1. This calculation will be updated, if necessary, to incorporate new data. This calculation supports the declaration of completion of WRSS Campaign No.1 and, as such, is also the documentation for completion of Performance Agreement TWR 1.2.1 , C-106 Sluicing Performance Expectations. It documents the performance of all the appropriate tank 241-C-106 mass transfer verifications, evaluations, and appropriate adjustments discussed in HNF-SD-WM-PROC-021, Chapter 23, ''Process Engineering Calculations for Tank 241-C-106 Sluicing and Retrieval''
Waste retrieval sluicing system campaign number 1 solids volume transferred calculation
International Nuclear Information System (INIS)
BAILEY, J.W.
1999-01-01
This calculation has been prepared to document the volume of sludge removed from tank 241-C-106 during Waste Retrieval Sluicing System (WRSS) Sluicing Campaign No.1. This calculation will be updated, if necessary, to incorporate new data. This calculation supports the declaration of completion of WRSS Campaign No.1 and, as such, is also the documentation for completion of Performance Agreement TWR 1.2.1 C-106 Sluicing Performance Expectations. It documents the performance of all the appropriate tank 241-C-106 mass transfer verifications, evaluations, and appropriate adjustments discussed in HNF-SD-WM-PROC-021, Chapter 23, ''Process Engineering Calculations for Tank 241-C-106 Sluicing and Retrieval''
Lõhmus, Uno, 1952-
2009-01-01
Euroopa Kohtus said vastuse kaks esimest Eesti kohtute poolt esitatud eelotsusetaotlust: C-241/07 keskkonnasõbraliku põllumajandustootmise toetamise kohta ja C-560/07 üleliigse laovaru tasu määramise kohta
Highly efficient production of L-lactic acid from xylose by newly isolated Bacillus coagulans C106.
Ye, Lidan; Zhou, Xingding; Hudari, Mohammad Sufian Bin; Li, Zhi; Wu, Jin Chuan
2013-03-01
Cost-effective production of optically pure lactic acid from lignocellulose sugars is commercially attractive but challenging. Bacillus coagulans C106 was isolated from environment and used to produce l-lactic acid from xylose at 50°C and pH 6.0 in mineral salts medium containing 1-2% (w/v) of yeast extract without sterilizing the medium before fermentation. In batch fermentation with 85g/L of xylose, lactic acid titer and productivity reached 83.6g/L and 7.5g/Lh, respectively. When fed-batch (120+80+60g/L) fermentation was applied, they reached 215.7g/L and 4.0g/Lh, respectively. In both cases, the lactic acid yield and optical purity reached 95% and 99.6%, respectively. The lactic acid titer and productivity on xylose are the highest among those ever reported. Ca(OH)2 was found to be a better neutralizing agent than NaOH in terms of its giving higher lactic acid titer (1.2-fold) and productivity (1.8-fold) under the same conditions. Copyright © 2013 Elsevier Ltd. All rights reserved.
Plant uptake and transport of 241Am
International Nuclear Information System (INIS)
Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.
1981-01-01
We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers
2010-07-01
...) Public institutions of undergraduate higher education, 106.15(e) Recruitment, [34, 35]; 106.23 Specific...(d) Pre-Employment Inquiry Recruitment, [83, 90, 91, 95] Sex as a BFOQ, [96]; 106.61 Student... organizations”, 106.31(c) Fraternities/Sororities Social, [53, 27, 28]; 106.14(a) Business/professional, [40, 53...
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
Energy Technology Data Exchange (ETDEWEB)
JOHNSTON GA
2008-01-15
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D&D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D&D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D&D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and
Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1997-09-01
Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization
Operational test report for the AY-102 Enraf densitometer control and acquisition system
International Nuclear Information System (INIS)
Huber, J.H.
1998-01-01
On June 2 through June 10, 1998, the AY-102 Tank Densitometer Control and Acquisition System was operationally tested per OTP-320-01 O Revision A-O. The test was performed at the Department of Energy's Hanford Site, 200 East Area, 241-AY Tank Farm. The test validated the functionality of the Enraf 854 ATG Densitometer Gauge and Enraf Control Panel software for use by project W-320, Waste Retrieval Sluicing System (WRSS). The purpose of the test procedure was two fold: (1) to verify the functionality of the Enraf 854 ATG as a Densitometer and (2) to verify the functionality of the Enraf Control Panel Software density acquisition routines. The densitometer was previously acceptance tested per HNF-SD-WM-ATP-077. The software was previously acceptance tested per HNF-1991
Thermodynamic assessment of the Nb-W-C system
International Nuclear Information System (INIS)
Huang Weiming; Selleby, M.
1997-01-01
The phase equilibrium and thermodynamic information of the Nb-W-C system was reviewed and assessed by using thermodynamic models for the Gibbs energy of individual phases. The assessment was based on the recent evaluations of the W-C, Nb-W and Nb-C, which was revised in the present work taking ternary information into account. The model parameters were evaluated by fitting the selected experimental data by means of a computer program. A consistent set of parameters was obtained, which satisfactorily describes most of the experimental information. (orig.)
Biosorption of americium-241 by immobilized Rhizopus arrihizus
International Nuclear Information System (INIS)
Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji
2004-01-01
Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3
Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula
Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.
International Nuclear Information System (INIS)
RASMUSSEN, O.R.
2000-01-01
This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies
Material mixing on W/C twin limiter in TEXTOR-94
International Nuclear Information System (INIS)
Tanabe, T.; Ohgo, T.; Wada, M.; Rubel, M.; Philipps, V.; Seggern, J. von; Ohya, K.; Huber, A.; Pospieszczyk, A.; Schweer, B.
2000-01-01
In order to investigate the effect of mutual contamination between tungsten (W) and carbon (C) and its influence on the plasma, a W-C twin test limiter, half made of W and the other half of C, was inserted into the edge plasma of TEXTOR-94 under ohmic and NBI heating conditions. The contamination process was observed by spectroscopy, and the intensity distribution of WI showed migration of W onto the C side by the successive cycles of sputtering and prompt redeposition. On the other hand, the deposition of C on the W surface was not obvious. Most of the hydrogen (deuterium) on the limiter was found to be retained in the deposited layers and that in the deposited C layer much higher than that in the deposited W layer. This indicates that tritium retention is smaller in metallic deposits above 500 K. The AES analysis conducted after the exposure of the test limiter showed that W deposited on C reacted with the substrate to form carbides at higher temperatures. The thickness of carbide layer, and/or the content of W in C were influenced by the temperature and flux distributions, and no carbide layer was formed at the limiter edge where the temperature was relatively low
Iwanejko, L; Smith, K N; Loeillet, S; Nicolas, A; Fabre, F
1999-10-01
We have carried out the systematic disruption of six ORFs on chromosome XV, of Saccharomyces cerevisiae using the long flanking homology technique to replace each with the KanMX cassette; we have also constructed plasmids containing replacement cassettes and cognate clones for each ORF. Disruption of three of the ORFs-YOL117w, YOL114c, and YOL112w (also known as MSB4)-does not result in any noteworthy phenotype with respect to temperature or nutritional requirements, but yol112w mutants with an additional disruption of YNL293w, which encodes a protein similar to Yol112w, exhibit a slow growth phenotype. The protein specified by YOL114c shares similarity with the human DS-1 protein. Disruption of YOL115w confers slow growth, cold sensitivity and poor sporulation; this ORF has been described elsewhere as TRF4, which encodes a topoisomerase I-related protein. Cells with disruptions of YOL111c, whose product is weakly similar to the human ubiquitin-like protein GdX, are slightly impaired in mating. Mutants disrupted for YOL072w, the predicted product of which is unrelated to any protein of known function, grow slowly, are cold-sensitive and sporulate with reduced efficiency. Copyright 1999 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Thomas, B.L.; Evans, J.C.; Pool, K.H.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices
Final Report of Tank 241-C-105 Dissolution, the Phase 2 Study
International Nuclear Information System (INIS)
Meznarich, Huei K.; Bolling, Stacey D.; Cooke, Gary A.; Ely, Thomas M.; Herting, Daniel L.; Lachut, James S.; LaMothe, Margaret E.
2016-01-01
Three clamshell grab samples were taken from Tank 241-C-105 in October 2015 in accordance with RPP-PLAN-60011. Analytical results of those samples were issued in the report RPP-RPT-59115 by Wastren Advantage, Inc., Hanford Laboratory. Solid phase characterization results were reported separately in LAB-RPT-15-00011 and in RPP-RPT-59147. The major solid phases reported to be present were dawsonite [NaAlCO 3 (OH) 2 ], trona [Na 3 (HCO 3 )(CO 3 )⋅2H 2 O], cejkaite [Na 4 (UO 2 )(CO 3 ) 3 ], and an unidentified organic solid, with minor amounts of gibbsite [Al(OH) 3 ], natrophosphate [Na 7 F(PO 4 ) 2 ⋅19H 2 O], and traces of unidentified iron-rich and manganese-rich phases. Note that the presence of dawsonite, trona, and cejkaite requires a relatively low pH, likely around pH 9 to 10. One aliquot of each grab sample was provided to 222-S Laboratory Process Chemistry for dissolution studies. Phase 1 of the dissolution testing followed the approved test plan, WRPS-1404813, Rev. 3, and examined the behavior of the Tank 241-C-105 solids treated with water, 19M sodium hydroxide, 2M nitric acid, and 0.5M oxalic acid/2M nitric acid. Phase 2 of the testing was conducted in accordance with instructions from the client and emphasized treatment with 19M sodium hydroxide followed by water washing. This is the report of the Phase 2 testing.
Project W-519 TWRS privatization phase 1 infrastructure year 2000 compliance assessment project plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-519. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance
Measuring c-quark polarization in W+c samples at ATLAS and CMS
Kats, Yevgeny
2016-01-01
The process $pp \\to W^-c$ produces polarized charm quarks. The polarization is expected to be partly retained in $\\Lambda_c$ baryons when those form in the $c$-quark hadronization. We argue that it will likely be possible for ATLAS and CMS to measure the $\\Lambda_c$ polarization in the $W$+$c$ samples in Run 2 of the LHC. This can become the first measurement ever of a longitudinal polarization of charm quarks. Its results will provide a unique input to the understanding of polarization transfer in fragmentation. They will also allow applying the same measurement technique to other (e.g., new physics) samples of charm quarks in which the polarization is a priori unknown. The proposed analysis is similar to the ATLAS and CMS measurements of the $W$+$c$ cross section in the 7 TeV run that used reconstructed $D$-meson decays for charm tagging.
Thermodynamics of the Mo-Fe-C and W-Fe-C systems
International Nuclear Information System (INIS)
Kleykamp, H.
1978-01-01
A study on the reaction behaviour of the components of the Mo 2 C-Fe and WC-Fe systems is presented. Both systems are stable if the mono-phase carbides are in equilibrium with the Fe-C solid solution within fixed carbon concentrations, the limits of which are calculated in this paper. Gibbs energies of formation at 1273 K of the intermetallic phases, of the binary and of the ternary carbides in the Mo-Fe-C and W-Fe-C systems were determined. The Fe corner in the phase diagrams of both systems and the calculated C boundaries in the two-phase field γ-Fe(Mo,C)-Mo 2 C and the γ-Fe(W,C)-WC, respectively, based on this study, are shown in figures. (GSC) [de
Investigation of cosputtered W--C thin films as diffusion barriers
International Nuclear Information System (INIS)
Yang, H.Y.; Zhao, X.
1988-01-01
Polycrystalline thin films of W--C were deposited on single-crystal Si or SiO 2 substrates by rf planar magnetron cosputtering of graphite (C) and W targets. The performance of cosputtered W 75 C 25 thin films as diffusion barriers between a Si substrate and metallic overlayers of Ag, Au, or Al was investigated. Backscattering spectrometry and x-ray diffraction are used to detect metallurgical interactions. Four-point probe measurement of resistance is employed to monitor the electrical stability of the metallization schemes upon thermal annealing in a vacuum for 30 min in temperature ranges from 500 to 700 0 C. The electrical resistivity of W 75 C 25 films is 140 μΩ cm. A W 75 C 25 layer 1100 A thick prevents metallurgical interdiffusion and reaction between Au or Ag overlayers and the Si substrates up to 700 0 C, and between an Al overlayer and the Si substrate up to 450 0 C.tential
5W intracavity frequency-doubled green laser for laser projection
Yan, Boxia; Bi, Yong; Li, Shu; Wang, Dongdong; Wang, Dongzhou; Qi, Yan; Fang, Tao
2014-11-01
High power green laser has many applications such as high brightness laser projection and large screen laser theater. A compact and high power green-light source has been developed in diode-pumped solid-state laser based on MgO doped periodically poled LiNbO3 (MgO:PPLN). 5W fiber coupled green laser is achieved by dual path Nd:YVO4/MgO:PPLN intra-cacity frequency-doubled. Single green laser maximum power 2.8W at 532nm is obtained by a 5.5W LD pumped, MgO:PPLN dimensions is 5mm(width)×1mm(thickness)×2mm(length), and the optical to optical conversion efficiency is 51%. The second LD series connected with the one LD, the second path green laser is obtained using the same method. Then the second path light overlap with the first path by the reflection mirrors, then couple into the fiber with a focus mirror. Dual of LD, Nd:YVO4, MgO:PPLN are placed on the same heat sink using a TEC cooling, the operating temperature bandwidth is about 12°C and the stablity is 5% in 96h. A 50×50×17mm3 laser module which generated continuous-wave 5 W green light with high efficiency and width temperature range is demonstrated.
Structural rearrangements in the C/W(001) surface system
International Nuclear Information System (INIS)
Lyman, P.F.; Mullins, D.R.
1995-01-01
We have investigated the surface structure of the C/W(001) surface system at submonolayer C coverages using Auger-electron spectroscopy and high-resolution core-level photoelectron spectroscopy. Core-level spectroscopy is a sensitive probe of an atom's local electronic environment; by examining the core levels of the W atoms in the selvedge region, we monitored the response of the substrate to C adsorption. The average shift of the 4f core-level binding energy provided evidence for a heretofore unknown surface reconstruction that occurs upon submonolayer C adsorption. We also performed line-shape analysis on these core-level spectra, and have thereby elucidated the mechanism by which the low-coverage (√2 x √2 )R45 degree structure evolves to a c(3 √2 x √2 )R45 degree arrangement upon further C adsorption. The line-shape analysis also provides corroborating evidence for a proposed model of the saturated C/W(001)-(5x1) surface structure, and suggests that the first two or three atomic W layers are perturbed by the C adsorption and attendant reconstruction
Project W-049H Collection System Acceptance Test
International Nuclear Information System (INIS)
Buckles, D.I.
1994-01-01
The Acceptance Test Procedure (ATP) Program for Project W-049H covers the following activities: Disposal system, Collection system, Instrumentation and control system. Each activity has its own ATP. The purpose of the ATPs is to verify that the systems have been constructed in accordance with the construction documents and to demonstrate that the systems function as required by the Project criteria. This ATP has been prepared to demonstrate that the Collection System Instrumentation functions as required by project criteria
Operability Test Report for 241-T compressed air system and heat pump
International Nuclear Information System (INIS)
Freeman, R.D.
1995-02-01
This Operability Test Report (OTR) documents the results of functional testing performed on the operating parameters of the 241-T-701 Compressed Air System. The System was successfully installed and tested per work package 2W-92-01172
Comparison of the mechanically alloyed (V,W)C and (V,W)C-co powders
CSIR Research Space (South Africa)
Bolokang, AS
2008-01-01
Full Text Available in XRD patterns because they were of extremely fine grain size.As a result of the loss ofVandWthrough oxidation, free carbonwas also found in the final powder. The lattice parameter of the (V,W)C powder increased with milling time up to a maximum...
Final Report of Tank 241-C-105 Dissolution, the Phase 2 Study
Energy Technology Data Exchange (ETDEWEB)
Meznarich, Huei K. [Washington River Protection Solutions LLC., Richland, WA (United States); bolling, Stacey D. [Washington River Protection Solutions LLC., Richland, WA (United States); Cooke, Gary A. [Washington River Protection Solutions LLC., Richland, WA (United States); Ely, Thomas M. [Washington River Protection Solutions LLC., Richland, WA (United States); Herting, Daniel L. [Washington River Protection Solutions LLC., Richland, WA (United States); Lachut, James S. [Washington River Protection Solutions LLC., Richland, WA (United States); LaMothe, Margaret E. [Washington River Protection Solutions LLC., Richland, WA (United States)
2016-10-01
Three clamshell grab samples were taken from Tank 241-C-105 in October 2015 in accordance with RPP-PLAN-60011. Analytical results of those samples were issued in the report RPP-RPT-59115 by Wastren Advantage, Inc., Hanford Laboratory. Solid phase characterization results were reported separately in LAB-RPT-15-00011 and in RPP-RPT-59147. The major solid phases reported to be present were dawsonite [NaAlCO3(OH)2], trona [Na3(HCO3)(CO3)·2H2O], cejkaite [Na4(UO2)(CO3)3], and an unidentified organic solid, with minor amounts of gibbsite [Al(OH)3], natrophosphate [Na7F(PO4)2·19H2O], and traces of unidentified iron-rich and manganese-rich phases. Note that the presence of dawsonite, trona, and cejkaite requires a relatively low pH, likely around pH 9 to 10. One aliquot of each grab sample was provided to 222-S Laboratory Process Chemistry for dissolution studies. Phase 1 of the dissolution testing followed the approved test plan, WRPS-1404813, Rev. 3, and examined the behavior of the Tank 241-C-105 solids treated with water, 19M sodium hydroxide, 2M nitric acid, and 0.5M oxalic acid/2M nitric acid. Phase 2 of the testing was conducted in accordance with instructions from the client and emphasized treatment with 19M sodium hydroxide followed by water washing. This is the report of the Phase 2 testing.
Privacy Issues of the W3C Geolocation API
Doty, Nick; Mulligan, Deirdre K.; Wilde, Erik
2010-01-01
The W3C's Geolocation API may rapidly standardize the transmission of location information on the Web, but, in dealing with such sensitive information, it also raises serious privacy concerns. We analyze the manner and extent to which the current W3C Geolocation API provides mechanisms to support privacy. We propose a privacy framework for the consideration of location information and use it to evaluate the W3C Geolocation API, both the specification and its use in the wild, and recommend s...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HUBER HJ
2011-04-21
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Energy Technology Data Exchange (ETDEWEB)
Sauter, Philipp Andre
2012-06-13
In this study tungsten-doped carbon films (a-C:W) were investigated with respect on hydrogen retention and erosion under deuterium (D) impact. a-C:W was used as model system for mixed layers, which will be deposited on the inner wall of the fusion reactor ITER. The erosion is lowered by the successive enrichment of tungsten at the surface and only mildly depends on the dopant concentration and the temperature. The hydrogen retention is determined by the diffusion of D into depth, which increases with temperature. The resulting successive accumulation of D in a-C:W is insensitive on enrichment for high fluences and in line with the accumulation of D in C.
Dimethylformamide as a cryoprotectant for canine semen diluted and frozen in ACP-106C.
Mota Filho, A C; Teles, C H A; Jucá, R P; Cardoso, J F S; Uchoa, D C; Campello, C C; Silva, A R; Silva, L D M
2011-10-15
The objective was to assess the effect of adding various concentrations of dimethylformamide on characteristics of canine semen diluted in powdered coconut water (ACP-106C; ACP Biotecnologia, Fortaleza, CE, Brazil) and frozen at -196°C. Fifteen ejaculates were collected by manual stimulation from five adult Boxer dogs. The sperm-rich fraction was diluted in ACP-106C (ACP Biotecnologia) containing 10% egg yolk and divided into four aliquots. The cryoprotectants used for each aliquot were 6% glycerol (control group; CG) or 2%, 4%, or 6% dimethylformamide (DF2, DF4, and DF6, respectively). After thawing, total motility (mean ± SEM) for CG (58.4 ± 24.6) was higher (P Biotecnologia) and 10% egg yolk as a diluent, yielded unsatisfactory in vitro results for freezing canine semen. Copyright © 2011 Elsevier Inc. All rights reserved.
Results of Characterization and Retrieval Testing on Tank 241-C-109 Heel Solids
Energy Technology Data Exchange (ETDEWEB)
Callaway, William S.
2013-09-26
test samples at temperatures ranging from 26-30 °C. The metathesized sodium aluminate was then dissolved by addition of volumes of water approximately equal to 1.3 times the volumes of caustic added to the test slurries. Aluminate dissolution was allowed to proceed for 2 days at ambient temperatures of ≈29 °C. Overall, the sequential water and caustic dissolution tests dissolved and removed 80.0 wt% of the tank 241-C-109 crushed heel solids composite test sample. The 20 wt% of solids remaining after the dissolution tests were 85-88 wt% gibbsite. If the density of the residual solids was approximately equal to that of gibbsite, they represented ≈17 vol% of the initial crushed solids composite test sample. In the water dissolution tests, addition of a volume of water ≈6.9 times the initial volume of the crushed solids composite was sufficient to dissolve and recover essentially all of the natrophosphate present. The ratio of the weight of water required to dissolve the natrophosphate solids to the estimated weight of natrophosphate present was 8.51. The Environmental Simulation Program (OLI Systems, Inc., Morris Plains, New Jersey) predicts that an 8.36 w/w ratio would be required to dissolve the estimated weight of natrophosphate present in the absence of other components of the heel solids. Only minor amounts of Al-bearing solids were removed from the composite solids in the water dissolution tests. The caustic metathesis/aluminate dissolution test sequence, executed at temperatures ranging from 27-30 °C, dissolved and recovered ≈69 wt% of the gibbsite estimated to have been present in the initial crushed heel solids composite. This level of gibbsite recovery is consistent with that measured in previous scoping tests on the dissolution of gibbsite in strong caustic solutions. Overall, the sequential water and caustic dissolution tests dissolved and removed 80.3 wt% of the tank 241-C-109 aggregate solids test sample. The residual solids were
Project W-151 Tank 101-AZ Waste Retrieval System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-151. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance
Analysis of BY-106 pump pit cover plate
International Nuclear Information System (INIS)
Coverdell, B.L.
1994-01-01
A new cover for the pump pit of Tank 241-BY-106 has been designed to allow the rotary core exhauster to be hooked up without requiring pit entry, riser modification, or equipment removal. The new pit cover is necessary to allow installation of two risers for reducing exposure, contamination, and waste. Computer analysis indicates that the safety margin of the pit cover plate with two risers is adequate. The computer stress model and input files are attached. The pit cover plate is a replacement for an existing plate; therefore seismic and wind loads were considered for the plate only
International Nuclear Information System (INIS)
Parazin, R.J.
1998-01-01
This document describes the functional and physical interfaces between the Tank Waste Remediation System (TWRS) Privatization Phase 1 Infrastructure Project W-519 and the various other projects (i.e., Projects W-314, W-464, W-465, and W-520) supporting Phase 1 that will require the allocation of land in and about the Privatization Phase 1 Site and/or interface with the utilities extended by Project W-519. Project W-519 will identify land use allocations and upgrade/extend several utilities in the 200-East Area into the Privatization Phase 1 Site (formerly the Grout Disposal Compound) in preparation for the Privatization Contractors (PC) to construct treatment facilities. The project will upgrade/extend: Roads, Electrical Power, Raw Water (for process and fire suppression), Potable Water, and Liquid Effluent collection. The replacement of an existing Sanitary Sewage treatment system that may be displaced by Phase 1 site preparation activities may also be included
Project W-058 monitor and control system logic
International Nuclear Information System (INIS)
ROBERTS, J.B.
1999-01-01
This supporting document contains the printout of the control logic for the Project W-058 Monitor and Control System, as developed by Programmable Control Services, Inc. The logic is arranged in five appendices, one for each programmable logic controller console
Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Bordyuzhin, Igor; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kosmyntseva, Alena; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano
2017-04-10
The production of $t\\overline{t}$, $W+b\\overline{b}$ and $W+c\\overline{c}$ is studied in the forward region of proton-proton collisions collected at a centre-of-mass energy of 8 TeV by the LHCb experiment, corresponding to an integrated luminosity of 1.98 $\\pm$ 0.02 $\\mbox{fb}^{-1}$. The $W$ bosons are reconstructed in the decays $W\\rightarrow\\ell\
Energy Technology Data Exchange (ETDEWEB)
Huang, Bin; Xiong, Weihao, E-mail: whxiong@hust.edu.cn; Zhang, Man; Jing, Yong; Li, Baolong; Luo, Haifeng; Wang, Shengqing
2016-08-15
(Ti{sub 1-x}W{sub x})C solid solutions (x = 0.05, 0.15, 0.25, 0.35) were synthesized by carbothermal reduction and then were used as hard phases to prepare (Ti,W)C-Ni{sub 3}Al cermets by vacuum sintering. (Ti,W)C-Ni{sub 3}Al cermets showed weak core-rim structure carbide particles embedded in Ni{sub 3}Al binder. As W content in (Ti,W)C increased, core-rim structure of carbide particles got weaker and the contrast of particles lowered down in SEM-BSE morphologies. Furthermore, the densification of cermets was promoted with W content in solid solution increasing, meanwhile TRS and toughness of cermets were improved obviously. In this paper, the wettability of molten metal on different group transition metal carbides was discussed in detail based on valence-electron configurations (VECs) of carbides. - Highlights: • (Ti{sub 1-x}W{sub x})C solid solutions were synthesized by carbothermal reduction. • (Ti,W)C-Ni{sub 3}Al cermets were prepared through powder metallurgy route. • The increase of W can improve wetting and densification significantly. • (Ti,W)C-Ni{sub 3}Al cermets showed a weak core-rim structure particles embedded in binder. • Wetting behavior were discussed from valence-electron configurations of carbides.
Risk Management Plan for Tank Farm Restoration and Safe Operations, Project W-314
International Nuclear Information System (INIS)
MCGREW, D.L.
2000-01-01
The Risk Management Plan for Project W-314 describes the systems, processes and procedures for implementation of applicable risk management practices described in HNF-0842, Volume IV, Section 2.6, ''Risk Management''. This plan is tailored specifically for use by Project W-314
System design description for portable 1,000 CFM exhauster Skids POR-007/Skid E and POR-008/Skid F
International Nuclear Information System (INIS)
Nelson, O.D.
1998-01-01
The primary purpose of the two 1,000 CFM Exhauster Skids, POR-007-SKID E and POR-008-SKID F, is to provide backup to the waste tank primary ventilation systems for tanks 241-C-106 and 241-AY-102, and the AY-102 annulus in the event of a failure during the sluicing of tank 241-C-106 and subsequent transfer of sluiced waste to 241-AY-102. This redundancy is required since both of the tank ventilation systems have been declared as Safety Class systems
System Safety Program Plan for Project W-314, tank farm restoration and safe operations
International Nuclear Information System (INIS)
Boos, K.A.
1996-01-01
This System Safety Program Plan (SSPP) outlines the safety analysis strategy for project W-314, ''Tank Farm Restoration and Safe Operations.'' Project W-314 will provide capital improvements to Hanford's existing Tank Farm facilities, with particular emphasis on infrastructure systems supporting safe operation of the double-shell activities related to the project's conceptual Design Phase, but is planned to be updated and maintained as a ''living document'' throughout the life of the project to reflect the current safety analysis planning for the Tank Farm Restoration and Safe Operations upgrades. This approved W-314 SSPP provides the basis for preparation/approval of all safety analysis documentation needed to support the project
Energy Technology Data Exchange (ETDEWEB)
Fischer, H.; Volkland, H.P.; Stumpf, R.
1996-10-01
The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.
Functions and requirements for tank farm restoration and safe operations, Project W-314. Revision 3
International Nuclear Information System (INIS)
Garrison, R.C.
1995-01-01
This Functions and Requirements document (FRD) establishes the basic performance criteria for Project W-314, in accordance with the guidance outlined in the letter from R.W. Brown, RL, to President, WHC, ''Tank Waste Remediation System (TWRS) Project Documentation Methodology,'' 94-PRJ-018, dated 3/18/94. The FRD replaces the Functional Design Criteria (FDC) as the project technical baseline documentation. Project W-314 will improve the reliability of safety related systems, minimize onsite health and safety hazards, and support waste retrieval and disposal activities by restoring and/or upgrading existing Tank Farm facilities and systems. The scope of Project W-314 encompasses the necessary restoration upgrades of the Tank Farms' instrumentation, ventilation, electrical distribution, and waste transfer systems
Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204
International Nuclear Information System (INIS)
Simpson, B.C.
1998-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center
International Nuclear Information System (INIS)
Parazin, R.J.
1998-01-01
This Project Execution Plan (PEP) defines the overall strategy, objectives, and contractor management requirements for the execution phase of Project W-519 (98-D403), Privatization Phase 1 Infrastructure Support, whose mission is to effect the required Hanford site infrastructure physical changes to accommodate the Privatization Contractor facilities. This plan provides the project scope, project objectives and method of performing the work scope and achieving objectives. The plan establishes the work definitions, the cost goals, schedule constraints and roles and responsibilities for project execution. The plan also defines how the project will be controlled and documented
Directory of Open Access Journals (Sweden)
Peng Guo
2013-01-01
Full Text Available W-incorporated diamond-like carbon (W-C:H films were fabricated by a hybrid beams system consisting of a DC magnetron sputtering and a linear ion source. The W concentration (1.08~31.74 at.% in the film was controlled by varying the sputtering current. The cross-sectional topography, composition, and microstructure of the W-C:H films were investigated by SEM, XPS, TEM, and Raman spectroscopy. The mechanical and tribological properties of the films as a function of W concentration were evaluated by a stress-tester, nanoindentation, and ball-on-disk tribometer, respectively. The results showed that films mainly exhibited the feature of amorphous carbon when W concentration of the films was less than 4.38 at.%, where the incorporated W atoms would be bonded with C atoms and resulted in the formation of WC1-x nanoparticles. The W-C:H film with 4.38 at.% W concentration showed a minimum value of residual compressive stress, a higher hardness, and better tribological properties. Beyond this W concentration range, both the residual stress and mechanical properties were deteriorated due to the growth of tungsten carbide nanoparticles in the carbon matrix.
Effect of americium-241 on luminous bacteria. Role of peroxides
Energy Technology Data Exchange (ETDEWEB)
Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)
2011-04-15
The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.
Quality Assurance program plan - plutonium stabilization and handling project W-460
International Nuclear Information System (INIS)
SCHULTZ, J.W.
1999-01-01
This Quality Assurance Program Plan (QAPP) identifies Project Quality Assurance (QA) program requirements for all parties participating in the design, procurement, demolition, construction, installation, inspection and testing for Project W-460
Project Execution Plan for Project W-211 Initial Tank Retrieval Systems (ITRS)
International Nuclear Information System (INIS)
VAN BEEK, J.E.
2000-01-01
This Project Execution Plan documents the methodology for managing Project W-211. Project W-211, Initial Tank Retrieval Systems (ITRS), is a fiscal year 1994 Major Systems Acquisition that will provide systems for retrieval of radioactive wastes from selected double-shell tanks (DST). The contents of these tanks are a combination of supernatant liquids and settled solids. To retrieve waste from the tanks, it is first necessary to mix the liquid and solids prior to transferring the slurry to alternative storage or treatment facilities. The ITRS will provide systems to mobilize the settled solids and transfer the wastes out of the tanks. In so doing, ITRS provides feed for the future waste treatment plant, allows for consolidation of tank solids to manage space within existing DST storage capacity, and supports continued safe storage of tank waste. The ITRS scope has been revised to include waste retrieval systems for tanks AP-102, AP-104, AN-102, AN-103, AN-104, AN-105, AY-102, AZ-102, and SY-102. This current tank selection and sequence provides retrieval systems supporting the River Protection Project (RF'P) Waste Treatment Facility and sustains the ability to provide final remediation of several watch list DSTs via treatment. The ITRS is configured to support changing program needs, as constrained by available budget, by maintaining the flexibility for exchanging tanks requiring mixer pump-based retrieval systems and shifting the retrieval sequence. Preliminary design was configured such that an adequate basis exists for initiating Title II design of a mixer pump-based retrieval system for any DST. This Project Execution Plan (PEP), derived from the predecessor Project Management Plan, documents the methodology for managing the ITRS, formalizes organizational responsibilities and interfaces, and identifies project requirements such as change control, design verification, systems engineering, and human factors engineering
Pershina, V; Anton, J
2013-05-07
Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.
Forward W + c, b-jet and Top Measurements with LHCb
INSPIRE-00258006
2015-01-01
Inclusive c and b-jet tagging algorithms have been developed to utilize the excellent secondary vertex reconstruction and resolution capabilities of the LHCb detector. The validation and performance of these tagging algorithms are reported using the full run 1 LHCb dataset at 7 and 8 TeV. Jet-tagging has been applied to muon+jet final states to measure both the W+c,b-jet charge asymmetries and the ratios of W+c,b-jet to W+jet and W+jet to Z+jet production. The forward top production cross-section is also measured using the muon+b-jet final. All results are found to be consistent with standard model predictions.
Americium-241 radioisotope thermoelectric generator development for space applications
International Nuclear Information System (INIS)
Ambrosi, Richard; Williams, Hugo; Samara-Ratna, Piyal
2013-01-01
Space nuclear power systems are under development in the UK in collaboration with European partners as part of a European Space Agency (ESA) programme. Radioisotope thermoelectric generators (RTG) are an important element of this new capability in Europe. RTG systems being developed in Europe are targeting the 10 W electric to 50 W electric power generation range adopting a modular scalable approach to the design. Radiogenic decay heat from radioisotopes can be converted to electrical power by using appropriate semiconductor based thermoelectric materials. The plan for Europe is to develop radioisotope space nuclear power systems based on both thermoelectric and Stirling power conversion systems. Although primarily focused on delivering up to 50 W of electrical power, the European radioisotope thermoelectric system development programme is targeting americium-241 as a fuel source and is maximizing the use of commercially available thermoelectric manufacturing processes in order to accelerate the development of power conversion systems. The use of americium provides an economic solution at high isotopic purity and is product of a separation process from stored plutonium produced during the reprocessing of civil nuclear fuel. A laboratory prototype that uses electrical heating as a substitute for the radioisotope was developed to validate the designs. This prototype has now been tested. This paper outlines the requirements for a European americium-241 fuelled RTG, describes the most recent updates in system design and provides further insight into recent laboratory prototype test campaigns. (author)
Americium-241 radioisotope thermoelectric generator development for space applications
Energy Technology Data Exchange (ETDEWEB)
Ambrosi, Richard; Williams, Hugo; Samara-Ratna, Piyal, E-mail: rma8@le.ac.uk [University of Leicester, (United Kingdom); and others
2013-07-01
Space nuclear power systems are under development in the UK in collaboration with European partners as part of a European Space Agency (ESA) programme. Radioisotope thermoelectric generators (RTG) are an important element of this new capability in Europe. RTG systems being developed in Europe are targeting the 10 W electric to 50 W electric power generation range adopting a modular scalable approach to the design. Radiogenic decay heat from radioisotopes can be converted to electrical power by using appropriate semiconductor based thermoelectric materials. The plan for Europe is to develop radioisotope space nuclear power systems based on both thermoelectric and Stirling power conversion systems. Although primarily focused on delivering up to 50 W of electrical power, the European radioisotope thermoelectric system development programme is targeting americium-241 as a fuel source and is maximizing the use of commercially available thermoelectric manufacturing processes in order to accelerate the development of power conversion systems. The use of americium provides an economic solution at high isotopic purity and is product of a separation process from stored plutonium produced during the reprocessing of civil nuclear fuel. A laboratory prototype that uses electrical heating as a substitute for the radioisotope was developed to validate the designs. This prototype has now been tested. This paper outlines the requirements for a European americium-241 fuelled RTG, describes the most recent updates in system design and provides further insight into recent laboratory prototype test campaigns. (author)
Accident consequence calculations for project W-058 safety analysis
International Nuclear Information System (INIS)
Van Keuren, J.C.
1997-01-01
This document describes the calculations performed to determine the accident consequences for the W-058 safety analysis. Project W-058 is the replacement cross site transfer system (RCSTS), which is designed to transort liquid waste between the 200 W and 200 E areas. Calculations for RCSTS safety analyses used the same methods as the calculations for the Tank Waste Remediation System (TWRS) Basis for Interim Operation (BIO) and its supporting calculation notes. Revised analyses were performed for the spray and pool leak accidents since the RCSTS flows and pressures differ from those assumed in the TWRS BIO. Revision 1 of the document incorporates review comments
Solid Waste Operations Complex W-113: Project cost estimate. Preliminary design report. Volume IV
International Nuclear Information System (INIS)
1995-01-01
This document contains Volume IV of the Preliminary Design Report for the Solid Waste Operations Complex W-113 which is the Project Cost Estimate and construction schedule. The estimate was developed based upon Title 1 material take-offs, budgetary equipment quotes and Raytheon historical in-house data. The W-113 project cost estimate and project construction schedule were integrated together to provide a resource loaded project network
TWRS phase 1 infrastructure project (W-519) characterization
International Nuclear Information System (INIS)
Mitchell, C.J.
1998-01-01
In order to treat the mixed radioactive and hazardous waste stored in 177 underground tanks, the Tank Waste Remediation System (TWRS) program is developing a 'demonstration' site for treatment and immobilization of these wastes by a private contractor. Project W-519 is providing the infrastructure support to this site by developing the designs and emplacing required pipelines, roads, electrical, etc. In support of the TWRS Phase 1 Infrastructure Project (W-519) Characterization, Numatec Hanford Corporation (NHC) contracted with Waste Management Federal Services, Inc., Northwest Operations (WMNW) to investigate a number of locations in and just outside the 200 East Area eastern fenceline boundary. These areas consisted of known or suspected waste lines or waste sites that could potentially impact the construction and emplacement of the proposed facility improvements, including waterlines and roads. These sites were all located subsurface and sugaring would be required to obtain sample material from the desired depth. The soils would then be sampled and submitted to the laboratory for analysis of radioactivity
International Nuclear Information System (INIS)
Duncan, J.B.; Huber, H.J.
2011-01-01
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Energy Technology Data Exchange (ETDEWEB)
Xia, Liangzhi, E-mail: 15004110853@163.com; Liu, Qing
2016-12-15
Density Functional Theory (DFT) combines with grand canonical Monte Carlo (GCMC) simulations are performed to explore the effect of Li doping on the hydrogen storage capability of COF-320. The results show that the interaction energy between the H{sub 2} and the Li-doped COF-320 is about three times higher than that of pristine COF-320. GCMC simulations are employed to study the hydrogen uptake of Li-doped COF-320 at ambient temperature, further confirm that the lithium doping can improve the hydrogen uptake at ambient temperature. Our results demonstrate that Li-doped COFs have good potential in the field of hydrogen storage. - Graphical abstract: Fig. 1. The optimized cluster model used here to represent the COF-320 and possible adsorption sites (A, B, C) for adsorption of metals in the COF-320. The dangling bonds are terminated by H atoms. C, H, and N atoms are shown as gray, white, and blue colors, respectively. Fig. 2. The adsorption isotherm of H{sub 2} in the pristine and Li-doped COF-320 at 298 K. - Highlights: • The binding sites of single and two lithium atoms in COF-320 were studied. • The interaction energy between the H{sub 2} and the Li-doped COF-320 is about three times higher than that of pristine COF-320. • H{sub 2} uptakes on the Li-doped COFs obtain significant improvement at ambient temperature. • Lithium-doping is a successful strategy for improving hydrogen uptake.
International Nuclear Information System (INIS)
Xia, Liangzhi; Liu, Qing
2016-01-01
Density Functional Theory (DFT) combines with grand canonical Monte Carlo (GCMC) simulations are performed to explore the effect of Li doping on the hydrogen storage capability of COF-320. The results show that the interaction energy between the H 2 and the Li-doped COF-320 is about three times higher than that of pristine COF-320. GCMC simulations are employed to study the hydrogen uptake of Li-doped COF-320 at ambient temperature, further confirm that the lithium doping can improve the hydrogen uptake at ambient temperature. Our results demonstrate that Li-doped COFs have good potential in the field of hydrogen storage. - Graphical abstract: Fig. 1. The optimized cluster model used here to represent the COF-320 and possible adsorption sites (A, B, C) for adsorption of metals in the COF-320. The dangling bonds are terminated by H atoms. C, H, and N atoms are shown as gray, white, and blue colors, respectively. Fig. 2. The adsorption isotherm of H 2 in the pristine and Li-doped COF-320 at 298 K. - Highlights: • The binding sites of single and two lithium atoms in COF-320 were studied. • The interaction energy between the H 2 and the Li-doped COF-320 is about three times higher than that of pristine COF-320. • H 2 uptakes on the Li-doped COFs obtain significant improvement at ambient temperature. • Lithium-doping is a successful strategy for improving hydrogen uptake.
Evaluation of neutron data for americium-241
Energy Technology Data Exchange (ETDEWEB)
Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)
1997-03-01
The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.
W3C Geolocation API ur ett utvecklarperspektiv
Jönsson, Jesper
2012-01-01
The goal of this thesis is to investigate the W3C Geolocation API from a developer’s perspective, focused on whether it makes development of location-based applications more accessible to developers. This has been investigated by looking at available ways to locate, possible uses, the functionality offered, the necessary level of prior knowledge needed for a developer and requirements on developer tools. This has been achieved through studies in relevant areas, a thorough introduction to W3C ...
Operational test report for the 241-A-701 air compressor upgrade
Energy Technology Data Exchange (ETDEWEB)
Meeuwsen, W.E.
1997-06-30
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.
International Nuclear Information System (INIS)
Evans, J.C.; Pool, K.H.; Thomas, B.L.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of waste storage tank 241-C-107 (Tank C-107) at the Hanford Site in Washington State. The results described in this report is the second in a series comparing vapor sampling of the tank headspace using the Vapor Sampling System (VSS) and In Situ Vapor Sampling (ISVS) system without high efficiency particulate air (HEPA) prefiltration. The results include air concentrations of water (H 2 O) and ammonia (NH 3 ), permanent gases, total non-methane organic compounds (TO-12), and individual organic analytes collected in SUMMA trademark canisters and on triple sorbent traps (TSTs). Samples were collected by Westinghouse Hanford Company (WHC) and analyzed by Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volume measurements provided by WHC
Kruger, Larisa C.; O'Malley, Heather A.; Hull, Jacob M.; Kleeman, Amanda; Patino, Gustavo A.
2016-01-01
Voltage-gated sodium channel (VGSC) β subunits signal through multiple pathways on multiple time scales. In addition to modulating sodium and potassium currents, β subunits play nonconducting roles as cell adhesion molecules, which allow them to function in cell–cell communication, neuronal migration, neurite outgrowth, neuronal pathfinding, and axonal fasciculation. Mutations in SCN1B, encoding VGSC β1 and β1B, are associated with epilepsy. Autosomal-dominant SCN1B-C121W, the first epilepsy-associated VGSC mutation identified, results in genetic epilepsy with febrile seizures plus (GEFS+). This mutation has been shown to disrupt both the sodium-current-modulatory and cell-adhesive functions of β1 subunits expressed in heterologous systems. The goal of this study was to compare mice heterozygous for Scn1b-C121W (Scn1b+/W) with mice heterozygous for the Scn1b-null allele (Scn1b+/−) to determine whether the C121W mutation results in loss-of-function in vivo. We found that Scn1b+/W mice were more susceptible than Scn1b+/− and Scn1b+/+ mice to hyperthermia-induced convulsions, a model of pediatric febrile seizures. β1-C121W subunits are expressed at the neuronal cell surface in vivo. However, despite this, β1-C121W polypeptides are incompletely glycosylated and do not associate with VGSC α subunits in the brain. β1-C121W subcellular localization is restricted to neuronal cell bodies and is not detected at axon initial segments in the cortex or cerebellum or at optic nerve nodes of Ranvier of Scn1bW/W mice. These data, together with our previous results showing that β1-C121W cannot participate in trans-homophilic cell adhesion, lead to the hypothesis that SCN1B-C121W confers a deleterious gain-of-function in human GEFS+ patients. SIGNIFICANCE STATEMENT The mechanisms underlying genetic epilepsy syndromes are poorly understood. Closing this gap in knowledge is essential to the development of new medicines to treat epilepsy. We have used mouse models to
24 CFR 888.320 - One-time Contract Rent determination.
2010-04-01
... PROGRAM, SECTION 202 SUPPORTIVE HOUSING FOR THE ELDERLY PROGRAM AND SECTION 811 SUPPORTIVE HOUSING FOR PERSONS WITH DISABILITIES PROGRAM) SECTION 8 HOUSING ASSISTANCE PAYMENTS PROGRAM-FAIR MARKET RENTS AND... Elderly or Handicapped, and Special Allocations Projects § 888.320 One-time Contract Rent determination...
5 CFR 9701.106 - Relationship to other provisions.
2010-01-01
....106 Section 9701.106 Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES... SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM General Provisions § 9701.106 Relationship to other provisions....S.C. 5545(d); (iv) Recruitment, relocation, and retention payments under 5 U.S.C. 5753-5754; (v...
Operational test report for the 241-A-701 air compressor upgrade
International Nuclear Information System (INIS)
Meeuwsen, W.E.
1997-01-01
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis
27 CFR 21.106 - Diethyl phthalate.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Diethyl phthalate. 21.106....106 Diethyl phthalate. (a) Refractive index at 25 °C. 1.497 to 1.502. (b) Color. Colorless. (c) Odor... °/25 °C. 1.115 to 1.118. (f) Ester content (as diethyl phthalate). Not less than 99 percent by weight...
Uchoa, D C; Silva, T F P; Mota Filho, A C; Silva, L D M
2012-12-01
The aim of this study was to evaluate powdered coconut water extender (ACP-106c; ACP Serviços Tecnológicos Ltda, ACP Biotecnologia, Fortaleza, Ceará, Brazil) as a diluent for freezing dog semen and the fertility after vaginal insemination of semen frozen therein. Ten ejaculates were collected from five dogs, evaluated fresh, diluted in ACP-106c, 10% egg yolk and 6% glycerol, cooled and frozen. In the first phase of the study, straws with frozen semen were thawed and immediately subjected to the same analysis as the fresh semen and, in addition, to Computer-Assisted Semen Analysis (CASA). In phase 2, 10 bitches that had been subjected to natural breeding during a preceding oestrous cycle were vaginally inseminated with thawed semen that had been re-diluted in ACP-106c. After thawing, a mean of 77% sperm motility was obtained through subjective analysis and 77.3% through CASA. Following artificial insemination, a 60% pregnancy rate was observed, resulting in a 50% parturition rate and a mean litter size of 3.4 (SEM 0.6), with 47.1% males and 52.9% females. ACP-106c can be successfully used for freezing canine semen, and vaginal deposition of such semen yields similar pregnancy rates to those reported in other studies. © 2012 Blackwell Verlag GmbH.
Recovery of 241Am/Be neutron sources, Wooster, Ohio
International Nuclear Information System (INIS)
Tompkins, J.A.; Wannigman, D.; Hatler, V.
1998-07-01
In August 1997, the Nuclear Regulatory Commission (NRC) submitted to the US Department of Energy (DOE) a partial list of licensed radioactive sealed sources to be recovered under a pilot project initiating Radioactive Source Recovery Program (RSRP) operations. The first of the pilot project recoveries was scheduled for September 1997 at Eastern Well Surveys in Wooster, Ohio, a company with five unwanted sealed sources on the NRC list. The sources were neutron emitters, each containing 241 Am/Be with activities ranging from 2.49 to 3.0 Ci. A prior radiological survey had established that one of these sources, a Gulf Nuclear Model 71-1 containing 3 Ci of 241 Am, was contaminated with 241 Am and might be leaking. The other four sources were obsolete and could no longer be used by Eastern Well Surveys for their intended application in well-logging applications due to NRC decertification of these sources. All of the sources exceeded the limits established for Class C waste under 10 CFR 61.55 and, as a result, are the ultimate responsibility of the DOE under the provisions of PL 99-240. This report describes the cooperative effort between the DOE and NRC to recover the sources and transport them to Los Alamos National Laboratory (LANL) for deactivation under the RSRP. This operation alleviated any potential risk to the public health and safety from the site which might result from the leaking neutron sources or the potential mismanagement of unwanted sources. The on-site recovery occurred on September 23, 1997, and was performed by personnel from LANL and its contractor and was observed by staff from the Region III office of the NRC. All aspects of the recovery were successfully accomplished, and the sources were received at LANL on September 29, 1997. Experience gained during this operation will be used to formulate operational poilicies and procedures which will contribute to the eventual routine recovery operations of a full-scale RSRP
International Nuclear Information System (INIS)
Ocampo, V.P.; Boothe, G.F.; Greager, T.M.; Johnson, K.D.; Kooiker, S.L.; Martin, J.D.
1994-11-01
This document provides additional and supplemental information to WHC-SD-W112-FDC-001, Project W-112 for radioactive and mixed waste storage. It provides additional requirements for the design and summarizes Westinghouse Hanford Company key design guidance and establishes the technical baseline agreements to be used for definitive design of the Project W-112 facilities
30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...
Mixer pump long term operations plan for Tank 241-SY-101 mitigation
International Nuclear Information System (INIS)
Irwin, J.J.
1994-01-01
This document provides the general Operations Plan for performance of the mixer pump long term operations for Tank 241-SY-101 mitigation of gas retention and periodic release in Tank 101-SY. This operations plan will utilize a 112 kW (150 hp) mixing pump to agitate/suspend the particulates in the tank
Project W-420 Stack Monitoring system upgrades conceptual design report
International Nuclear Information System (INIS)
TUCK, J.A.
1998-01-01
This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks
Project W-420 Stack Monitoring system upgrades conceptual design report
Energy Technology Data Exchange (ETDEWEB)
TUCK, J.A.
1998-11-06
This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks.
Potentiostatic electro-deposition of 241Am using room temperature ionic liquids
International Nuclear Information System (INIS)
Sankhe, R.H.; Mirashi, N.N.; Arijit Sengupta; Murali, M.S.
2015-01-01
An attempt was made for the potentiostatic electrodeposition of 241 Am using six different room temperature ionic liquids (RTILs). Effect of electrodeposition time on the % of electrodeposition of 241 Am, pH change of the solution and the temperature change of the systems were investigated. It was observed that for water immiscible RTILs, the least viscous RTIL gave the best yield (when mixed with iso-propanol), while for water miscible RTILs, reverse trend was observed (when mixed with water). Out of all water immiscible RTILs under consideration for the present case, the octyl-methyl-pyrrolidinium bis(trifluoromethylsulfonyl)imide (C 8 mpyNTf 2 ) in isopropanol was found to yield almost quantitative (99.6 %) electrodeposition of 241 Am within 45 min whereas the most effective system was found to be C 8 mimBr with ∼90 % of 241 Am deposited on the electrode for water miscible RTILs. To the best of our knowledge, this is the first approach ever been reported in the literature. (author)
International Nuclear Information System (INIS)
Mendoza, D.P.
1995-01-01
This BCR compares the Project W-058 Functional Design Criteria with the Project W-058 Preliminary Design Requirements Document, and identifies the differences between the two documents in the mission definition, project requirements, system functions, and interfaces. Impacts these differences have on current project design are also discussed
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default. 320.31 Section 320.31 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) GOVERNMENT... SECURITIES Bond-Type Securities § 320.31 Default. Upon default of the issuer, the Association has the right...
Hydrotreatment of heavy oil from coal liquefaction on Sulfide Ni - W Catalysts
International Nuclear Information System (INIS)
Zhi-ping Lei; Li-juan Gao; Heng-fu Shui; Shi-biao, Ren; Zhi-cai Wang; Kang-shi Gang
2011-01-01
Heavy oil (distillation temperature: 320-340 deg C) derived from the direct coal liquefaction process using Shengli coal were hydrotreated using sulfided Ni-Mo/Al 2 O 3 , Ni-W/Al 2 O 3 , and Ni-W/SiO 2 catalysts respectively. The sulfided catalysts were characterized by BET, XRD, H 2 -TPR and NH 3 -TPD respectively. The evaluations of the hydrodenitrogenation (HDN) and hydrodearomatization (HDA) properties of heavy oil on the three catalysts were carried out at 400 deg C and 5.0 MPa initial H2 pressure. The W-based catalysts displayed better performances than Mo-based catalysts for the HDN and HDA reactions. Al 2 O 3 supported catalysts were found to have higher catalytic activities than on SiO 2 supported ones. The activities of sulfided catalysts were associated mainly with the nature of active sites, acidity, metal sulfide crystallite size and the amount of the reducible sulfur species of metal sulfide. (author)
CSER 94-09: Implications of the heat anomaly in Tank 106-C to criticality safety
Energy Technology Data Exchange (ETDEWEB)
Rogers, C.A.
1994-10-01
Water is periodically added to Tank C-106 to cool its waste. In March 1994 addition of water was temporarily discontinued to determine if the tank could be adequately cooled at a lower water level. Following an addition of water, a temperature fluctuation was observed on one of the thermocouple trees. This Criticality Safety Evaluation Report (CSER) explains why the anomalous temperature measurements could not have been caused by nuclear criticality. Waste in Tank C-106 was discharged from processing facilities under controls designed to ensure that the contents of the tank would remain well subcritical under all credible conditions. The observed temperature profile does not fit the profile expected from a criticality event. In addition, there has been no indication of any significant increase in the rate of water evaporation.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Settlement. 14.320 Section 14.320... Applications § 14.320 Settlement. The applicant and agency counsel may agree on a proposed settlement of the award before final action on the application, either in connection with a settlement of the underlying...
International Nuclear Information System (INIS)
Bilal, A.; Kogan, I.I.
1991-01-01
We show that the complex and projective structures on 2D Riemann surfaces are determined by the solutions to the linear differential equations obtained by the hamiltonian reduction of Sl(2,C) connections by the gauge parabolic subgroup. The compatibility of complex (μ) and projective (T) structures appears as the associated zero-curvature condition on the reduced symplectic manifold and is nothing but the conformal Ward identity. Generalizing this construction to the reduction of Sl(n,C) connections by the maximal parabolic gauge subgroup, we obtain generalized complex (μ,ρ,...) and projective (T,W,...) structures. From their compatibility conditions we explicitly obtain the Ward identities of W n -gravity and the operator product expansions of the W n -algebras. The associated linear differential equations (one of which involves the basic differential operator of the nth reduction of the KP hierarchy) allow for a geometric interpretation of the W-symmetries in terms of deformations of flag configurations in the jet bundle Γ (n-1) . We also show how to derive the W n -Ward identities from the quantization of the (2+1)-dimensional Chern-Simons theory. (orig.)
29 CFR 99.320 - Report submission.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Report submission. 99.320 Section 99.320 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditees § 99.320... package pursuant to § 99.320(d)(2). (vii) A yes or no statement as to whether the auditee qualified as a...
Energy Technology Data Exchange (ETDEWEB)
Hansen, E
2005-03-31
The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default. 320.15 Section 320.15... SECURITIES Pass-Through Type Securities § 320.15 Default. (a) Issuer default. Any failure or inability of the... default of the issuer. (b) Action upon default. Upon any default by the issuer, the Association may: (1...
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Default. 2.320 Section 2.320 Energy NUCLEAR REGULATORY COMMISSION RULES OF PRACTICE FOR DOMESTIC LICENSING PROCEEDINGS AND ISSUANCE OF ORDERS Rules of General... § 2.320 Default. If a party fails to file an answer or pleading within the time prescribed in this...
Crawler Acquisition and Testing Demonstration Project Management Plan
International Nuclear Information System (INIS)
DEFIGH-PRICE, C.
2000-01-01
If the crawler based retrieval system is selected, this project management plan identifies the path forward for acquiring a crawler/track pump waste retrieval system, and completing sufficient testing to support deploying the crawler for as part of a retrieval technology demonstration for Tank 241-C-104. In the balance of the document, these activities will be referred to as the Crawler Acquisition and Testing Demonstration. During recent Tri-Party Agreement negotiations, TPA milestones were proposed for a sludge/hard heel waste retrieval demonstration in tank C-104. Specifically one of the proposed milestones requires completion of a cold demonstration of sufficient scale to support final design and testing of the equipment (M-45-03G) by 6/30/2004. A crawler-based retrieval system was one of the two options evaluated during the pre-conceptual engineering for C-104 retrieval (RPP-6843 Rev. 0). The alternative technology procurement initiated by the Hanford Tanks Initiative (HTI) project, combined with the pre-conceptual engineering for C-104 retrieval provide an opportunity to achieve compliance with the proposed TPA milestone M-45-03H. This Crawler Acquisition and Testing Demonstration project management plan identifies the plans, organizational interfaces and responsibilities, management control systems, reporting systems, timeline and requirements for the acquisition and testing of the crawler based retrieval system. This project management plan is complimentary to and supportive of the Project Management Plan for Retrieval of C-104 (RPP-6557). This project management plan focuses on utilizing and completing the efforts initiated under the Hanford Tanks Initiative (HTI) to acquire and cold test a commercial crawler based retrieval system. The crawler-based retrieval system will be purchased on a schedule to support design of the waste retrieval from tank C-104 (project W-523) and to meet the requirement of proposed TPA milestone M-45-03H. This Crawler
Directory of Open Access Journals (Sweden)
Majid Reza Sheikh Rezaee
2015-01-01
Full Text Available Background: Aldose reductase (AR is the rate-limiting enzyme in the glucose metabolism, which has been implicated in the pathogenesis of diabetic microvascular complications (MVCs. Frequent C-106T polymorphism in the promoter of the AR gene may change the expression of the gene. Aims: The aim of the following study is to study the association between AR C106T genotypes and diabetic MVCs in Iranian population. Materials and Methods: We included 206 type 2 diabetic patients categorized into two groups according to the presence or absence of diabetic microangiopathy. The cases of interest were diabetic neuropathy, retinopathy and nephropathy identified during clinical and or laboratory examination. In addition, 114 age- and sex-matched individuals were selected to serve as a control group. AR genotyping was done using an amplification gel electrophoresis. Results: The frequency of CC genotype was specifically higher in subjects with diabetic retinopathy as compared to those without it (53.2% vs. 38.1%, P = 0.030. Patients with diabetic microangiopathy in general; however, did not differ significantly between AR genotype groups. Conclusion: The C-106T polymorphism in the AR gene is likely a risk factor for development of only retinal complication of diabetes microvascular in Iranian individuals.
Measurement and analysis of the 241Am(n,γ) cross section at the CERN nTOF facility
International Nuclear Information System (INIS)
Fraval, Kevin
2013-01-01
In the context of the current nuclear technology, the radiotoxicity of the spent fuel of a typical PWR reactor is dominated by minor actinides for times greater than 10 4 years. In particular, 241 Am and its 432 years half-life is responsible for about half of the minor actinide content of a PWR spent fuel. This thesis work consisted in measuring and analysing the 241 Am(n,γ) cross section at the CERN n T OF facility. After selecting exclusively the events obtained with lead shielding in front of the C 6 D 6 detectors, the amplitude-energy calibration has to be adjusted with time, by using a photon coming from the 27 Al(α,p) 30 Si * reaction. Histogram extraction included applying a weighting function (obtained by MCNP simulation), a dead time correction, and a normalization to the compound nucleus excitation energy. The background corrected spectra were normalized relatively to the 4.9 eV resonance on 197 Au. Finally, the resonance analysis was performed using the SAMMY code. The extracted thermal value is 678±68 barns, the uncertainty being mostly due to the large background level. The resolved range was extended from 150 eV to 320 eV, with a total of 192 resonances that had to be added of heavily modified. The unresolved region was analysed up to 150 keV, yielding a larger average cross section than previously evaluated below 20 keV. (author) [fr
International Nuclear Information System (INIS)
HILL, J.S.
2000-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product
International Nuclear Information System (INIS)
1985-11-01
This US Nuclear Regulatory Commission report documents the circumstances surrounding the March 26, 1985, confiscation and subsequent decontamination activities related to the use of unauthorized quantities of americium-241 at the John C. Haynes Company (licensee) of Newark, Ohio. It focuses on the period from early February to July 26, 1985. The incident started when NRC Region III recieved information that John C. Haynes possessed unauthorized quantities of americium-241 and was conducting unauthorized activities (diamond irradiation). By July 26, 1985, the decontamination activities at the licensee's laboratory were concluded. The licensee's actions with diamond irradiation resulted in contamination in restricted and unrestricted areas of the facility. The confiscation and decontamination activities required the combined efforts of NRC, Federal Bureau of Investigation, US Department of Energy, Oak Ridge Associated Universities, the State of Ohio, and the US Environmental Protection Agency. The report describes the factual information and significant findings associated with the confiscation and decontamination activities
Directory of Open Access Journals (Sweden)
N. Potalangi
2007-12-01
Full Text Available The objective of this research was to study the effect of LHRHa gonad maturity in broodstock of P. hypophthalmus through W/O/W LG (C-14 emulsion injection. The treatments consisted of control (A, 50 µg/kg fish wight (B, and 100 µg/kg fish weight (C, with five replications of each. Fish weight at the beginning of experiment was 2.0 kg/individual. The result showed that LHRHa in W/O/W emulsion had positive effect on egg maturation. This was shown by the value of average of eggs diameter. The maximum size of egg diameter for fish 701.52 ± 17.56 µm. The size of eggs was more homogenous in group B than those of group C and A. it was concluded that injection of LHRHa in W/O/W LG (C-14 emulsion if effective in promoting gonad maturation and oocyte development in the catfish
Treatment of selected primary gynecologic and pelvic malignancies with 241Americium
International Nuclear Information System (INIS)
Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn
1995-01-01
Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were
Gupta, Balram; Singh, S K
2017-07-01
Polymorphism in aldose reductase (ALR) gene at nucleotide C(-106)T (rs759853) in the promoter region is associated with susceptibility to development of diabetic peripheral neuropathy. The aim of this study was to detect the association of the C (-106)T polymorphism of ALR gene and its frequency among patients with type 2 diabetes mellitus with and without peripheral neuropathy. The study subjects were divided into three groups. Group I included 356 patients with diabetes having peripheral neuropathy. Group II included 294 patients with diabetes without peripheral neuropathy and group III included 181 healthy subjects. Genotyping of ALR C(-106)T SNPs was performed using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and direct sequencing methods. The genetic risk among the groups was compared and tested by calculating odds ratio with 95% class interval. ALR 106TT genotype was significantly higher in group I compared to group II with an odds ratio of 2.12 (95% CI: 1.22-3.67; pneuropathy with relative risk of 1.97 (95% CI: 1.16-3.35; pperipheral neuropathy in patients with type 2 diabetes mellitus. Copyright © 2017 Elsevier Inc. All rights reserved.
Mookerjea, B.; Giesen, T.; Stutzki, J.; Cernicharo, J.; Goicoechea, J. R.; De Luca, M.; Bell, T. A.; Gupta, H.; Gerin, M.; Persson, C. M.; Sonnentrucker, P.; Makai, Z.; Black, J.; Boulanger, F.; Coutens, A.; Dartois, E.; Encrenaz, P.; Falgarone, E.; Geballe, T.; Godard, B.; Goldsmith, P. F.; Gry, C.; Hennebelle, P.; Herbst, E.; Hily-Blant, P.; Joblin, C.; Kazmierczak, M.; Kolos, R.; Krelowski, J.; Lis, D. C.; Martin-Pintado, J.; Menten, K. M.; Monje, R.; Pearson, J. C.; Perault, M.; Phillips, T. G.; Plume, R.; Salez, M.; Schlemmer, S.; Schmidt, M.; Teyssier, D.; Vastel, C.; Yu, S.; Dieleman, P.; Guesten, R.; Honingh, C. E.; Morris, P.; Roelfsema, P.; Schieder, R.; Tielens, A. G. G. M.; Zmuidzinas, J.
2010-01-01
We present spectrally resolved observations of triatomic carbon (C-3) in several ro-vibrational transitions between the vibrational ground state and the low-energy nu(2) bending mode at frequencies between 1654-1897 GHz along the sight-lines to the submillimeter continuum sources W31C and W49N,
International Nuclear Information System (INIS)
Clauss, T.R.; Lucke, R.B.; McVeety, B.; Allwine, K.J.; Fruchter, J.S.
1994-09-01
The purpose of Sample Jobs 4 and 5 was to determine whether the organic nitrites observed on the outside of tank 241-C-103 originated in the tank or from degradation products of the high-efficiency particulate air (HEPA) filter. The plan was to take samples from either side of the HE-PA filter. The relative level of organic nitrites would help determine whether they were produced in the filter or the tank. Pacific Northwest Laboratory was responsible for analyzing the SUMMA trademark canisters collected in support of this study. The laboratory was to analyze the SUMMA trademark Canister samples according to letters of instruction and report all semivolatile and volatile organic constituents detected in the tank headspace. Pacific Northwest Laboratory was also to submit a letter report to the Program Manager of all qualitative and quantitative analytical data, and estimate concentrations of any aliphatic nitrites identified. This was one of the first sampling activities for this program, and a number of errors were made both in the field and in the laboratory. Because of these errors, the samples and results were of questionable value. Therefore, Westinghouse program management asked that the analysis of the samples for this report not be completed. This report describes the few results that were generated before we were asked to stop work on this activity. In addition to analyzing SUMMA trademark canisters, PNL operates a site portable weather station near tank 241-C-103. Pacific Northwest Laboratory was required to collect atmospheric data starting 11/15/93, but the weather station was already collecting data during the time of both these two sample jobs (11/12/93 and 11/16/93). Therefore, a summary of the atmospheric data is also presented in this report
SAFETY ANALYSIS APPROACH TO TANK 241-SY-101 REMEDIATION ACTIVITIES
International Nuclear Information System (INIS)
RYAN, G.W.
2000-01-01
An Unreviewed Safety Question was declared related to the unexplained waste surface level growth in high-level radioactive waste storage Tank 241-SY-101 at the Hanford Site in Richland, Washington. Because the waste surface level in Tank 241-SY-101 was growing in a manner inconsistent with previous behavior, the following issues of concern were recognized: (1) The continually rising surface level had the potential to reach physical encumbrances or limits within the tank (e.g., instrumentation, cameras, established Authorization Basis limits, and the double containment boundary) and the potential to significantly change the consequences of previously analyzed accidents (e.g., flammable gas deflagrations). (2) The presence of new hazards because of significant quantities of flammable gas retained in the crust (e.g., crust collapse gas-release events). (3) The potential to inhibit information gathering related to the existing hazards in the tank (e.g., unable to determine surface level to assess the potential for large gas releases). In response to this situation, a Contractor Project Team, which included Department of Energy representation, was formed to constructively address the issue. The team was responsible for developing and evaluating remediation options and executing the chosen option for remediating the surface level rise issue for Tank 241-SY-101. From an Authorization Basis perspective, the following important aspects will be discussed in this paper: (1) The integrated nature of the Project Team. The team consisted of all the organizations necessary to ensure that the time available to remediate Tank 241-SY-101 was effectively used. Most notable is the connectivity of the Nuclear Safety and Licensing organization with the Engineering, Design, and Operations organizations. (2) The ability of the safety analysis support to adjust to and address evolving Project Team goals and dynamic tank conditions. (3) Due to the urgency to mitigate this developing issue
Results of Characterization and Retrieval Testing on Tank 241-C-110 Heel Solids
Energy Technology Data Exchange (ETDEWEB)
Callaway, William S.
2013-09-30
Nine samples of heel solids from tank 241-C-110 were delivered to the 222-S Laboratory for characterization and dissolution testing. After being drained thoroughly, the sample solids were primarily white to light-brown with minor dark-colored inclusions. The maximum dimension of the majority of the solids was <2 mm; however, numerous pieces of aggregate, microcrystalline, and crystalline solids with maximum dimensions ranging from 5-70 mm were observed. In general, the larger pieces of aggregate solids were strongly cemented. Natrophosphate [Na{sub 7}F(PO{sub 4}){sub 2}°19H{sub 2}O] was the dominant solid phase identified in the heel solids. Results of chemical analyses suggested that 85-87 wt% of the heel solids were the fluoridephosphate double salt. The average bulk density measured for the heel solids was 1.689 g/mL; the reference density of natrophosphate is 1.71 g/mL. Dissolution tests on composite samples indicate that 94 to 97 wt% of the tank 241-C-110 heel solids can be retrieved by dissolution in water. Dissolution and recovery of the soluble components in 1 kg (0.59 L) of the heel solids required the addition of ≈9.5 kg (9.5 L) of water at 15 °C and ≈4.4 kg (4.45 L) of water at 45 °C. Calculations performed using the Environmental Simulation Program indicate that dissolution of the ≈0.86 kg of natrophosphate in each kilogram of the tank 241-C-110 heel solids would require ≈9.45 kg of water at 15 °C and ≈4.25 kg of water at 45 °C. The slightly larger quantities of water determined to be required to retrieve the soluble components in 1 kg of the heel solids are consistent with that required for the dissolution of solids composed mainly of natrophosphate with a major portion of the balance consisting of highly soluble sodium salts. At least 98% of the structural water, soluble phosphate, sodium, fluoride, nitrate, carbonate, nitrite, sulfate, oxalate, and chloride in the test composites was dissolved and recovered in the
International Nuclear Information System (INIS)
Clauss, T.R.; Edwards, J.A.; Fruchter, J.S.
1994-09-01
On 5/18/94, Westinghouse Hanford Company (WHC) delivered samples to Pacific Northwest Laboratory (PNL) that were collected from waste Tank 241-C-103 on 5/16/94. These samples were from Sample Job (SJ) 7b, Part 1. On 5/24/94, WHC delivered samples to PNL that were collected from waste Tank 241-C-103 on 5/18/94. These samples were from SJ7b, Part 2. A summary of data derived from the sampling of waste Tank 241-C-103 for gravimetric (H 2 O) and normal paraffin hydrocarbon (NPH) concentrations are shown for SJ7b. Gravimetric analysis was performed on the samples within 24 hours of receipt by PNL. The NPH concentration of 10 samples collected for Part 1 was slightly higher than the average concentration for 15 samples collected in Part 2, 812 (± 133) mg/m 3 and 659 (± 88) mg/m 3 , respectively. The higher concentrations measured in Part 1 samples may be because the samples in Part 1 were collected at a single level, 0.79 meters above the air-liquid interface. Part 2 samples were collected at three different tank levels, 0.79, 2.92, and 5.05 m above the air-liquid interface. In Part 2, the average NPH concentrations for 5 samples collected at each of three levels was similar: 697 (60) mg/m 3 at the low level, 631 (51) mg/m 3 at the mid level, and 651 (134) mg/m 3 at the high level. It is important to note that the measured tridecane to dodecane concentration remained constant in all samples collected in Parts 1 and 2. That ratio is 1.2 ± 0.05. This consistent ratio indicates that there were no random analytical biases towards either compound
Project W-049H collection system Acceptance Test Procedure
International Nuclear Information System (INIS)
Carrigan, M.C.
1994-01-01
The purpose of this Acceptance Test Procedure (ATP) for the Project W-049H, Treated Effluent Disposal Facility, is to verify that the collection system equipment installed as Pump Station No. 1 (225-W) and Pump Station No. 2 (225-E) have been installed in accordance with the design documents and function as required by the project criteria. This will be a wet test with potable water being introduced into the pump pits to test for leakage. Potable water will also be employed in the testing of the pumps and related mechanical equipment. All Instrument and Control equipment related to the pump stations will be checked electronically with simulated inputs/outputs when actual input/output signals are unavailable. Water from Pump Station 1 will be moved through the TEDF piping system and discharged into the disposal ponds. This will check the proper function of the air/vac valves not tested during construction, and the automated samplers
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
Engineering task plan for the vapor monitor installation into 241-C-103 tank
International Nuclear Information System (INIS)
Hertelendy, N.A.
1994-12-01
A vapor flow monitor is to be installed into the 241-C-103 tank's exhaust, just downstream of the HEPA filter. The flow monitor system includes the flow sensor, the baffle assembly, the signal conditioning and control electronics, and a chart recorder. The electronics package and the chart recorder are installed into a small, heated instrument cabinet that is mounted on the same steel pallet on which the flowmeter and the diffuser assembly is mounted. The flowmeter is connected to the HEPA filter with an unheated, un-insulated flex hose. An automatic drain, upstream of the flowmeter, is designed to automatically drain the condensate into an evaporating pan. The flowmeter is heated with a temperature controlled heater to avoid condensation
Directory of Open Access Journals (Sweden)
Nermine Hossam Zakaria
2014-04-01
Full Text Available The aldose reductase pathway proves that elevated blood glucose promotes cellular dysfunction. The polyol pathway converts excess intracellular glucose into alcohols via activity of the aldose reductase. This enzyme catalyzes the conversion of glucose to sorbitol which triggers variety of intracellular changes in the tissues. Among diabetes, activity is drastically increased in association with three main consequences inside the cells. The aim of this study was to detect the association of the C-106 T polymorphism of the aldose reductase gene and its frequency among a sample of 150 Egyptian adults with type 2 diabetic patients having diabetic microvascular. The detection of the aldose reductase C-106 T polymorphism gene was done by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP. The genotype distribution of the C-106 T polymorphism showed that CC genotype was statistically significantly higher among patients with retinopathy compared to nephropathy. Patients with nephropathy had significant association with the TT genotype when compared with diabetic retinopathy patients. Follow up study after the genotype detection among recently diagnosed diabetic patients in order to give a prophylactic aldose reductase inhibitors; studying the microvascular complications and its relation to the genotype polymorphisms. The study may include multiple gene polymorphisms to make the relation between the gene and the occurrence of these complications more evident.
International Nuclear Information System (INIS)
MAUSER, R.W.
2001-01-01
This Engineering Test report outlines the results obtained from testing polyurea on its decon factor, tank waste compatibility, and adhesion strength when subjected to a high level of gamma radiation. This report is used in conjunction with RPP-7187 Project W-314 Pit Coatings Repair Requirements Analysis, to document the fact polyurea meets the project W-314 requirements contained in HNF-SD-W314-PDS-005 and is therefore an acceptable SPC for use in W-314 pit refurbishments
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...
International Nuclear Information System (INIS)
Brown, G.N.; Bontha, J.R.; Carlson, C.D.
1995-09-01
Pacific Northwest Laboratory (PNL), in conjunction with the Process Chemistry and Statistics Section of Westinghouse Hanford Company (WHC), conducted this study as part of the Supernatant Treatment Development Task for the Initial Pretreatment Module (IPM) Applied Engineering Project. The study assesses the performance of the CS-100 ion exchange material for removing cesium from simulated and actual alkaline supernate from Hanford tanks 241-SY-101 and 241-SY-103. The objective of these experiments is to compare the cesium ion exchange loading and elution profiles of actual and simulated wastes. Specific experimental objectives include (1) demonstration of decontamination factors (DF) for cesium removal, 92) verification of simulant performance, (3) investigation of waste/exchanger chemistry, and (4) determination of the radionuclide content of the regenerated CS-100 resin prior to disposal
International Nuclear Information System (INIS)
Goles, Ronald W.; Buchmiller, William C.; Hymas, Charles R.; MacIsaac, Brett D.
2002-01-01
In order to further the goal of optimizing Hanford?s HLW borosilicate flowsheet, a glass formulation effort was launched to develop an advanced high-capacity waste form exhibiting acceptable leach and crystal formation characteristics. A simulated C-106/AY-102 waste envelop inclusive of LAW pretreatment products was chosen as the subject of these nonradioactive optimization efforts. To evaluate this optimized borosilicate waste formulation under continuous dynamic vitrification conditions, a research-scale Joule-heated ceramic melter was used to demonstrate the advanced waste form?s flowsheet. The main objectives of this melter test was to evaluate (1) the processing characteristics of the newly formulated C-106/AY-102 surrogate melter-feed stream, (2) the effectiveness of sucrose as a glass-oxidation-state modifier, and (3) the impact of this reductant upon processing rates
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
Determination of 241Pu in nuclear waste slurries: a comparative study using LSC and ICP-MS.
Jäggi, M; Röllin, S; Alvarado, J A Corcho; Eikenberg, J
2012-02-01
(241)Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the (241)Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for (241)Pu, the methods were further validated using the (241)Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. Copyright © 2011 Elsevier Ltd. All rights reserved.
7 CFR 1205.320 - Marketing year.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing year. 1205.320 Section 1205.320 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Research and Promotion Order Definitions § 1205.320 Marketing year. Marketing year means a consecutive 12...
Recent Advances on Hydrogenic Retention in ITER's Plasma-Facing Materials: BE, C, W
International Nuclear Information System (INIS)
Skinner, C.H.; Haasz, A.A.; Alimov, V.Kh.; Bekris, N.; Causey, R.A.; Clark, R.E.H.; Coad, J.P.; Davis, J.W.; Doerner, R.P.; Mayer, M.; Pisarev, A.; Roth, J.; Tanabe, T.
2008-01-01
Management of tritium inventory remains one of the grand challenges in the development of fusion energy and the choice of plasma-facing materials is a key factor for in-vessel tritium retention. The Atomic and Molecular Data Unit of the International Atomic Energy Agency organized a Coordinated Research Project (CRP) on the overall topic of tritium inventory in fusion reactors during the period 2001-2006. This dealt with hydrogenic retention in ITER's plasma-facing materials, Be, C, W, and in compounds (mixed materials) of these elements as well as tritium removal techniques. The results of the CRP are summarized in this article together with recommendations for ITER. Basic parameters of diffusivity, solubility and trapping in Be, C and W are reviewed. For Be, the development of open porosity can account for transient hydrogenic pumping but long term retention will be dominated by codeposition. Codeposition is also the dominant retention mechanism for carbon and remains a serious concern for both Be and C containing layers. Hydrogenic trapping in unirradiated tungsten is low but will increase with ion and neutron damage. Mixed materials will be formed in a tokamak and these can also retain significant amounts of hydrogen isotopes. Oxidative and photon-based techniques for detritiation of plasma-facing components are described
Recent Advances on Hydrogenic Retention in ITER's Plasma-Facing Materials: BE, C, W.
Energy Technology Data Exchange (ETDEWEB)
Skinner, C H; Alimov, Kh; Bekris, N; Causey, R A; Clark, R.E.H.; Coad, J P; Davis, J W; Doerner, R P; Mayer, M; Pisarev, A; Roth, J
2008-03-29
Management of tritium inventory remains one of the grand challenges in the development of fusion energy and the choice of plasma-facing materials is a key factor for in-vessel tritium retention. The Atomic and Molecular Data Unit of the International Atomic Energy Agency organized a Coordinated Research Project (CRP) on the overall topic of tritium inventory in fusion reactors during the period 2001-2006. This dealt with hydrogenic retention in ITER's plasma-facing materials, Be, C, W, and in compounds (mixed materials) of these elements as well as tritium removal techniques. The results of the CRP are summarized in this article together with recommendations for ITER. Basic parameters of diffusivity, solubility and trapping in Be, C and W are reviewed. For Be, the development of open porosity can account for transient hydrogenic pumping but long term retention will be dominated by codeposition. Codeposition is also the dominant retention mechanism for carbon and remains a serious concern for both Be and C containing layers. Hydrogenic trapping in unirradiated tungsten is low but will increase with ion and neutron damage. Mixed materials will be formed in a tokamak and these can also retain significant amounts of hydrogen isotopes. Oxidative and photon-based techniques for detritiation of plasma-facing components are described.
Treatment of selected primary gynecologic and pelvic malignancies with {sup 241}Americium
Energy Technology Data Exchange (ETDEWEB)
Chung, Joyce Y; Peschel, Richard E; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E; Wilson, Lynn
1995-07-01
Purpose: To evaluate the efficacy of encapsulated {sup 241}Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated {sup 241}Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with {sup 241}Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of {sup 241}Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with {sup 241}Am. Median surface dose of {sup 241}Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S
Lattante, Serena; Le Ber, Isabelle; Galimberti, Daniela; Serpente, Maria; Rivaud-Péchoux, Sophie; Camuzat, Agnès; Clot, Fabienne; Fenoglio, Chiara; Scarpini, Elio; Brice, Alexis; Kabashi, Edor
2014-11-01
TMEM106B was identified as a risk factor for frontotemporal lobar degeneration (FTD) with TAR DNA-binding protein 43 kDa inclusions. It has been reported that variants in this gene are genetic modifiers of the disease and that this association is stronger in patients carrying a GRN mutation or a pathogenic expansion in chromosome 9 open reading frame 72 (C9orf72) gene. Here, we investigated the contribution of TMEM106B polymorphisms in cohorts of FTD and FTD with amyotrophic lateral sclerosis patients from France and Italy. Patients carrying the C9orf72 expansion (n = 145) and patients with GRN mutations (n = 76) were compared with a group of FTD patients (n = 384) negative for mutations and to a group of healthy controls (n = 552). In our cohorts, the presence of the C9orf72 expansion did not correlate with TMEM106B genotypes but the association was very strong in individuals with pathogenic GRN mutations (p = 9.54 × 10(-6)). Our data suggest that TMEM106B genotypes differ in FTD patient cohorts and strengthen the protective role of TMEM106B in GRN carriers. Further studies are needed to determine whether TMEM106B polymorphisms are associated with other genetic causes for FTD, including C9orf72 repeat expansions. Copyright © 2014 Elsevier Inc. All rights reserved.
GeV C.W. electron microtron design report
International Nuclear Information System (INIS)
1982-05-01
Rising interest in the nuclear physics community in a GeV C.W. electron accelerator reflects the growing importance of high-resolution short-range nuclear physics to future advances in the field. In this report major current problems are reviewed and the details of prospective measurements which could be made with a GeV C.W. electron facility are discussed, together with their impact on an understanding of nuclear forces and the structure of nuclear matter. The microtron accelerator has been chosen as the technology to generate the electron beams required for the research discussed because of the advantages of superior beam quality, low capital and operating cost and capability of furnishing beams of several energies and intensities simultaneously. A complete technical description of the conceptual design for a 2 GeV double-sided C.W. electron microtron is presented. The accelerator can furnish three beams with independently controlled energy and intensity. The maximum current per beam is 100 μamps. Although the precise objective for maximum beam energy is still a subject of debate, the design developed in this study provides the base technology for microtron accelerators at higher energies (2 to 6 GeV) using multi-sided geometries
GeV C. W. electron microtron design report
Energy Technology Data Exchange (ETDEWEB)
1982-05-01
Rising interest in the nuclear physics community in a GeV C.W. electron accelerator reflects the growing importance of high-resolution short-range nuclear physics to future advances in the field. In this report major current problems are reviewed and the details of prospective measurements which could be made with a GeV C.W. electron facility are discussed, together with their impact on an understanding of nuclear forces and the structure of nuclear matter. The microtron accelerator has been chosen as the technology to generate the electron beams required for the research discussed because of the advantages of superior beam quality, low capital and operating cost and capability of furnishing beams of several energies and intensities simultaneously. A complete technical description of the conceptual design for a 2 GeV double-sided C.W. electron microtron is presented. The accelerator can furnish three beams with independently controlled energy and intensity. The maximum current per beam is 100 ..mu..amps. Although the precise objective for maximum beam energy is still a subject of debate, the design developed in this study provides the base technology for microtron accelerators at higher energies (2 to 6 GeV) using multi-sided geometries.
Preliminary fire hazards analysis for W-211, Initial Tank Retrieval Systems
International Nuclear Information System (INIS)
Huckfeldt, R.A.
1995-01-01
A fire hazards analysis (FHA) was performed for Project W-211, Initial Tank Retrieval System (ITRS), at the Department of Energy (DOE) Hanford site. The objectives of this FHA was to determine (1) the fire hazards that expose the Initial Tank Retrieval System or are inherent in the process, (2) the adequacy of the fire-safety features planned, and (3) the degree of compliance of the project with specific fire safety provisions in DOE orders and related engineering codes and standards. The scope included the construction, the process hazards, building fire protection, and site wide fire protection. The results are presented in terms of the fire hazards present, the potential extent of fire damage, and the impact on employees and public safety. This study evaluated the ITRS with respect to its use at Tank 241-SY-101 only
Energy Technology Data Exchange (ETDEWEB)
Esch, R.A.
1998-03-12
This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ``A`` and ``B`` portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information.
International Nuclear Information System (INIS)
Esch, R.A.
1998-01-01
This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ''A'' and ''B'' portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Storm rails. 127.320 Section 127.320 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS CONSTRUCTION AND ARRANGEMENTS Rails and Guards § 127.320 Storm rails. Suitable storm rails must be installed in each passageway and at...
32 CFR 644.320 - Floodplain management.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Floodplain management. 644.320 Section 644.320... ESTATE HANDBOOK Disposal § 644.320 Floodplain management. The requirements of Executive Order 11988, Floodplain Management, 42 FR 26951, (24 May 1977) and its implementation will be outlined in subpart H (to be...
Preliminary Design Requirements Document for Project W-314
Energy Technology Data Exchange (ETDEWEB)
MCGREW, D.L.
2000-04-27
This document sets forth functional requirements, performance requirements, and design constraints for the tank farm systems elements identified in Section 3.1 of this document. These requirements shall be used to develop the Design Requirements Baseline for those system elements. System Overview--The tank farm system at Hanford Site currently consists of 149 single shell tanks and 28 double shell tanks with associated facilities and equipment, located in 18 separate groupings. Each grouping is known as a tank farm. They are located in the areas designated as 200 West and 200 East. Table 1-1 shows the number of tanks in each farm. The farms are connected together through a transfer system consisting of piping, diversion boxes, Double Contained Receiver Tanks (DCRT) and other miscellaneous facilities and elements. The tank farm system also connects to a series of processing plants which generate radioactive and hazardous wastes. The primary functions of the tank farm system are to store, transfer, concentrate, and characterize radioactive and hazardous waste generated at Hanford, until the waste can be safely retrieved, processed and dispositioned. The systems provided by Project W-314 support the store and transfer waste functions. The system elements to be upgraded by Project W-314 are identified in Section 3.1.
Preliminary Design Requirements Document for Project W-314
International Nuclear Information System (INIS)
MCGREW, D.L.
2000-01-01
This document sets forth functional requirements, performance requirements, and design constraints for the tank farm systems elements identified in Section 3.1 of this document. These requirements shall be used to develop the Design Requirements Baseline for those system elements. System Overview--The tank farm system at Hanford Site currently consists of 149 single shell tanks and 28 double shell tanks with associated facilities and equipment, located in 18 separate groupings. Each grouping is known as a tank farm. They are located in the areas designated as 200 West and 200 East. Table 1-1 shows the number of tanks in each farm. The farms are connected together through a transfer system consisting of piping, diversion boxes, Double Contained Receiver Tanks (DCRT) and other miscellaneous facilities and elements. The tank farm system also connects to a series of processing plants which generate radioactive and hazardous wastes. The primary functions of the tank farm system are to store, transfer, concentrate, and characterize radioactive and hazardous waste generated at Hanford, until the waste can be safely retrieved, processed and dispositioned. The systems provided by Project W-314 support the store and transfer waste functions. The system elements to be upgraded by Project W-314 are identified in Section 3.1
Hydrotreatment of heavy oil from coal liquefaction on Sulfide Ni - W Catalysts
Energy Technology Data Exchange (ETDEWEB)
Zhi-ping Lei; Li-juan Gao; Heng-fu Shui; Shi-biao, Ren; Zhi-cai Wang; Kang-shi Gang, E-mail: shhf@ahut.edu.c [Anhui University of Technology, Maanshan (China). School of Chemistry and Chemical Engineering. Anhui Key Lab. of Coal Clean Conversion and Utilization
2011-07-01
Heavy oil (distillation temperature: 320-340 deg C) derived from the direct coal liquefaction process using Shengli coal were hydrotreated using sulfided Ni-Mo/Al{sub 2}O{sub 3}, Ni-W/Al{sub 2}O{sub 3}, and Ni-W/SiO{sub 2} catalysts respectively. The sulfided catalysts were characterized by BET, XRD, H{sub 2}-TPR and NH{sub 3}-TPD respectively. The evaluations of the hydrodenitrogenation (HDN) and hydrodearomatization (HDA) properties of heavy oil on the three catalysts were carried out at 400 deg C and 5.0 MPa initial H2 pressure. The W-based catalysts displayed better performances than Mo-based catalysts for the HDN and HDA reactions. Al{sub 2}O{sub 3} supported catalysts were found to have higher catalytic activities than on SiO{sub 2} supported ones. The activities of sulfided catalysts were associated mainly with the nature of active sites, acidity, metal sulfide crystallite size and the amount of the reducible sulfur species of metal sulfide. (author)
Recommendation on changing interfaces of W-058 and W-236A
International Nuclear Information System (INIS)
Light, J.M.
1994-01-01
This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration
International Nuclear Information System (INIS)
Lee, Ki-Man; Kim, Eun-Hee
2015-01-01
The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV
Waste Retrieval Sluicing System Campaign Number 3 Solids Volume Transferred Calculation
International Nuclear Information System (INIS)
CAROTHERS, K.G.
1999-01-01
Waste Retrieval Sluicing System (WRSS) operations at tank 241-C-106 began on Wednesday, November 18, 1998. The purpose of this system is to retrieve and transfer the high-heat sludge from the tank for storage in double-shell tank 241-AY-102, thereby resolving the high-heat safety issue for the tank, and to demonstrate modernized past-practice retrieval technology for single-shell tank waste. Performance Agreement (PA) TWR 1.2.2, C-106 Sluicing, was established by the Department of Energy, Office of River Protection (ORP) for achieving completion of sluicing retrieval of waste from tank 241-C-106 by September 30, 1999. This level of sludge removal is defined in the PA as either removal of approximately 72 inches of sludge or removal of 172,000 gallons of sludge (approximately 62 inches) and less than 6,000 gallons (approximately 2 inches) of sludge removal per 12 hour sluice batch for three consecutive batches. Preliminary calculations of the volume of tank 241-C-106 sludge removed as of September 29, 1999 were provided to ORP documenting completion of PA TWR 1.2.2 (Allen 1999a). The purpose of this calculation is to document the final sludge volume removed from tank 241-C-106 up through September 30, 1999. Additionally, the results of an extra batch completed October 6, 1999 is included to show the total volume of sludge removed through the end of WRSS operations. The calculation of the sludge volume transferred from the tank is guided by engineering procedure HNF-SD-WM-PROC-021, Section 15.0,Rev. 3, sub-section 4.4, ''Calculation of Sludge Transferred.''
Waste Retrieval Sluicing System Campaign Number 3 Solids Volume Transferred Calculation
International Nuclear Information System (INIS)
CAROTHERS, K.G.
1999-01-01
Waste Retrieval Sluicing System (WRSS) operations at tank 241-C-106 began on Wednesday, November 18,1998. The purpose of this system is to retrieve and transfer the high-heat sludge from the tank for storage in double-shell tank 241-AY-102, thereby resolving the high-heat safety issue for the tank, and to demonstrate modernized past-practice retrieval technology for single-shell tank waste. Performance Agreement (PA) TWR 1.2.2, C-106 Sluicing, was established by the Department of Energy, Office of River Protection (ORP) for achieving completion of sluicing retrieval of waste from tank 241-C-106 by September 30,1999. This level of sludge removal is defined in the PA as either removal of approximately 72 inches of sludge or removal of 172,000 gallons of sludge (approximately 62 inches) and less than 6,000 gallons (approximately 2 inches) of sludge removal per 12 hour sluice batch for three consecutive batches. Preliminary calculations of the volume of tank 241-C-106 sludge removed as of September 29, 1999 were provided to ORP documenting completion of PA TWR 1.2.2 (Allen 1999a). The purpose of this calculation is to document the final sludge volume removed from tank 241-C-106 up through September 30, 1999. Additionally, the results of an extra batch completed October 6, 1999 is included to show the total volume of sludge removed through the end of WRSS operations. The calculation of the sludge volume transferred from the tank is guided by engineering procedure HNF-SD-WM-PROC-021, Section 15.0,Rev. 3, sub-section 4.4, ''Calculation of Sludge Transferred.''
Current status of ultra-fine grained W-TiC development for use in irradiation environments
Energy Technology Data Exchange (ETDEWEB)
Kurishita, H [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai-machi, Ibaraki-ken 311-1313 (Japan); Kobayashi, S [Department of Materials Science and Biotechnology, Ehime University, Matsuyama-shi 790-8577 (Japan); Nakai, K [Department of Materials Science and Biotechnology, Ehime University, Matsuyama-shi 790-8577 (Japan); Arakawa, H [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai-machi, Ibaraki-ken 311-1313 (Japan); Matsuo, S [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai-machi, Ibaraki-ken 311-1313 (Japan); Takida, T [ALMT. Corp., 2 Iwase-koshi-machi, Toyama 931-8371 (Japan); Takebe, K [ALMT. Corp., 2 Iwase-koshi-machi, Toyama 931-8371 (Japan); Kawai, M [Institute of Material Structure Science, High Energy Accelerator Research Organization (KEK), Tsukuba-shi, Ibaraki-ken 305-0801 (Japan)
2007-03-15
Ultra-fine grained (UFG) W-TiC with a high purity matrix of low dislocation density is expected to exhibit improve resistance to irradiation with neutrons and helium ions and the room temperature mechanical properties. Aiming at such UFG W-TiC with the desired microstructure, powders of W with 0.25-0.8 wt% TiC additions were subjected to mechanical alloying (MA) and hot isostatic pressing (HIP), where purified H{sub 2} and Ar were used as the MA atmosphere. Microstructural observations and room- and high-temperature mechanical tests were performed for UFG W-TiC before and after neutron irradiation to a fluence of 2x10{sup 24} n m{sup -2} at 873 K. It is shown that the MA atmosphere significantly affects grain refinement, room-temperature strength and high-temperature tensile plasticity of UFG W-TiC. W-0.5TiC with H{sub 2} in MA (W-0.5TiC-H{sub 2}) shows a larger strain rate sensitivity of flow stress, m, of 0.5{approx}0.6 at temperatures from 1673 to 1973 K, which is a feature of superplastic materials. Whereas W-0.5TiC-Ar shows a smaller m value of approximately 0.2. No radiation hardening is recognized in UFG W-0.5TiC-H{sub 2} and W-0.5TiC-Ar.
Current status of ultra-fine grained W-TiC development for use in irradiation environments
International Nuclear Information System (INIS)
Kurishita, H; Kobayashi, S; Nakai, K; Arakawa, H; Matsuo, S; Takida, T; Takebe, K; Kawai, M
2007-01-01
Ultra-fine grained (UFG) W-TiC with a high purity matrix of low dislocation density is expected to exhibit improve resistance to irradiation with neutrons and helium ions and the room temperature mechanical properties. Aiming at such UFG W-TiC with the desired microstructure, powders of W with 0.25-0.8 wt% TiC additions were subjected to mechanical alloying (MA) and hot isostatic pressing (HIP), where purified H 2 and Ar were used as the MA atmosphere. Microstructural observations and room- and high-temperature mechanical tests were performed for UFG W-TiC before and after neutron irradiation to a fluence of 2x10 24 n m -2 at 873 K. It is shown that the MA atmosphere significantly affects grain refinement, room-temperature strength and high-temperature tensile plasticity of UFG W-TiC. W-0.5TiC with H 2 in MA (W-0.5TiC-H 2 ) shows a larger strain rate sensitivity of flow stress, m, of 0.5∼0.6 at temperatures from 1673 to 1973 K, which is a feature of superplastic materials. Whereas W-0.5TiC-Ar shows a smaller m value of approximately 0.2. No radiation hardening is recognized in UFG W-0.5TiC-H 2 and W-0.5TiC-Ar
7 CFR 1980.320 - Interest rate.
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Interest rate. 1980.320 Section 1980.320 Agriculture... REGULATIONS (CONTINUED) GENERAL Rural Housing Loans § 1980.320 Interest rate. The interest rate must not... interest rate over the life of the loan. The rate shall be agreed upon by the borrower and the Lender and...
46 CFR 182.320 - Water heaters.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Water heaters. 182.320 Section 182.320 Shipping COAST...) MACHINERY INSTALLATION Auxiliary Machinery § 182.320 Water heaters. (a) A water heater must meet the...), except that an electric water heater is also acceptable if it: (1) Has a capacity of not more than 454...
Conceptual design report, 219-S secondary containment upgrade, Project W-178
International Nuclear Information System (INIS)
Beyer, J.J.
1993-05-01
The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000
Structural analysis of the equipment removal system for tanks 241C106 and 241AY102
International Nuclear Information System (INIS)
Mackey, T.C.
1994-10-01
The calculations documented in this report show that the ERS major components are structurally qualified to complete the objective: install the removed equipment into a shipping container, transport and store the container at the Central Waste Complex (CWC). The analysis for the structural members of the ERS components considers live load with an impact factor of 125% and dead load. An allowable stress of 1/3 yield is used for all structural components carrying the load based on DOE-RL-92-36. Adherence to DOE-RL-92-36 is not a code requirement. However, due to the loads considered, this factor of safety is appropriate. The calculations meet the strength requirements of the American Institute for Steel Construction (AISC 1989) for all non-critical structural elements
Zaburzenia lipidowe u pacjentów z zawrotami głowy
Directory of Open Access Journals (Sweden)
Hanna Zielińska-Bliźniewska
2012-11-01
Full Text Available Wprowadzenie: Celem pracy była ocena zaburzeń lipidowych u pacjentów z zawrotami głowy. Materiał i metody: Badania przeprowadzono na grupie 918 chorych, w tym 598 kobiet i 320 mężczyzn, w wieku 18–83 lat (średnia wieku 55±0,5, leczonych w latach 2009–2011 w Klinice Otolaryngologii i Onkologii Laryngologicznej z Zespołem Pracowni Audiologicznych i Foniatrycznych Uniwersyteckiego Szpitala Klinicznego im. WAM w Łodzi z powodu zawrotów głowy. U wszystkich chorych przeprowadzono szczegółowy wywiad, badanie przedmiotowe otolaryngologiczne, otoneurologiczne. Każdy pacjent był konsultowany neurologicznie, okulistycznie i internistycznie oraz miał wykonywane USG naczyń doczaszkowych, tomografię komputerową odcinka szyjnego kręgosłupa i głowy w celu wykluczenia schorzeń organicznych ośrodkowego układu nerwowego. Przeprowadzono także badania laboratoryjne, takie jak stężenie cholesterolu całkowitego, triglicerydy, frakcję cholesterolu LDL i HDL oraz stężenie glukozy w surowicy krwi. Wyniki: W grupie 918 pacjentów z zawrotami głowy u 539 (58,71% miały one pochodzenie ośrodkowe, a u 379 chorych (41,28% charakter mieszany, w tym u 366 kobiet (67,90% rozpoznano zawroty pochodzenia ośrodkowego, a u 232 (61,21% typu mieszanego. Spośród 320 mężczyzn (34,78% z zawrotami głowy u 173 (32,09% stwierdzono zawroty pochodzenia ośrodkowego, a u 147 (38,78% typu mieszanego. Analizując stężenia frakcji lipidów u badanych, odnotowano podwyższone wartości cholesterolu całkowitego u 67,03% z nich, w tym u 71,34% mężczyzn i 64,76% kobiet. Podwyższone stężenia frakcji cholesterolu LDL zaobserwowano u 51,57% pacjentów, w tym u 54,83% mężczyzn i 49,83% kobiet. Frakcja HDL cholesterolu u większości chorych (61,99% była w normie. Również stężenie triglicerydów u większości badanych (u 69,45% nie odbiegało od normy, podobnie jak stężenie glukozy (u 59,25% mężczyzn oraz 67,78% kobiet. Wnioski: Zaburzenia
46 CFR 119.320 - Water heaters.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Water heaters. 119.320 Section 119.320 Shipping COAST... Machinery § 119.320 Water heaters. (a) A water heater must meet the requirements of Parts 53 and 63 in... electric water heater is also acceptable if it: (1) Has a capacity of not more than 454 liters (120 gallons...
International Nuclear Information System (INIS)
SASAKI, L.M.
1999-01-01
This sampling and analysis plan identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained to address vapor issues related to the sluicing of tank 241-C-106. Sampling will be performed in accordance with Waste Retrieval Sluicing System Emissions Collection Phase III (Jones 1999) and Process Test Plan Phase III, Waste Retrieval Sluicing System Emissions Collection (Powers 1999). Analytical requirements include those specified in Request for Ecology Concurrence on Draft Strategy/Path Forward to Address Concerns Regarding Organic Emissions from C-106 Sluicing Activities (Peterson 1998). The Waste Retrieval Sluicing System was installed to retrieve and transfer high-heat sludge from tank 241-C-106 to tank 241-AY-102, which is designed for high-heat waste storage. During initial sluicing of tank 241-C-106 in November 1998, operations were halted due to detection of unexpected high volatile organic compounds in emissions that exceeded regulatory permit limits. Several workers also reported smelling sharp odors and throat irritation. Vapor grab samples from the 296-C-006 ventilation system were taken as soon as possible after detection; the analyses indicated that volatile and semi-volatile organic compounds were present. In December 1998, a process test (phase I) was conducted in which the pumps in tanks 241-C-106 and 241-AY-102 were operated and vapor samples obtained to determine constituents that may be present during active sluicing of tank 241-C-106. The process test was suspended when a jumper leak was detected. On March 7, 1999, phase I1 of the process test was performed; the sluicing system was operated for approximately 7 hours and was ended using the controlled shutdown method when the allowable amount of solids were transferred to 241-AY-102. The phase II test was successful, however, further testing is required to obtain vapor samples at higher emission levels
W Photoprotection in Tropical Marine Organisms
Armstrong, Roy A.
1997-01-01
Increasing levels of ultraviolet (UV) radiation reaching the earth's surface which results from stratospheric ozone depletions could have serious implications for terrestrial plants and for aquatic organisms within the euphotic zone. A documented 9% decline in ozone at mid-latitudes is considered to produce a 12% increase in harmful UV radiation. The biologically damaging effects of higher UV levels, particularly W-B (280-320 rim), could manifest earlier in the tropics because of the relative thinness of the earth's equatorial ozone layer. Tropical marine organisms are also living close to their upper tolerance levels of water temperature, However, despite the large potential effects on plants and animals, little is known about UV effects on tropical ecosystems. Long-term ecological studies are needed to quantify the effects of increased UV radiation on terrestrial and marine ecosystems and to produce reliable data for prediction. Plants have developed several mechanisms to protect themselves from harmful UV radiation, one of which is the production of secondary leaf pigments that absorb W-B radiation (screening pigments). A higher concentration of screening pigments (e.g. flavonoids) in leaves may be interpreted as a natural response to increased W radiation. If higher concentrations of flavonoids filter out the excessive W radiation, no damage will occur, as suggested by Caldwell et al. (1989) and Tevini (1993). Failure to screen all W-B may result in deleterious effects on photosynthesis, plant genetic material, and plant and leaf morphology and growth. Eventually this will have an impact on ecosystem processes, structure, species composition, and productivity. This paper describes an ongoing project that is assessing the responses of mangroves, seagrasses and corals to W radiation by studying pigment concentrations, biophysical parameters, and variations in spectral reflectance in the field and in W-reduction experiments. Preliminary results on the distribution
48 CFR 52.241-5 - Contractor's Facilities.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Facilities....241-5 Contractor's Facilities. As prescribed in 41.501(c)(4), insert a clause substantially the same as the following: Contractor's Facilities (FEB 1995) (a) The Contractor, at its expense, unless...
International Nuclear Information System (INIS)
Mutzhas, M.F.; Holzle, E.; Hofmann, C.; Plewig, G.
1981-01-01
A new apparatus (UVASUN 5000) is presented with high-radiation energy between 320 to 460 nm. The measureable energy below 320 nm was shown to be many orders of magnitude too low to produce erythema. The radiator is a specially developed source for high uv-A intensity, housing a quartz bulb with a mixture of argon, mercury and metal-halides. At a skin-target distance of 0.2 m the size of the irradiated area is 0.35 x 0.35 m, and the measured mean uv-A intensity is about 1400 W. m-2 (140 mW . cm-2). The uv-A energy in the range of 320 to 400 nm is about 84% of the total radiation energy. Effects of very high doses of uv-A on human skin were studied. Following single uv-a applications the minimal tanning dose uv-A (MTD) and the immediate pigment darkening (IPD) dose of uv-A were established. The calculated IPD threshold time was 1.8 min at 0.2 m. Repeated exposure to this uv-A delivering system yields long lasting dark brown skin pigmentation without any clinical or histological signs of sunburn (uv-B) damage, epidermal hyperplasia or thickening of the stratum corneum. The instrument was also successfully used for photo-patch testing and reproduction of skin lesions of polymorphous light eruption. Minimal therapeutic results were seen in the phototherapy of vitiligo and inflammatory acne
241-SY-101 multi-functional instrument tree acceptance for beneficial use (ABU)
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This document formally demonstrates that the ABU process for the 241-SY-101 risers 17B and 17C Multi-functional Instrument Trees (MIT's) has been properly completed in accordance with the approved ABU checklists. For each item required on the ABU Checklist, a bibliography of the documentation prepared and released to satisfy the requirements is provided. Release of this documentation signifies that the tank farm Operations, Engineering, and Maintenance organizations have accepted responsibility for the MIT'S in 241-SY-101 Risers 17B and 17C
Near-surface microstructural modification of (Ti,W)(C,N)-based compacts with nitrogen
International Nuclear Information System (INIS)
Ucakar, V.; Kral, C.; Lengauer, W.
2001-01-01
For developing of functional-gradient hardmetals the interaction of nitrogen with (Ti,W)(C,N)-based compacts was investigated. Hot-pressed (Ti,W)(C,N) compacts as well as sintered compacts of (Ti,W)(C,N)+Co were subjected to sintering and heat treatment at 1200-1500 o C and up to 30 bar N 2 . In (Ti,W)(C,N) compacts four microstructure types were obtained upon reaction with nitrogen. A uniform single-phase (Ti,W)(C,N) forms in samples with a low WC and high TiN content. If medium WC and high TiN/TiC ratio is present a core-rim type structure forms during Ar annealing which remains the same when nitrogen in-diffusion occurs. The third type of microstructure shows sub-micron lamellae of nitrogen-rich fcc phase and WC. This structure forms at increased WC and/or TiC content. If the WC content is increased again a WC layer forms at the outermost surface. Compressive stresses introduced by phase formation/decomposition were obtained for the nitrogen in-diffusion. Sintered (Ti,W)(C,N)+Co compacts were heat treated above and below the eutectic temperature. Above the eutectic temperature compact Ti(C,N) top-layers independent an sample composition were observed. Below the eutectic temperature the microstructure formation is mainly influenced by the sample composition. A Ti(C,N) top-layer forms in materials with a high Ti(C,N) content. Contrary, interaction zones without a layer were obtained in compacts with high WC/Ti(C,N) ratio. Some of these surface modified compacts show surfaces and particle sizes favorable for a cutting tool. (author)
5 CFR 9901.106 - Relationship to other provisions.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Relationship to other provisions. 9901.106 Section 9901.106 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND....S.C. 5545b; and (iii) Recruitment, relocation, and retention payments under 5 U.S.C. 5753 through...
International Nuclear Information System (INIS)
Hatch, C.E.
1995-05-01
This document is the Functional Design Criteria for Project W-252. Project W-252 provides the scope to provide BAT/AKART (best available technology...) to 200 Liquid Effluent Phase II streams (B-Plant). This revision (Rev. 2) incorporates a major descoping of the project. The descoping was done to reflect a combination of budget cutting measures allowed by a less stringent regulatory posture toward the Phase II streams
40 CFR 436.241 - Specialized definitions.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...
Energy Technology Data Exchange (ETDEWEB)
Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)
1965-10-15
The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author
Project W-521, waste feed delivery systems environmental permits and approvals plan
International Nuclear Information System (INIS)
TOLLEFSON, K.S.
1999-01-01
This document has been prepared to define the specific environmental requirements applicable to Project W-521. The document describes the permits and approvals necessary for the project to design, construct, and install planned upgrades, and provides a schedule of activities and provides cost estimates to complete the required permitting and approval activities
International Nuclear Information System (INIS)
Ingle, S.J.
1996-03-01
This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility
The Climate Change Consortium of Wales (C3W)
Hendry, K. R.; Reis, J.; Hall, I. R.
2011-12-01
In response to the complexity and multidisciplinary nature of climate change research, the Climate Change Consortium of Wales (C3W) was formed in 2009 by the Welsh universities of Aberystwyth, Bangor, Cardiff and Swansea. Initially funded by Welsh Government, through the Higher Education Funding Council for Wales, the Countryside Council for Wales and the universities, C3W aims to bring together climate change researchers from a wide range of disciplines to explore scientific and sociological drivers, impacts and implications at local, national and international scale. The specific aims are to i) improve our fundamental understanding of the causes, nature, timing and consequences of climate change on Planet Earth's environment and on humanity, and ii) to reconfigure climate research in Wales as a recognisable centre of excellence on the world stage. In addition to improving the infrastructure for climate change research, we aim to improve communication, networking, collaborative research, and multidisciplinary data assimilation within and between the Welsh universities, and other UK and international institutions. Furthermore, C3W aims to apply its research by actively contributing towards national policy development, business development and formal and informal education activities within and beyond Wales.
International Nuclear Information System (INIS)
VAN BEEK, J.E.
2000-01-01
This systems Engineering Management and Implementation Plan (SEMIP) describes the Project W-211 implementation of the Tank Farm Contractor Systems Engineering Management Plan (TFC SEMP). The SEMIP defines the systems engineering products and processes used by the project to comply with the TFC SEMP, and provides the basis for tailoring systems engineering processes by applying a graded approach to identify appropriate systems engineering requirements for W-211
Energy Technology Data Exchange (ETDEWEB)
VAN BEEK, J.E.
2000-05-05
This systems Engineering Management and Implementation Plan (SEMIP) describes the Project W-211 implementation of the Tank Farm Contractor Systems Engineering Management Plan (TFC SEMP). The SEMIP defines the systems engineering products and processes used by the project to comply with the TFC SEMP, and provides the basis for tailoring systems engineering processes by applying a graded approach to identify appropriate systems engineering requirements for W-211.
Americium-241 in bile and feces
International Nuclear Information System (INIS)
LoSasso, T.; Cohen, N.; Wrenn, M.E.
1977-01-01
In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route
Synthesis of TiC/W core–shell nanoparticles by precipitate-coating process
International Nuclear Information System (INIS)
Xia Min; Yan Qingzhi; Xu Lei; Zhu Lingxu; Guo Hongyan; Ge Changchun
2012-01-01
Graphical abstract: Well-dispersed titanium carbide/tungsten (TiC/W) core-shell nanoparticles with high-purity and uniform diameters were firstly synthesized by precipitate-coating process. Such unique process suggests a new method for preparing X/W (X refers the water-insoluble nanoparticles) core-shell nanoparticles with different cores. Abstract: Well-dispersed titanium carbide/tungsten (TiC/W) core–shell nanoparticles with high-purity and uniform diameters were firstly synthesized by precipitate-coating process. The as-synthesized nanoparticles were characterized by X-ray diffraction (XRD), Filed-emission scanning electron microscope (FESEM), Transmission electron microscopy (TEM), energy dispersive spectrum (EDS). Results revealed that the as-synthesized nanoparticles possess uniform diameters about 100 nm, and high purity. TEM and the corresponding FFT images demonstrate that TiC nanoparticles were well-encapsulated by W shells. Such unique process suggests a new method for preparing X/W (X refers the water-insoluble nanoparticles) core–shell nanoparticles with different cores.
Project specific quality assurance plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1994-01-01
The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation
10 CFR 600.241 - Financial reporting.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...
12 CFR 335.241 - Unlisted trading.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...
42 CFR 413.241 - Pharmacy arrangements.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
46 CFR 132.320 - Helicopter-landing decks.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Helicopter-landing decks. 132.320 Section 132.320 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS FIRE-PROTECTION EQUIPMENT Miscellaneous § 132.320 Helicopter-landing decks. Each vessel with a helicopter-landing deck must...
W/SiC X-ray multilayers optimized for use above 100 keV
DEFF Research Database (Denmark)
Windt, D.L.; Dongey, S.; Hailey, C.J.
2002-01-01
-derived optical constants, which we determined from reflectance-vs-incidence angle measurements also made using synchrotron radiation, in the range E=120 - 180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard X-ray reflective coatings operating in the energy range 100 - 200 keV. Grazing incidence X-ray reflectance at E=8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, while synchrotron radiation was used to measure the hard X-ray reflectance of a depth-graded multilayer designed specifically for use in the range Esimilar to150 - 170 keV. We have modeled the hard X-ray reflectance using newly...
W/SiC x-ray multilayers optimized for use above 100 keV
DEFF Research Database (Denmark)
Windt, D.L.; Donguy, S.; Hailey, C.J.
2003-01-01
optical constants, which we determined from reflectance versus incidence angle measurements also made using synchrotron radiation, in the range E = 120-180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard x-ray reflective coatings operating in the energy range 100-200 keV. Grazing-incidence x-ray reflectance at E = 8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, whereas synchrotron radiation was used to measure the hard x-ray reflectance of a depth-graded multilayer designed specifically for use in, the range Esimilar to150-170 keV. We have modeled the hard x-ray reflectance using newly derived...
Directory of Open Access Journals (Sweden)
LITA LIDYAWATI
2016-02-01
Full Text Available ABSTRAK Filter didefinisikan sebagai proses atau rangkaian yang melewatkan pita frekuensi tertentu yang diinginkan dan meredam pita frekuensi lainnya. Salah satu metode perancangan filter digital Finite Impulse Response (FIR adalah metode windowing. Dalam penelitian ini digunakan jenis window Hamming dan Blackman. Simulasi dilakukan dengan menggunakan software Matlab dengan memasukan frekuensi passband, frekuensi stopband, ripple passband, dan stopband attenuation. Dengan frekuensi sampling sebesar 15000 Hz, frekuensi passband sebesar 3000 Hz, frekuensi stopband sebesar 5000 Hz. Setelah simulasi dilakukan implementasi filter dengan parameter yang sama menggunakan DSK TMS 320C6713 dengan bantuan software CCS. Simulasi dan implementasi dilakukan pada semua band frekuensi. Hasil pengujian terhadap implementasi filter adalah respon magnitude, frekuensi cut-off, bandwidth, dan faktor kualitas dengan hasil simulasi tidak menunjukkan perbedaan yang signifikan. Kata kunci: filter digital, windowing, Hamming, Blackman, frekuensi cut-off . ABSTRACT Filter is defined as a process or series that skip certain desired frequency band and other frequency bands drown. One method of designing a digital filter Finite Impulse Response (FIR is a windowing method. This study used the type of window Hamming and Blackman. Simulations performed using Matlab software by inserting a frequency passband, stopband frequency, passband ripple, and stopband attenuation. With a sampling frequency of 15,000 Hz, a frequency of 3000 Hz passband, stopband frequency of 5000 Hz. After the simulation is completed, implementation of the filter with the same parameters using TMS 320C6713 DSK with the help of software CCS. Simulation and implmentasi performed on all frequency bands. The test results of the implementation of the filter is the Magnitude response, the cut-off frequency, bandwidth, and quality factor with simulation results showed no significant difference. Keywords: digital
Am-241 buildup in nematode organisms
International Nuclear Information System (INIS)
Martyushov, V.Z.; Tarasov, O.V.
1990-01-01
The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped
Project W-314 phase I environmental permits and approvals plan
International Nuclear Information System (INIS)
TOLLEFSON, K.S.
1999-01-01
This document describes the range of environmental actions, including required permits and other agency approvals, for Project W-314 activities in the Hanford Site's Tank Waste Remediation System. This document outlines alternative approaches to satisfying applicable environmental standards, and describes selected strategies for acquiring permits and other approvals needed for waste feed delivery to proceed. This document also includes estimated costs and schedule to obtain the required permits and approvals based on the selected strategy. It also provides estimated costs for environmental support during design and construction based on the preliminary project schedule provided
The HCM-linked W792R mutation in cardiac myosin-binding protein C reduces C6 FnIII domain stability.
Smelter, Dan F; de Lange, Willem J; Cai, Wenxuan; Ge, Ying; Ralphe, J Carter
2018-06-01
Cardiac myosin-binding protein C (cMyBP-C) is a functional sarcomeric protein that regulates contractility in response to contractile demand, and many mutations in cMyBP-C lead to hypertrophic cardiomyopathy (HCM). To gain insight into the effects of disease-causing cMyBP-C missense mutations on contractile function, we expressed the pathogenic W792R mutation (substitution of a highly conserved tryptophan residue by an arginine residue at position 792) in mouse cardiomyocytes lacking endogenous cMyBP-C and studied the functional effects using three-dimensional engineered cardiac tissue constructs (mECTs). Based on complete conservation of tryptophan at this location in fibronectin type II (FnIII) domains, we hypothesized that the W792R mutation affects folding of the C6 FnIII domain, destabilizing the mutant protein. Adenoviral transduction of wild-type (WT) and W792R cDNA achieved equivalent mRNA transcript abundance, but not equivalent protein levels, with W792R compared with WT controls. mECTs expressing W792R demonstrated abnormal contractile kinetics compared with WT mECTs that were nearly identical to cMyBP-C-deficient mECTs. We studied whether common pathways of protein degradation were responsible for the rapid degradation of W792R cMyBP-C. Inhibition of both ubiquitin-proteasome and lysosomal degradation pathways failed to increase full-length mutant protein abundance to WT equivalence, suggesting rapid cytosolic degradation. Bacterial expression of WT and W792R protein fragments demonstrated decreased mutant stability with altered thermal denaturation and increased susceptibility to trypsin digestion. These data suggest that the W792R mutation destabilizes the C6 FnIII domain of cMyBP-C, resulting in decreased full-length protein expression. This study highlights the vulnerability of FnIII-like domains to mutations that alter domain stability and further indicates that missense mutations in cMyBP-C can cause disease through a mechanism of
24 CFR 241.825 - Pro rata refund of insurance premium.
2010-04-01
... Projects Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.825 Pro rata refund of insurance premium... of the current annual loan insurance premium theretofore paid which is applicable to the portion of... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata refund of insurance...
7 CFR 1493.320 - Recovery of losses.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Recovery of losses. 1493.320 Section 1493.320... Facility Guarantee Program (FGP) Operations § 1493.320 Recovery of losses. (a) Notification. Upon payment of loss to the exporter or the exporter's assignee, CCC will notify the foreign bank of CCC's rights...
Ross In Situ Uranium Recovery Project NESHAP Subpart W Construction Approval
On May 5, 2015, EPA issued a Construction Approval under the National Emission Standards for Hazardous Air Pollutants (NESHAPs) at 40 CFR Part 61, subpart W, to Strata Energy, Inc., for their Ross In Situ Recovery (ISR) Uranium Project in Crook County, WY.
46 CFR 183.320 - Generators and motors.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Generators and motors. 183.320 Section 183.320 Shipping...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.320 Generators and motors. (a) Each generator and motor must be: (1) In a location that is accessible, adequately ventilated, and as dry as...
Tamada, Hiromi; Kiyama, Hiroshi
2015-01-01
Interstitial cells of Cajal (ICC) are mesenchymal cells that are distributed along the gastrointestinal tract and function as pacemaker cells or intermediary cells between nerves and smooth muscle cells. ICC express a receptor tyrosine kinase c-Kit, which is an established marker for ICC. The c-kit gene is allelic with the murine white-spotting locus (W), and some ICC subsets were reported to be missing in heterozygous mutant W/W(v) mice carrying W and W(v) mutated alleles. In this study, the characterization of interstitial cells in the subserosal layer of W/W(v) mice was analyzed by immunohistochemistry and electron microscopy. In the proximal and distal colon of W/W(v) mutant mice, no c-Kit-positive cells were detected in the subserosal layer by immunohistochemistry. By electron microscopy, the interstitial cells, which were characterized by the existence of caveolae, abundant mitochondria and gap junctions, were observed in the W/W(v) mutant colon. The morphological characteristics were comparable to those of the multipolar c-Kit positive ICC seen in the subserosa of proximal and distal colon of wild-type mice. Fibroblasts were also located in the same layers, but the morphology of the fibroblasts was distinguishable from that of ICC in wild type mice or of ICC-like cells in W/W(v) mutant mice. Collectively, it is concluded that c-Kit-negative interstitial cells showing a typical ICC ultrastructure exist in the proximal and distal colon of W/W(v) mutant mice.
South African Medical Journal - Vol 106, No 4 (2016)
African Journals Online (AJOL)
A multifaceted hospital-wide intervention increases hand hygiene compliance · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Patel, H Engelbrecht, H McDonald, V Morris, W Smythe, 335-341. http://dx.doi.org/10.7196/SAMJ.2016.v106i4.10671 ...
Fracture behavior of reaction layers in W and SiC joint system
International Nuclear Information System (INIS)
Son, S.J.; Kohyama, A.; Yu, I.K.; Cho, S.
2007-01-01
Full text of publication follows: SiC and SiC/SiC composites are considering as attractive structural materials for fusion reactors, because of their excellent physical, chemical and nuclear properties in fusion environments. For the application of these materials to gas-cooled fusion blanket systems, they have to satisfy specific requirements, such as hermeticity and surface features, in addition to baseline thermo-mechanical and irradiation properties. One of the critical issues for a fusion technology is a plasma facing material, which is considered in the connection with joining, heat transfer control and protection from helium gas in high temperature components. Tungsten as a coating material for SiC-based plasma-facing components has excellent advantages, such as a small mismatch in coefficient of thermal expansion, a very low sputtering yield, inherent heat resistance and high thermal conductivity. Therefore, tungsten and its alloys are promising as potential coating materials for divertor and first wall applications. In the present work, by using micron-sized tungsten and nano-SiC powders, W-SiC joints were prepared by simultaneous and sequential hot-pressing process. Various reaction products in the tungsten-SiC system were revealed by microstructural analyses. The interfacial phases and thickness were strongly depended on the temperature and time of hot pressing. The fracture characteristics of the reaction layers determine the robustness of W/SiC systems. Therefore, in this work, fracture behaviors by analyzing the indentation induced cracks in each phase and mechanical properties of W/SiC joints were examined. The most high shear strength was obtained in the joints fabricated at the conditions of 1780 deg. C, 20 MPa, 1 hr holding time. Easy crack extension was confirmed in the region of WC phase. The fracture of 1870 deg. C fabrication samples, which showed comparatively low shear strength, occurred at the wide region of reaction phases (WC+W 5 Si 3 +W
The Villas Carrousel PV-Wind Hybrid Project
Energy Technology Data Exchange (ETDEWEB)
Huacuz, Jorge M. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1997-12-31
A pilot project was carried out to supply electrical services for an ecological hotel (eco-hotel), using solar and wind energy in Southeast Mexico. Fifteen small photovoltaic-wind hybrid systems were designed and built by researchers of the Electrical Research Institute of Mexico (IIE), as part of a cooperation agreement with the mexican company Carrousel Operadora Turistica, aimed at developing a technology package to supply electrical services to similar hotels sited in remote areas. Each hybrid system includes one wind generator of 500W nominal capacity, one PV panel ranging in power from 150W to 320 Watts peak, one lead-acid battery bank of 570 ampere-hour in capacity, and an electronic charge controller. This paper describes the systems and summarizes the results from the first twelve months of operation. [Espanol] Se llevo a cabo un proyecto piloto para el suministro de servicios electricos a un hotel ecologico (eco-hotel), utilizando energia solar y energia del viento en el Sudeste de Mexico. Investigadores del Instituto de Investigaciones Electricas de Mexico, disenaron y construyeron quince pequenos sistemas hibridos fotovoltaicos-viento, como parte de un acuerdo de cooperacion con la compania mexicana Carrousel Operadora Turistica, orientado al desarrollo de un paquete tecnologico para proporcionar servicios de energia electrica a hoteles similares ubicados en areas remotas. Cada sistema hibrido incluye un aero-generador con capacidad nominal de 500W un panel foto-voltaico con una potencia que varia entre los 150W y los 320W pico, una banco de baterias de plomo-acido de 570 amperes-hora de capacidad y un controlador electronico de carga. Este articulo describe los sistemas y presenta un resumen de los resultados de los primeros doce meses de operacion.
The Villas Carrousel PV-Wind Hybrid Project
Energy Technology Data Exchange (ETDEWEB)
Huacuz, Jorge M [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1998-12-31
A pilot project was carried out to supply electrical services for an ecological hotel (eco-hotel), using solar and wind energy in Southeast Mexico. Fifteen small photovoltaic-wind hybrid systems were designed and built by researchers of the Electrical Research Institute of Mexico (IIE), as part of a cooperation agreement with the mexican company Carrousel Operadora Turistica, aimed at developing a technology package to supply electrical services to similar hotels sited in remote areas. Each hybrid system includes one wind generator of 500W nominal capacity, one PV panel ranging in power from 150W to 320 Watts peak, one lead-acid battery bank of 570 ampere-hour in capacity, and an electronic charge controller. This paper describes the systems and summarizes the results from the first twelve months of operation. [Espanol] Se llevo a cabo un proyecto piloto para el suministro de servicios electricos a un hotel ecologico (eco-hotel), utilizando energia solar y energia del viento en el Sudeste de Mexico. Investigadores del Instituto de Investigaciones Electricas de Mexico, disenaron y construyeron quince pequenos sistemas hibridos fotovoltaicos-viento, como parte de un acuerdo de cooperacion con la compania mexicana Carrousel Operadora Turistica, orientado al desarrollo de un paquete tecnologico para proporcionar servicios de energia electrica a hoteles similares ubicados en areas remotas. Cada sistema hibrido incluye un aero-generador con capacidad nominal de 500W un panel foto-voltaico con una potencia que varia entre los 150W y los 320W pico, una banco de baterias de plomo-acido de 570 amperes-hora de capacidad y un controlador electronico de carga. Este articulo describe los sistemas y presenta un resumen de los resultados de los primeros doce meses de operacion.
Determination of 241Am in reindeer bone
International Nuclear Information System (INIS)
Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.
1978-01-01
The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden
Determination of {sup 241}Pu in nuclear waste slurries: A comparative study using LSC and ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Jaeggi, M., E-mail: maya.jaeggi@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland); Roellin, S., E-mail: Stefan.Roellin@babs.admin.ch [Federal Office for Civil Protection, SPIEZ Laboratory, CH-3700 Spiez (Switzerland); Corcho Alvarado, J.A., E-mail: Corcho-Alvarado@chuv.ch [Institute of Radiation Physics, University Hospital and University of Lausanne, Rue du Grand-Pre 1, 1007 Lausanne (Switzerland); Eikenberg, J., E-mail: jost.eikenberg@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland)
2012-02-15
{sup 241}Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the {sup 241}Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for {sup 241}Pu, the methods were further validated using the {sup 241}Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. - Highlights: Black-Right-Pointing-Pointer Good agreement between the {sup 241}Pu activity of 5 slurry samples, using 3 measurement techniques. Black-Right-Pointing-Pointer {sup 241}Pu information values of two IAEA samples agreed well for the 3 measurement techniques. Black-Right-Pointing-Pointer Low detection limits were achieved; 1.8 Bq/kg (Quantulus), 2 Bq/kg (ICP-MS) and 3.5 Bq/kg (TriCarb).
Development of ultra-fine grained W-TiC and their mechanical properties for fusion applications
Energy Technology Data Exchange (ETDEWEB)
Kurishita, H. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan)]. E-mail: kurishi@imr.tohoku.ac.jp; Amano, Y. [Department of Materials Science and Engineering, Ehime University, Matsuyama 790-8577 (Japan); Kobayashi, S. [Department of Materials Science and Engineering, Ehime University, Matsuyama 790-8577 (Japan); Nakai, K. [Department of Materials Science and Engineering, Ehime University, Matsuyama 790-8577 (Japan); Arakawa, H. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Hiraoka, Y. [Okayama University of Science, 1-1 Ridai-cho, Okayama 700-0005 (Japan); Takida, T. [A.L.M.T. Corp., 2 Iwase-koshi-machi, Toyama 931-8371 (Japan); Takebe, K. [A.L.M.T. Corp., 2 Iwase-koshi-machi, Toyama 931-8371 (Japan); Matsui, H. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan)
2007-08-01
Effects of neutron irradiation on microstructural evolution and radiation hardening were examined for fine-grained W-0.3 wt%TiC (grain size of 0.9 {mu}m) and commercially available pure W (20 {mu}m). Both materials were neutron irradiated at 563 K to 9 x 10{sup 23} n/m{sup 2} (E > 1 MeV) in the Japan Materials Testing Reactor (JMTR). Post-irradiation examinations showed that the microstructural changes and the degree of hardening due to irradiation were significantly reduced for fine-grained W-0.3TiC compared with pure W, demonstrating the significance of grain refinement to improve radiation resistance. In order to develop ultra-fine grained W-TiC compacts with nearly full densification, the fabrication process was modified, so that W-(0.3-0.7)%TiC with 0.06-0.2 {mu}m grain size and 99% of relative density was fabricated. The achievable grain refinement depended on TiC content and milling atmosphere. The three-point bending fracture strength at room temperature for ultra-fine grained W-TiC compacts of powder milled in H{sub 2} reached approximately 1.6-2 GPa for composition near 0.5%TiC.
A 320 mV, 6 kb subthreshold 10T SRAM employing voltage lowering techniques
International Nuclear Information System (INIS)
Cai Jiangzheng; Zhang Sumin; Yuan Jia; Shang Xinchao; Chen Liming; Hei Yong
2015-01-01
This paper presents a 6 kb SRAM that uses a novel 10T cell to achieve a minimum operating voltage of 320 mV in a 130 nm CMOS process. A number of low power circuit techniques are included to enable the proposed SRAM to operate in the subthreshold region. The reverse short channel effect and the reverse narrow channel effect are utilized to improve the performance of the SRAM. A novel subthreshold pulse generation circuit produces an ideal pulse to make read operation stable. A floating write bit-line effectively reduces the standby leakage consumption. Finally, a short read bit-line makes the read operation fast and energy-saving. Measurements indicate that these techniques are effective, the SRAM can operate at 800 kHz and consume 1.94 μW at its lowest voltage (320 mV). (paper)
MicroRNA-320 suppresses colorectal cancer by targeting SOX4, FOXM1, and FOXQ1
DEFF Research Database (Denmark)
Vishnubalaji, Radhakrishnan; Hamam, Rimi; Shijun, Yue
2016-01-01
Colorectal cancer (CRC) is the third most common cancer causing high mortality rates world-wide. Delineating the molecular mechanisms leading to CRC development and progression, including the role of microRNAs (miRNAs), are currently being unravelled at a rapid rate. Here, we report frequent down...... for the miR-320/SOX4/FOXM1/FOXQ1 axes in promoting CRC development and progression and suggest targeting those networks as potential therapeutic strategy for CRC....... mice. Global gene expression analysis in CRC cells over-expressing miR-320c, combined with in silico prediction identified 84 clinically-relevant potential gene targets for miR-320 in CRC. Using a series of biochemical assays and functional validation, SOX4, FOXM1, and FOXQ1 were validated as novel...... gene targets for the miR-320 family. Inverse correlation between the expression of miR-320 members with SOX4, FOXM1, and FOXQ1 was observed in primary CRC patients' specimens, suggesting that these genes are likely bona fide targets for the miR-320 family. Interestingly, interrogation of the expression...
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
International Nuclear Information System (INIS)
BLACKER, S.M.
2000-01-01
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
Energy Technology Data Exchange (ETDEWEB)
BLACKER, S.M.
2000-04-13
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.
International Nuclear Information System (INIS)
Klinger, G.S.; Clauss, T.W.; Ligotke, M.W.
1995-10-01
This document presents the details of the inorganic and organic analysis that was performed on samples from the headspace of Hanford waste tank 241-C-102. The results described were obtained to support the safety and toxicological evaluations. A summary of the results for the inorganic and organic analytes is included, as well as, a detailed description of the results which appears in the text
XRD analysis and microstructure of milled and sintered V, W, C, and Co powders
CSIR Research Space (South Africa)
Bolokang, AS
2011-01-01
Full Text Available on the starting compositions of pure elements, their lattice coherency according to Hume-Rothery rules on crystal structure and atomic size, and enough milling time that provides adequate kinetics. Keywords ? X-ray analysis; ? (V,W)C; ? Co15W8C6...-1 International Journal of Refractory Metals and Hard Materials Volume 29, Issue 1, January 2011, Pages 108?111 XRD analysis and microstructure of milled and sintered V, W, C, and Co powders ? A.S. Bolokang ? M.J. Phasha ? C. Oliphant ? D. Motaung ? a...
Hydrogen retention and erosion behaviour of tungsten-doped carbon films (a-C:W)
International Nuclear Information System (INIS)
Sauter, Philipp Andre
2012-01-01
In this study tungsten-doped carbon films (a-C:W) were investigated with respect on hydrogen retention and erosion under deuterium (D) impact. a-C:W was used as model system for mixed layers, which will be deposited on the inner wall of the fusion reactor ITER. The erosion is lowered by the successive enrichment of tungsten at the surface and only mildly depends on the dopant concentration and the temperature. The hydrogen retention is determined by the diffusion of D into depth, which increases with temperature. The resulting successive accumulation of D in a-C:W is insensitive on enrichment for high fluences and in line with the accumulation of D in C.
Overview of C-2U FRC Experimental Program and Plans for C-2W
Gota, H.; Binderbauer, M. W.; Tajima, T.; Putvinski, S.; Tuszewski, M.; Dettrick, S.; Korepanov, S.; Smirnov, A.; Thompson, M. C.; Yang, X.; Cappello, M.; Ivanov, A. A.; TAE Team
2016-10-01
Tri Alpha Energy's experimental program has been focused on a demonstration of reliable field-reversed configuration (FRC) formation and sustainment, driven by fast ions via high-power neutral-beam (NB) injection. The world's largest compact-toroid experimental devices, C-2 and C-2U, have successfully produced a well-stabilized, sustainable FRC plasma state with NB injection (input power, PNB 10 + MW; 15 keV hydrogen) and end-on coaxial plasma guns. Remarkable improvements in confinement and stability of FRC plasmas have led to further improved fast-ion build up; thereby, an advanced beam-driven FRC state has been produced and sustained for up to 5 + ms (longer than all characteristic system time scales), only limited by hardware and electric supply constraints such as NB and plasma-gun power supplies. To further improve the FRC performance the C-2U device is being replaced by C-2W featuring higher injected NB power, longer pulse duration as well as enhanced edge-biasing systems and substantially upgraded divertors. Main C-2U experimental results and key features of C-2W will be presented. Tri Alpha Energy, Inc.
XRD and HRTEM characterization of mechanosynthesized Ti{sub 0.9}W{sub 0.1}C cermet
Energy Technology Data Exchange (ETDEWEB)
Bandyopadhyay, S. [Department of Physics, The University of Burdwan, Golapbag, Burdwan 713104, West Bengal (India); Dutta, H. [Department of Physics, Vivekananda College, Burdwan 713103, West Bengal (India); Pradhan, S.K., E-mail: skp_bu@yahoo.com [Department of Physics, The University of Burdwan, Golapbag, Burdwan 713104, West Bengal (India)
2013-12-25
Highlights: •Cubic Ti{sub 0.9}W{sub 0.1}C is formed after 50 min of milling of α-Ti, W and graphite powders. •Nanocrystalline Ti{sub 0.9}W{sub 0.1}C with particle size ∼11 nm is obtained after 8 h milling. •Average particle size of Ti{sub 0.9}W{sub 0.1}C from XRD analysis and HRTEM is very close. •Formation of Ti{sub 0.9}W{sub 0.1}C is hindered as compared with TiC. -- Abstract: Elemental powder mixture of titanium, tungsten and graphite is milled by high energy planetary ball mill at a fixed ball to powder mass ratio (BPMR) for different duration to produce nanosized particles of Ti{sub 0.9}W{sub 0.1}C hard metal. Microstructure characterization in terms of lattice imperfections and phase quantification of ball-milled samples has been done primarily by analyzing the XRD pattern and employing Rietveld method of structure and microstructure refinement. After 8 h of ball-milling full formation of Ti{sub 0.9}W{sub 0.1}C is noticed without any contamination of other phase or milling media. TEM study of 8 h ball-milled sample gives direct supportive evidence of structural and microstructural evaluation by XRD pattern analysis. A comparative study of microstructural changes between TiC and Ti{sub 0.9}W{sub 0.1}C helps to understand the effect of addition of W as solute in Ti–C metal matrix.
International Nuclear Information System (INIS)
Heuvel, R.L. van den
1990-01-01
Radiation damage from 241 Am to bone marrow cells was manifest in long-term bone marrow cultures (LTC) from offspring of mice radiocontaminated at 14th day of gestation (119, 479, 803, 1754 kBq 241 Am kg). Offspring were reared by their own contaminated mother for 3 weeks postnatal. LTC from these offspring were less able to support in vitro CFC proliferation than control LTC. This radiation damage persisted 71 weeks after radiocontamination in utero. Damage was observed at lower doses if 241 Am contamination occurred at foetal rather than adult ages. Radiation damage was observed only using LTC. After culturing LTC in 25% FCS and recharging the stromal adherent layer with bone marrow cell suspensions originating either from control offspring or from offspring contaminated with 241 Am in utero evidence was found that the proliferation capacity of haemopoietic cells was diminished. However, the nature of effects on the stromal elements is currently somewhat equivocal. Following in utero contamination stromal adherent cells appeared to support better production of in vitro CFC. (author)
Aad, G.; Abdallah, J.; Abdelalim, A.A.; Abdesselam, A.; Abdinov, O.; Abi, B.; Abolins, M.; Abramowicz, H.; Abreu, H.; Acerbi, E.; Acharya, B.S.; Ackers, M.; Adams, D.L.; Addy, T.N.; Adelman, J.; Aderholz, M.; Adomeit, S.; Adorisio, C.; Adragna, P.; Adye, T.; Aefsky, S.; Aguilar-Saavedra, J.A.; Aharrouche, M.; Ahlen, S.P.; Ahles, F.; Ahmad, A.; Ahmed, H.; Ahsan, M.; Aielli, G.; Akdogan, T.; Akesson, T.P.A.; Akimoto, G.; Akimov, A.V.; Aktas, A.; Alam, M.S.; Alam, M.A.; Albrand, S.; Aleksa, M.; Aleksandrov, I.N.; Aleppo, M.; Alessandria, F.; Alexa, C.; Alexander, G.; Alexandre, G.; Alexopoulos, T.; Alhroob, M.; Aliev, M.; Alimonti, G.; Alison, J.; Aliyev, M.; Allport, P.P.; Allwood-Spiers, S.E.; Almond, J.; Aloisio, A.; Alon, R.; Alonso, A.; Alonso, J.; Alviggi, M.G.; Amako, K.; Amaral, P.; Ambrosio, G.; Amelung, C.; Ammosov, V.V.; Amorim, A.; Amoros, G.; Amram, N.; Anastopoulos, C.; Andeen, T.; Anders, C.F.; Anderson, K.J.; Andreazza, A.; Andrei, V.; Andrieux, M-L.; Anduaga, X.S.; Angerami, A.; Anghinolfi, F.; Anjos, N.; Annovi, A.; Antonaki, A.; Antonelli, M.; Antonelli, S.; Antos, J.; Antunovic, B.; Anulli, F.; Aoun, S.; Apolle, R.; Arabidze, G.; Aracena, I.; Arai, Y.; Arce, A.T.H.; Archambault, J.P.; Arfaoui, S.; Arguin, J-F.; Argyropoulos, T.; Arik, E.; Arik, M.; Armbruster, A.J.; Arms, K.E.; Armstrong, S.R.; Arnaez, O.; Arnault, C.; Artamonov, A.; Arutinov, D.; Asai, M.; Asai, S.; Asfandiyarov, R.; Ask, S.; Asman, B.; Asner, D.; Asquith, L.; Assamagan, K.; Astbury, A.; Astvatsatourov, A.; Atoian, G.; Aubert, B.; Auerbach, B.; Auge, E.; Augsten, K.; Aurousseau, M.; Austin, N.; Avolio, G.; Avramidou, R.; Axen, D.; Ay, C.; Azuelos, G.; Azuma, Y.; Baak, M.A.; Baccaglioni, G.; Bacci, C.; Bach, A.M.; Bachacou, H.; Bachas, K.; Bachy, G.; Backes, M.; Badescu, E.; Bagnaia, P.; Bai, Y.; Bailey, D.C.; Bain, T.; Baines, J.T.; Baker, O.K.; Baker, M.D.; Baker, S; Baltasar Dos Santos Pedrosa, F.; Banas, E.; Banerjee, P.; Banerjee, Sw.; Banfi, D.; Bangert, A.; Bansal, V.; Baranov, S.P.; Baranov, S.; Barashkou, A.; Barbaro Galtieri, A.; Barber, T.; Barberio, E.L.; Barberis, D.; Barbero, M.; Bardin, D.Y.; Barillari, T.; Barisonzi, M.; Barklow, T.; Barlow, N.; Barnett, B.M.; Barnett, R.M.; Baroncelli, A.; Barone, M.; Barr, A.J.; Barreiro, F.; Barreiro Guimaraes da Costa, J.; Barrillon, P.; Bartoldus, R.; Bartsch, D.; Bates, R.L.; Batkova, L.; Batley, J.R.; Battaglia, A.; Battistin, M.; Battistoni, G.; Bauer, F.; Bawa, H.S.; Bazalova, M.; Beare, B.; Beau, T.; Beauchemin, P.H.; Beccherle, R.; Bechtle, P.; Beck, G.A.; Beck, H.P.; Beckingham, M.; Becks, K.H.; Beddall, A.J.; Beddall, A.; Bednyakov, V.A.; Bee, C.; Begel, M.; Behar Harpaz, S.; Behera, P.K.; Beimforde, M.; Belanger-Champagne, C.; Belhorma, B.; Bell, P.J.; Bell, W.H.; Bella, G.; Bellagamba, L.; Bellina, F.; Bellomo, G.; Bellomo, M.; Belloni, A.; Belotskiy, K.; Beltramello, O.; Ben Ami, S.; Benary, O.; Benchekroun, D.; Benchouk, C.; Bendel, M.; Benedict, B.H.; Benekos, N.; Benhammou, Y.; Benincasa, G.P.; Benjamin, D.P.; Benoit, M.; Bensinger, J.R.; Benslama, K.; Bentvelsen, S.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Berghaus, F.; Berglund, E.; Beringer, J.; Bernardet, K.; Bernat, P.; Bernhard, R.; Bernius, C.; Berry, T.; Bertin, A.; Bertinelli, F.; Bertolucci, F.; Besana, M.I.; Besson, N.; Bethke, S.; Bhimji, W.; Bianchi, R.M.; Bianco, M.; Biebel, O.; Biesiada, J.; Biglietti, M.; Bilokon, H.; Binder, M.; Bindi, M.; Binet, S.; Bingul, A.; Bini, C.; Biscarat, C.; Bischof, R.; Bitenc, U.; Black, K.M.; Blair, R.E.; Blanchard, J-B; Blanchot, G.; Blocker, C.; Blocki, J.; Blondel, A.; Blum, W.; Blumenschein, U.; Boaretto, C.; Bobbink, G.J.; Bobrovnikov, V.B.; Bocci, A.; Bocian, D.; Bock, R.; Boddy, C.R.; Boehler, M.; Boek, J.; Boelaert, N.; Boser, S.; Bogaerts, J.A.; Bogdanchikov, A.; Bogouch, A.; Bohm, C.; Bohm, J.; Boisvert, V.; Bold, T.; Boldea, V.; Bondarenko, V.G.; Bondioli, M.; Boonekamp, M.; Boorman, G.; Booth, C.N.; Booth, P.; Booth, J.R.A.; Bordoni, S.; Borer, C.; Borisov, A.; Borissov, G.; Borjanovic, I.; Borroni, S.; Bos, K.; Boscherini, D.; Bosman, M.; Boterenbrood, H.; Botterill, D.; Bouchami, J.; Boudreau, J.; Bouhova-Thacker, E.V.; Boulahouache, C.; Bourdarios, C.; Boveia, A.; Boyd, J.; Boyko, I.R.; Bozhko, N.I.; Bozovic-Jelisavcic, I.; Braccini, S.; Bracinik, J.; Braem, A.; Brambilla, E.; Branchini, P.; Brandenburg, G.W.; Brandt, A.; Brandt, G.; Brandt, O.; Bratzler, U.; Brau, B.; Brau, J.E.; Braun, H.M.; Brelier, B.; Bremer, J.; Brenner, R.; Bressler, S.; Breton, D.; Brett, N.D.; Bright-Thomas, P.G.; Britton, D.; Brochu, F.M.; Brock, I.; Brock, R.; Brodbeck, T.J.; Brodet, E.; Broggi, F.; Bromberg, C.; Brooijmans, G.; Brooks, W.K.; Brown, G.; Brubaker, E.; Bruckman de Renstrom, P.A.; Bruncko, D.; Bruneliere, R.; Brunet, S.; Bruni, A.; Bruni, G.; Bruschi, M.; Buanes, T.; Bucci, F.; Buchanan, J.; Buchanan, N.J.; Buchholz, P.; Buckingham, R.M.; Buckley, A.G.; Budagov, I.A.; Budick, B.; Buscher, V.; Bugge, L.; Buira-Clark, D.; Buis, E.J.; Bulekov, O.; Bunse, M.; Buran, T.; Burckhart, H.; Burdin, S.; Burgess, T.; Burke, S.; Busato, E.; Bussey, P.; Buszello, C.P.; Butin, F.; Butler, B.; Butler, J.M.; Buttar, C.M.; Butterworth, J.M.; Byatt, T.; Caballero, J.; Cabrera Urban, S.; Caccia, M.; Caforio, D.; Cakir, O.; Calafiura, P.; Calderini, G.; Calfayan, P.; Calkins, R.; Caloba, L.P.; Caloi, R.; Calvet, D.; Calvet, S.; Camard, A.; Camarri, P.; Cambiaghi, M.; Cameron, D.; Cammin, J.; Campana, S.; Campanelli, M.; Canale, V.; Canelli, F.; Canepa, A.; Cantero, J.; Capasso, L.; Capeans Garrido, M.D.M.; Caprini, I.; Caprini, M.; Caprio, M.; Capriotti, D.; Capua, M.; Caputo, R.; Caramarcu, C.; Cardarelli, R.; Carli, T.; Carlino, G.; Carminati, L.; Caron, B.; Caron, S.; Carpentieri, C.; Carrillo Montoya, G.D.; Carron Montero, S.; Carter, A.A.; Carter, J.R.; Carvalho, J.; Casadei, D.; Casado, M.P.; Cascella, M.; Caso, C.; Castaneda Hernandez, A.M.; Castaneda-Miranda, E.; Castillo Gimenez, V.; Castro, N.F.; Cataldi, G.; Cataneo, F.; Catinaccio, A.; Catmore, J.R.; Cattai, A.; Cattani, G.; Caughron, S.; Cauz, D.; Cavallari, A.; Cavalleri, P.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Cazzato, A.; Ceradini, F.; Cerna, C.; Cerqueira, A.S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cervetto, M.; Cetin, S.A.; Cevenini, F.; Chafaq, A.; Chakraborty, D.; Chan, K.; Chapman, J.D.; Chapman, J.W.; Chareyre, E.; Charlton, D.G.; Chavda, V.; Cheatham, S.; Chekanov, S.; Chekulaev, S.V.; Chelkov, G.A.; Chen, H.; Chen, L.; Chen, S.; Chen, T.; Chen, X.; Cheng, S.; Cheplakov, A.; Chepurnov, V.F.; Cherkaoui El Moursli, R.; Tcherniatine, V.; Chesneanu, D.; Cheu, E.; Cheung, S.L.; Chevalier, L.; Chevallier, F.; Chiarella, V.; Chiefari, G.; Chikovani, L.; Childers, J.T.; Chilingarov, A.; Chiodini, G.; Chizhov, M.V.; Choudalakis, G.; Chouridou, S.; Christidi, I.A.; Christov, A.; Chromek-Burckhart, D.; Chu, M.L.; Chudoba, J.; Ciapetti, G.; Ciftci, A.K.; Ciftci, R.; Cinca, D.; Cindro, V.; Ciobotaru, M.D.; Ciocca, C.; Ciocio, A.; Cirilli, M.; Citterio, M.; Clark, A.; Clark, P.J.; Cleland, W.; Clemens, J.C.; Clement, B.; Clement, C.; Clifft, R.W.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Coe, P.; Coelli, S.; Coggeshall, J.; Cogneras, E.; Cojocaru, C.D.; Colas, J.; Cole, B.; Colijn, A.P.; Collard, C.; Collins, N.J.; Collins-Tooth, C.; Collot, J.; Colon, G.; Coluccia, R.; Comune, G.; Conde Muino, P.; Coniavitis, E.; Conidi, M.C.; Consonni, M.; Constantinescu, S.; Conta, C.; Conventi, F.; Cook, J.; Cooke, M.; Cooper, B.D.; Cooper-Sarkar, A.M.; Cooper-Smith, N.J.; Copic, K.; Cornelissen, T.; Corradi, M.; Correard, S.; Corriveau, F.; Corso-Radu, A.; Cortes-Gonzalez, A.; Cortiana, G.; Costa, G.; Costa, M.J.; Costanzo, D.; Costin, T.; Cote, D.; Coura Torres, R.; Courneyea, L.; Cowan, G.; Cowden, C.; Cox, B.E.; Cranmer, K.; Cranshaw, J.; Cristinziani, M.; Crosetti, G.; Crupi, R.; Crepe-Renaudin, S.; Cuenca Almenar, C.; Cuhadar Donszelmann, T.; Cuneo, S.; Curatolo, M.; Curtis, C.J.; Cwetanski, P.; Czirr, H.; Czyczula, Z.; D'Auria, S.; D'Onofrio, M.; D'Orazio, A.; Da Rocha Gesualdi Mello, A.; Da Silva, P.V.M.; Da Via, C; Dabrowski, W.; Dahlhoff, A.; Dai, T.; Dallapiccola, C.; Dallison, S.J.; Daly, C.H.; Dam, M.; Dameri, M.; Damiani, D.S.; Danielsson, H.O.; Dankers, R.; Dannheim, D.; Dao, V.; Darbo, G.; Darlea, G.L.; Daum, C.; Dauvergne, J.P.; Davey, W.; Davidek, T.; Davidson, N.; Davidson, R.; Davies, M.; Davison, A.R.; Dawe, E.; Dawson, I.; Dawson, J.W.; Daya, R.K.; De, K.; de Asmundis, R.; De Castro, S.; De Castro Faria Salgado, P.E.; De Cecco, S.; de Graat, J.; De Groot, N.; de Jong, P.; De La Cruz-Burelo, E.; De La Taille, C.; De Lotto, B.; De Mora, L.; De Nooij, L.; De Oliveira Branco, M.; De Pedis, D.; de Saintignon, P.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Vivie De Regie, J.B.; De Zorzi, G.; Dean, S.; Dedes, G.; Dedovich, D.V.; Defay, P.O.; Degenhardt, J.; Dehchar, M.; Deile, M.; Del Papa, C.; Del Peso, J.; Del Prete, T.; Dell'Acqua, A.; Dell'Asta, L.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delpierre, P.; Delruelle, N.; Delsart, P.A.; Deluca, C.; Demers, S.; Demichev, M.; Demirkoz, B.; Deng, J.; Deng, W.; Denisov, S.P.; Dennis, C.; Derkaoui, J.E.; Derue, F.; Dervan, P.; Desch, K.; Deviveiros, P.O.; Dewhurst, A.; DeWilde, B.; Dhaliwal, S.; Dhullipudi, R.; Di Ciaccio, A.; Di Ciaccio, L.; Di Domenico, A.; Di Girolamo, A.; Di Girolamo, B.; Di Luise, S.; Di Mattia, A.; Di Nardo, R.; Di Simone, A.; Di Sipio, R.; Diaz, M.A.; Diaz Gomez, M.M.; Diblen, F.; Diehl, E.B.; Dietl, H.; Dietrich, J.; Dietzsch, T.A.; Diglio, S.; Dindar Yagci, K.; Dingfelder, J.; Dionisi, C.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djilkibaev, R.; Djobava, T.; do Vale, M.A.B.; Do Valle Wemans, A.; Doan, T.K.O.; Dobbs, M.; Dobinson, R.; Dobos, D.; Dobson, E.; Dobson, M.; Dodd, J.; Dogan, O.B.; Doglioni, C.; Doherty, T.; Doi, Y.; Dolejsi, J.; Dolenc, I.; Dolezal, Z.; Dolgoshein, B.A.; Dohmae, T.; Donadelli, M.; Donega, M.; Donini, J.; Dopke, J.; Doria, A.; Dos Anjos, A.; Dosil, M.; Dotti, A.; Dova, M.T.; Dowell, J.D.; Doxiadis, A.; Doyle, A.T.; Drasal, Z.; Drees, J.; Dressnandt, N.; Drevermann, H.; Driouichi, C.; Dris, M.; Drohan, J.G.; Dubbert, J.; Dubbs, T.; Dube, S.; Duchovni, E.; Duckeck, G.; Dudarev, A.; Dudziak, F.; Duhrssen, M.; Duerdoth, I.P.; Duflot, L.; Dufour, M-A.; Dunford, M.; Duran Yildiz, H.; Dushkin, A.; Duxfield, R.; Dwuznik, M.; Dydak, F.; Dzahini, D.; Duren, M.; Ebenstein, W.L.; Ebke, J.; Eckert, S.; Eckweiler, S.; Edmonds, K.; Edwards, C.A.; Efthymiopoulos, I.; Egorov, K.; Ehrenfeld, W.; Ehrich, T.; Eifert, T.; Eigen, G.; Einsweiler, K.; Eisenhandler, E.; Ekelof, T.; El Kacimi, M.; Ellert, M.; Elles, S.; Ellinghaus, F.; Ellis, K.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Ely, R.; Emeliyanov, D.; Engelmann, R.; Engl, A.; Epp, B.; Eppig, A.; Erdmann, J.; Ereditato, A.; Eriksson, D.; Ermoline, I.; Ernst, J.; Ernst, M.; Ernwein, J.; Errede, D.; Errede, S.; Ertel, E.; Escalier, M.; Escobar, C.; Espinal Curull, X.; Esposito, B.; Etienne, F.; Etienvre, A.I.; Etzion, E.; Evangelakou, D.; Evans, H.; Evdokimov, V.N.; Fabbri, L.; Fabre, C.; Facius, K.; Fakhrutdinov, R.M.; Falciano, S.; Falou, A.C.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farley, J.; Farooque, T.; Farrington, S.M.; Farthouat, P.; Fasching, D.; Fassnacht, P.; Fassouliotis, D.; Fatholahzadeh, B.; Fayard, L.; Fazio, S.; Febbraro, R.; Federic, P.; Fedin, O.L.; Fedorko, I.; Fedorko, W.; Fehling-Kaschek, M.; Feligioni, L.; Felzmann, C.U.; Feng, C.; Feng, E.J.; Fenyuk, A.B.; Ferencei, J.; Ferguson, D.; Ferland, J.; Fernandes, B.; Fernando, W.; Ferrag, S.; Ferrando, J.; Ferrara, V.; Ferrari, A.; Ferrari, P.; Ferrari, R.; Ferrer, A.; Ferrer, M.L.; Ferrere, D.; Ferretti, C.; Ferretto Parodi, A.; Ferro, F.; Fiascaris, M.; Fiedler, F.; Filipcic, A.; Filippas, A.; Filthaut, F.; Fincke-Keeler, M.; Fiolhais, M.C.N.; Fiorini, L.; Firan, A.; Fischer, G.; Fischer, P.; Fisher, M.J.; Fisher, S.M.; Flammer, J.; Flechl, M.; Fleck, I.; Fleckner, J.; Fleischmann, P.; Fleischmann, S.; Flick, T.; Flores Castillo, L.R.; Flowerdew, M.J.; Fohlisch, F.; Fokitis, M.; Fonseca Martin, T.; Fopma, J.; Forbush, D.A.; Formica, A.; Forti, A.; Fortin, D.; Foster, J.M.; Fournier, D.; Foussat, A.; Fowler, A.J.; Fowler, K.; Fox, H.; Francavilla, P.; Franchino, S.; Francis, D.; Franklin, M.; Franz, S.; Fraternali, M.; Fratina, S.; Freestone, J.; French, S.T.; Froeschl, R.; Froidevaux, D.; Frost, J.A.; Fukunaga, C.; Fullana Torregrosa, E.; Fuster, J.; Gabaldon, C.; Gabizon, O.; Gadfort, T.; Gadomski, S.; Gagliardi, G.; Gagnon, P.; Galea, C.; Gallas, E.J.; Gallas, M.V.; Gallo, V.; Gallop, B.J.; Gallus, P.; Galyaev, E.; Gan, K.K.; Gao, Y.S.; Gapienko, V.A.; Gaponenko, A.; Garcia-Sciveres, M.; Garcia, C.; Garcia Navarro, J.E.; Gardner, R.W.; Garelli, N.; Garitaonandia, H.; Garonne, V.; Garvey, J.; Gatti, C.; Gaudio, G.; Gaumer, O.; Gaur, B.; Gautard, V.; Gauzzi, P.; Gavrilenko, I.L.; Gay, C.; Gaycken, G.; Gayde, J-C.; Gazis, E.N.; Ge, P.; Gee, C.N.P.; Geich-Gimbel, Ch.; Gellerstedt, K.; Gemme, C.; Genest, M.H.; Gentile, S.; Georgatos, F.; George, S.; Gerlach, P.; Gershon, A.; Geweniger, C.; Ghazlane, H.; Ghez, P.; Ghodbane, N.; Giacobbe, B.; Giagu, S.; Giakoumopoulou, V.; Giangiobbe, V.; Gianotti, F.; Gibbard, B.; Gibson, A.; Gibson, S.M.; Gieraltowski, G.F.; Gilbert, L.M.; Gilchriese, M.; Gildemeister, O.; Gilewsky, V.; Gillberg, D.; Gillman, A.R.; Gingrich, D.M.; Ginzburg, J.; Giokaris, N.; Giordani, M.P.; Giordano, R.; Giorgi, F.M.; Giovannini, P.; Giraud, P.F.; Girtler, P.; Giugni, D.; Giusti, P.; Gjelsten, B.K.; Gladilin, L.K.; Glasman, C.; Glatzer, J; Glazov, A.; Glitza, K.W.; Glonti, G.L.; Gnanvo, K.G.; Godfrey, J.; Godlewski, J.; Goebel, M.; Gopfert, T.; Goeringer, C.; Gossling, C.; Gottfert, T.; Goggi, V.; Goldfarb, S.; Goldin, D.; Golling, T.; Gollub, N.P.; Golovnia, S.N.; Gomes, A.; Gomez Fajardo, L.S.; Goncalo, R.; Gonella, L.; Gong, C.; Gonidec, A.; Gonzalez, S.; Gonzalez de la Hoz, S.; Gonzalez Silva, M.L.; Gonzalez-Pineiro, B.; Gonzalez-Sevilla, S.; Goodson, J.J.; Goossens, L.; Gorbounov, P.A.; Gordon, H.A.; Gorelov, I.; Gorfine, G.; Gorini, B.; Gorini, E.; Gorisek, A.; Gornicki, E.; Gorokhov, S.A.; Gorski, B.T.; Goryachev, V.N.; Gosdzik, B.; Gosselink, M.; Gostkin, M.I.; Gouanere, M.; Gough Eschrich, I.; Gouighri, M.; Goujdami, D.; Goulette, M.P.; Goussiou, A.G.; Goy, C.; Grabowska-Bold, I.; Grabski, V.; Grafstrom, P.; Grah, C.; Grahn, K-J.; Grancagnolo, F.; Grancagnolo, S.; Grassi, V.; Gratchev, V.; Grau, N.; Gray, H.M.; Gray, J.A.; Graziani, E.; Grebenyuk, O.G.; Green, B.; Greenfield, D.; Greenshaw, T.; Greenwood, Z.D.; Gregor, I.M.; Grenier, P.; Grewal, A.; Griesmayer, E.; Griffiths, J.; Grigalashvili, N.; Grillo, A.A.; Grimm, K.; Grinstein, S.; Grishkevich, Y.V.; Grivaz, J.F.; Groer, L.S.; Grognuz, J.; Groh, M.; Gross, E.; Grosse-Knetter, J.; Groth-Jensen, J.; Gruwe, M.; Grybel, K.; Guarino, V.J.; Guicheney, C.; Guida, A.; Guillemin, T.; Guindon, S.; Guler, H.; Gunther, J.; Guo, B.; Gupta, A.; Gusakov, Y.; Gushchin, V.N.; Gutierrez, A.; Gutierrez, P.; Guttman, N.; Gutzwiller, O.; Guyot, C.; Gwenlan, C.; Gwilliam, C.B.; Haas, A.; Haas, S.; Haber, C.; Haboubi, G.; Hackenburg, R.; Hadavand, H.K.; Hadley, D.R.; Haeberli, C.; Haefner, P.; Hartel, R.; Hahn, F.; Haider, S.; Hajduk, Z.; Hakobyan, H.; Haller, J.; Hallewell, G.D.; Hamacher, K.; Hamilton, A.; Hamilton, S.; Han, H.; Han, L.; Hanagaki, K.; Hance, M.; Handel, C.; Hanke, P.; Hansen, C.J.; Hansen, J.R.; Hansen, J.B.; Hansen, J.D.; Hansen, P.H.; Hansl-Kozanecka, T.; Hansson, P.; Hara, K.; Hare, G.A.; Harenberg, T.; Harper, R.; Harrington, R.D.; Harris, O.M.; Harrison, K; Hart, J.C.; Hartert, J.; Hartjes, F.; Haruyama, T.; Harvey, A.; Hasegawa, S.; Hasegawa, Y.; Hashemi, K.; Hassani, S.; Hatch, M.; Hauff, D.; Haug, S.; Hauschild, M.; Hauser, R.; Havranek, M.; Hawes, B.M.; Hawkes, C.M.; Hawkings, R.J.; Hawkins, D.; Hayakawa, T.; Hayward, H.S.; Haywood, S.J.; Hazen, E.; He, M.; Head, S.J.; Hedberg, V.; Heelan, L.; Heim, S.; Heinemann, B.; Heisterkamp, S.; Helary, L.; Heldmann, M.; Heller, M.; Hellman, S.; Helsens, C.; Hemperek, T.; Henderson, R.C.W.; Hendriks, P.J.; Henke, M.; Henrichs, A.; Henriques Correia, A.M.; Henrot-Versille, S.; Henry-Couannier, F.; Hensel, C.; Henss, T.; Hernandez Jimenez, Y.; Hershenhorn, A.D.; Herten, G.; Hertenberger, R.; Hervas, L.; Hessey, N.P.; Hidvegi, A.; Higon-Rodriguez, E.; Hill, D.; Hill, J.C.; Hill, N.; Hiller, K.H.; Hillert, S.; Hillier, S.J.; Hinchliffe, I.; Hindson, D.; Hines, E.; Hirose, M.; Hirsch, F.; Hirschbuehl, D.; Hobbs, J.; Hod, N.; Hodgkinson, M.C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M.R.; Hoffman, J.; Hoffmann, D.; Hohlfeld, M.; Holder, M.; Hollins, T.I.; Holmes, A.; Holmgren, S.O.; Holy, T.; Holzbauer, J.L.; Homer, R.J.; Homma, Y.; Horazdovsky, T.; Horn, C.; Horner, S.; Horton, K.; Hostachy, J-Y.; Hott, T.; Hou, S.; Houlden, M.A.; Hoummada, A.; Howell, D.F.; Hrivnac, J.; Hruska, I.; Hryn'ova, T.; Hsu, P.J.; Hsu, S.C.; Huang, G.S.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T.B.; Hughes, E.W.; Hughes, G.; Hughes-Jones, R.E.; Huhtinen, M.; Hurst, P.; Hurwitz, M.; Husemann, U.; Huseynov, N.; Huston, J.; Huth, J.; Iacobucci, G.; Iakovidis, G.; Ibbotson, M.; Ibragimov, I.; Ichimiya, R.; Iconomidou-Fayard, L.; Idarraga, J.; Idzik, M.; Iengo, P.; Igonkina, O.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Imbault, D.; Imhaeuser, M.; Imori, M.; Ince, T.; Inigo-Golfin, J.; Ioannou, P.; Iodice, M.; Ionescu, G.; Irles Quiles, A.; Ishii, K.; Ishikawa, A.; Ishino, M.; Ishmukhametov, R.; Isobe, T.; Issever, C.; Istin, S.; Itoh, Y.; Ivashin, A.V.; Iwanski, W.; Iwasaki, H.; Izen, J.M.; Izzo, V.; Jackson, B.; Jackson, J.N.; Jackson, P.; Jaekel, M.R.; Jahoda, M.; Jain, V.; Jakobs, K.; Jakobsen, S.; Jakubek, J.; Jana, D.K.; Jankowski, E.; Jansen, E.; Jantsch, A.; Janus, M.; Jared, R.C.; Jarlskog, G.; Jeanty, L.; Jelen, K.; Jen-La Plante, I.; Jenni, P.; Jeremie, A.; Jez, P.; Jezequel, S.; Ji, H.; Ji, W.; Jia, J.; Jiang, Y.; Jimenez Belenguer, M.; Jin, G.; Jin, S.; Jinnouchi, O.; Joergensen, M.D.; Joffe, D.; Johansen, L.G.; Johansen, M.; Johansson, K.E.; Johansson, P.; Johnert, S.; Johns, K.A.; Jon-And, K.; Jones, G.; Jones, M.; Jones, R.W.L.; Jones, T.W.; Jones, T.J.; Jonsson, O.; Joo, K.K.; Joos, D.; Joram, C.; Jorge, P.M.; Jorgensen, S.; Joseph, J.; Juranek, V.; Jussel, P.; Kabachenko, V.V.; Kabana, S.; Kaci, M.; Kaczmarska, A.; Kadlecik, P.; Kado, M.; Kagan, H.; Kagan, M.; Kaiser, S.; Kajomovitz, E.; Kalinin, S.; Kalinovskaya, L.V.; Kama, S.; Kanaya, N.; Kaneda, M.; Kantserov, V.A.; Kanzaki, J.; Kaplan, B.; Kapliy, A.; Kaplon, J.; Kar, D.; Karagounis, M.; Karagoz, M.; Karnevskiy, M.; Karr, K.; Kartvelishvili, V.; Karyukhin, A.N.; Kashif, L.; Kasmi, A.; Kass, R.D.; Kastanas, A.; Kataoka, M.; Kataoka, Y.; Katsoufis, E.; Katzy, J.; Kaushik, V.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kayl, M.S.; Kayumov, F.; Kazanin, V.A.; Kazarinov, M.Y.; Kazi, S.I.; Keates, J.R.; Keeler, R.; Keener, P.T.; Kehoe, R.; Keil, M.; Kekelidze, G.D.; Kelly, M.; Kennedy, J.; Kenney, C.J.; Kenyon, M.; Kepka, O.; Kerschen, N.; Kersevan, B.P.; Kersten, S.; Kessoku, K.; Ketterer, C.; Khakzad, M.; Khalil-zada, F.; Khandanyan, H.; Khanov, A.; Kharchenko, D.; Khodinov, A.; Kholodenko, A.G.; Khomich, A.; Khoriauli, G.; Khovanskiy, N.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kilvington, G.; Kim, H.; Kim, M.S.; Kim, P.C.; Kim, S.H.; Kimura, N.; Kind, O.; Kind, P.; King, B.T.; King, M.; Kirk, J.; Kirsch, G.P.; Kirsch, L.E.; Kiryunin, A.E.; Kisielewska, D.; Kisielewski, B.; Kittelmann, T.; Kiver, A.M.; Kiyamura, H.; Kladiva, E.; Klaiber-Lodewigs, J.; Klein, M.; Klein, U.; Kleinknecht, K.; Klemetti, M.; Klier, A.; Klimentov, A.; Klingenberg, R.; Klinkby, E.B.; Klioutchnikova, T.; Klok, P.F.; Klous, S.; Kluge, E.E.; Kluge, T.; Kluit, P.; Kluth, S.; Knecht, N.S.; Kneringer, E.; Knobloch, J.; Ko, B.R.; Kobayashi, T.; Kobel, M.; Koblitz, B.; Kocian, M.; Kocnar, A.; Kodys, P.; Koneke, K.; Konig, A.C.; Koenig, S.; Konig, S.; Kopke, L.; Koetsveld, F.; Koevesarki, P.; Koffas, T.; Koffeman, E.; Kohn, F.; Kohout, Z.; Kohriki, T.; Koi, T.; Kokott, T.; Kolachev, G.M.; Kolanoski, H.; Kolesnikov, V.; Koletsou, I.; Koll, J.; Kollar, D.; Kollefrath, M.; Kolos, S.; Kolya, S.D.; Komar, A.A.; Komaragiri, J.R.; Kondo, T.; Kono, T.; Kononov, A.I.; Konoplich, R.; Konovalov, S.P.; Konstantinidis, N.; Kootz, A.; Koperny, S.; Kopikov, S.V.; Korcyl, K.; Kordas, K.; Koreshev, V.; Korn, A.; Korol, A.; Korolkov, I.; Korolkova, E.V.; Korotkov, V.A.; Kortner, O.; Kortner, S.; Kostyukhin, V.V.; Kotamaki, M.J.; Kotov, S.; Kotov, V.M.; Kotov, K.Y.; Kourkoumelis, C.; Koutsman, A.; Kowalewski, R.; Kowalski, H.; Kowalski, T.Z.; Kozanecki, W.; Kozhin, A.S.; Kral, V.; Kramarenko, V.A.; Kramberger, G.; Krasel, O.; Krasny, M.W.; Krasznahorkay, A.; Kraus, J.; Kreisel, A.; Krejci, F.; Kretzschmar, J.; Krieger, N.; Krieger, P.; Krobath, G.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Kruger, H.; Krumshteyn, Z.V.; Kruth, A.; Kubota, T.; Kuehn, S.; Kugel, A.; Kuhl, T.; Kuhn, D.; Kukhtin, V.; Kulchitsky, Y.; Kuleshov, S.; Kummer, C.; Kuna, M.; Kundu, N.; Kunkle, J.; Kupco, A.; Kurashige, H.; Kurata, M.; Kurchaninov, L.L.; Kurochkin, Y.A.; Kus, V.; Kuykendall, W.; Kuze, M.; Kuzhir, P.; Kvasnicka, O.; Kwee, R.; La Rosa, A.; La Rotonda, L.; Labarga, L.; Labbe, J.; Lacasta, C.; Lacava, F.; Lacker, H.; Lacour, D.; Lacuesta, V.R.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lamanna, M.; Lambacher, M.; Lampen, C.L.; Lampl, W.; Lancon, E.; Landgraf, U.; Landon, M.P.J.; Landsman, H.; Lane, J.L.; Lange, C.; Lankford, A.J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Lapin, V.V.; Laplace, S.; Lapoire, C.; Laporte, J.F.; Lari, T.; Larionov, A.V.; Larner, A.; Lasseur, C.; Lassnig, M.; Lau, W.; Laurelli, P.; Lavorato, A.; Lavrijsen, W.; Laycock, P.; Lazarev, A.B.; Lazzaro, A.; Le Dortz, O.; Le Guirriec, E.; Le Maner, C.; Le Menedeu, E.; Le Vine, M.; Leahu, M.; Lebedev, A.; Lebel, C.; Lechowski, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, H.; Lee, J.S.H.; Lee, S.C.; Lefebvre, M.; Legendre, M.; Leger, A.; LeGeyt, B.C.; Legger, F.; Leggett, C.; Lehmacher, M.; Lehmann Miotto, G.; Lehto, M.; Lei, X.; Leite, M.A.L.; Leitner, R.; Lellouch, D.; Lellouch, J.; Leltchouk, M.; Lendermann, V.; Leney, K.J.C.; Lenz, T.; Lenzen, G.; Lenzi, B.; Leonhardt, K.; Lepidis, J.; Leroy, C.; Lessard, J-R.; Lesser, J.; Lester, C.G.; Leung Fook Cheong, A.; Leveque, J.; Levin, D.; Levinson, L.J.; Levitski, M.S.; Lewandowska, M.; Leyton, M.; Li, B.; Li, H.; Li, X.; Liang, Z.; Liang, Z.; Liberti, B.; Lichard, P.; Lichtnecker, M.; Lie, K.; Liebig, W.; Lifshitz, R.; Lilley, J.N.; Lim, H.; Limosani, A.; Limper, M.; Lin, S.C.; Linde, F.; Linnemann, J.T.; Lipeles, E.; Lipinsky, L.; Lipniacka, A.; Liss, T.M.; Lissauer, D.; Lister, A.; Litke, A.M.; Liu, C.; Liu, D.; Liu, H.; Liu, J.B.; Liu, M.; Liu, S.; Liu, T.; Liu, Y.; Livan, M.; Livermore, S.S.A.; Lleres, A.; Lloyd, S.L.; Lobodzinska, E.; Loch, P.; Lockman, W.S.; Lockwitz, S.; Loddenkoetter, T.; Loebinger, F.K.; Loginov, A.; Loh, C.W.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Loken, J.; Long, R.E.; Lopes, L.; Lopez Mateos, D.; Losada, M.; Loscutoff, P.; Losty, M.J.; Lou, X.; Lounis, A.; Loureiro, K.F.; Lovas, L.; Love, J.; Love, P.A.; Lowe, A.J.; Lu, F.; Lu, J.; Lu, L.; Lubatti, H.J.; Luci, C.; Lucotte, A.; Ludwig, A.; Ludwig, D.; Ludwig, I.; Ludwig, J.; Luehring, F.; Luijckx, G.; Lumb, D.; Luminari, L.; Lund, E.; Lund-Jensen, B.; Lundberg, B.; Lundberg, J.; Lundquist, J.; Lungwitz, M.; Lupi, A.; Lutz, G.; Lynn, D.; Lynn, J.; Lys, J.; Lytken, E.; Ma, H.; Ma, L.L.; Maass en, M.; Macana Goia, J.A.; Maccarrone, G.; Macchiolo, A.; Macek, B.; Machado Miguens, J.; Macina, D.; Mackeprang, R.; MacQueen, D.; Madaras, R.J.; Mader, W.F.; Maenner, R.; Maeno, T.; Mattig, P.; Mattig, S.; Magalhaes Martins, P.J.; Magnoni, L.; Magradze, E.; Magrath, C.A.; Mahalalel, Y.; Mahboubi, K.; Mahmood, A.; Mahout, G.; Maiani, C.; Maidantchik, C.; Maio, A.; Majewski, S.; Makida, Y.; Makouski, M.; Makovec, N.; Mal, P.; Malecki, Pa.; Malecki, P.; Maleev, V.P.; Malek, F.; Mallik, U.; Malon, D.; Maltezos, S.; Malyshev, V.; Malyukov, S.; Mambelli, M.; Mameghani, R.; Mamuzic, J.; Manabe, A.; Manara, A.; Mandelli, L.; Mandic, I.; Mandrysch, R.; Maneira, J.; Mangeard, P.S.; Mangin-Brinet, M.; Manjavidze, I.D.; Mann, A.; Mann, W.A.; Manning, P.M.; Manousakis-Katsikakis, A.; Mansoulie, B.; Manz, A.; Mapelli, A.; Mapelli, L.; March, L.; Marchand, J.F.; Marchese, F.; Marchesotti, M.; Marchiori, G.; Marcisovsky, M.; Marin, A.; Marino, C.P.; Marroquim, F.; Marshall, R.; Marshall, Z.; Martens, F.K.; Marti-Garcia, S.; Martin, A.J.; Martin, A.J.; Martin, B.; Martin, B.; Martin, F.F.; Martin, J.P.; Martin, Ph.; Martin, T.A.; Martin dit Latour, B.; Martinez, M.; Martinez Outschoorn, V.; Martini, A.; Martyniuk, A.C.; Marzano, F.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A.L.; Mass, M.; Massa, I.; Massaro, G.; Massol, N.; Mastroberardino, A.; Masubuchi, T.; Mathes, M.; Matricon, P.; Matsumoto, H.; Matsunaga, H.; Matsushita, T.; Mattravers, C.; Maugain, J.M.; Maxfield, S.J.; May, E.N.; Mayer, J.K.; Mayne, A.; Mazini, R.; Mazur, M.; Mazzanti, M.; Mazzoni, E.; Mc Donald, J.; Mc Kee, S.P.; McCarn, A.; McCarthy, R.L.; McCarthy, T.G.; McCubbin, N.A.; McFarlane, K.W.; McGarvie, S.; McGlone, H.; Mchedlidze, G.; McLaren, R.A.; McMahon, S.J.; McMahon, T.R.; McMahon, T.J.; McPherson, R.A.; Meade, A.; Mechnich, J.; Mechtel, M.; Medinnis, M.; Meera-Lebbai, R.; Meguro, T.; Mehdiyev, R.; Mehlhase, S.; Mehta, A.; Meier, K.; Meinhardt, J.; Meirose, B.; Melachrinos, C.; Mellado Garcia, B.R.; Mendoza Navas, L.; Meng, Z.; Mengarelli, A.; Menke, S.; Menot, C.; Meoni, E.; Merkl, D.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F.S.; Messina, A.M.; Messmer, I.; Metcalfe, J.; Mete, A.S.; Meuser, S.; Meyer, C.; Meyer, J-P.; Meyer, J.; Meyer, J.; Meyer, T.C.; Meyer, W.T.; Miao, J.; Michal, S.; Micu, L.; Middleton, R.P.; Miele, P.; Migas, S.; Migliaccio, A.; Mijovic, L.; Mikenberg, G.; Mikestikova, M.; Mikulec, B.; Mikuz, M.; Miller, D.W.; Miller, R.J.; Mills, W.J.; Mills, C.; Milov, A.; Milstead, D.A.; Milstein, D.; Mima, S.; Minaenko, A.A.; Minano, M.; Minashvili, I.A.; Mincer, A.I.; Mindur, B.; Mineev, M.; Ming, Y.; Mir, L.M.; Mirabelli, G.; Miralles Verge, L.; Misawa, S.; Miscetti, S.; Misiejuk, A.; Mitra, A.; Mitrevski, J.; Mitrofanov, G.Y.; Mitsou, V.A.; Mitsui, S.; Miyagawa, P.S.; Miyazaki, K.; Mjornmark, J.U.; Mladenov, D.; Moa, T.; Moch, M.; Mockett, P.; Moed, S.; Moeller, V.; Monig, K.; Moser, N.; Mohn, B.; Mohr, W.; Mohrdieck-Mock, S.; Moisseev, A.M.; Moles-Valls, R.; Molina-Perez, J.; Moneta, L.; Monk, J.; Monnier, E.; Montesano, S.; Monticelli, F.; Moore, R.W.; Moorhead, G.F.; Mora Herrera, C.; Moraes, A.; Morais, A.; Morel, J.; Morello, G.; Moreno, D.; Moreno Llacer, M.; Morettini, P.; Morgan, D.; Morii, M.; Morin, J.; Morita, Y.; Morley, A.K.; Mornacchi, G.; Morone, M-C.; Morozov, S.V.; Morris, J.D.; Moser, H.G.; Mosidze, M.; Moss, J.; Moszczynski, A.; Mount, R.; Mountricha, E.; Mouraviev, S.V.; Moye, T.H.; Moyse, E.J.W.; Mudrinic, M.; Mueller, F.; Mueller, J.; Mueller, K.; Muller, T.A.; Muenstermann, D.; Muijs, A.; Muir, A.; Munar, A.; Munwes, Y.; Murakami, K.; Murillo Garcia, R.; Murray, W.J.; Mussche, I.; Musto, E.; Myagkov, A.G.; Myska, M.; Nadal, J.; Nagai, K.; Nagano, K.; Nagasaka, Y.; Nairz, A.M.; Naito, D.; Nakamura, K.; Nakano, I.; Nanava, G.; Napier, A.; Nash, M.; Nasteva, I.; Nation, N.R.; Nattermann, T.; Naumann, T.; Nauyock, F.; Navarro, G.; Nderitu, S.K.; Neal, H.A.; Nebot, E.; Nechaeva, P.; Negri, A.; Negri, G.; Nelson, A.; Nelson, S.; Nelson, T.K.; Nemecek, S.; Nemethy, P.; Nepomuceno, A.A.; Nessi, M.; Nesterov, S.Y.; Neubauer, M.S.; Neukermans, L.; Neusiedl, A.; Neves, R.M.; Nevski, P.; Newcomer, F.M.; Nicholson, C.; Nickerson, R.B.; Nicolaidou, R.; Nicolas, L.; Nicoletti, G.; Nicquevert, B.; Niedercorn, F.; Nielsen, J.; Niinikoski, T.; Nikiforov, A.; Nikolaenko, V.; Nikolaev, K.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsen, H.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nishiyama, T.; Nisius, R.; Nodulman, L.; Nomachi, M.; Nomidis, I.; Nomoto, H.; Nordberg, M.; Nordkvist, B.; Norniella Francisco, O.; Norton, P.R.; Notz, D.; Novakova, J.; Nozaki, M.; Nozicka, M.; Nugent, I.M.; Nuncio-Quiroz, A.E.; Nunes Hanninger, G.; Nunnemann, T.; Nurse, E.; Nyman, T.; O'Neale, S.W.; O'Neil, D.C.; O'Shea, V.; Oakham, F.G.; Oberlack, H.; Ocariz, J.; Ochi, A.; Oda, S.; Odaka, S.; Odier, J.; Odino, G.A.; Ogren, H.; Oh, A.; Oh, S.H.; Ohm, C.C.; Ohshima, T.; Ohshita, H.; Ohska, T.K.; Ohsugi, T.; Okada, S.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olcese, M.; Olchevski, A.G.; Oliveira, M.; Oliveira Damazio, D.; Oliver, C.; Oliver, J.; Oliver Garcia, E.; Olivito, D.; Olszewski, A.; Olszowska, J.; Omachi, C.; Onofre, A.; Onyisi, P.U.E.; Oram, C.J.; Ordonez, G.; Oreglia, M.J.; Orellana, F.; Oren, Y.; Orestano, D.; Orlov, I.; Oropeza Barrera, C.; Orr, R.S.; Ortega, E.O.; Osculati, B.; Ospanov, R.; Osuna, C.; Otero y Garzon, G.; Ottersbach, J.P; Ottewell, B.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Ouyang, Q.; Owen, M.; Owen, S.; Oyarzun, A; Oye, O.K.; Ozcan, V.E.; Ozone, K.; Ozturk, N.; Pacheco Pages, A.; Padilla Aranda, C.; Paganis, E.; Paige, F.; Pajchel, K.; Palestini, S.; Palla, J.; Pallin, D.; Palma, A.; Palmer, J.D.; Palmer, M.J.; Pan, Y.B.; Panagiotopoulou, E.; Panes, B.; Panikashvili, N.; Panin, V.N.; Panitkin, S.; Pantea, D.; Panuskova, M.; Paolone, V.; Paoloni, A.; Papadopoulou, Th.D.; Paramonov, A.; Park, S.J.; Park, W.; Parker, M.A.; Parker, S.I.; Parodi, F.; Parsons, J.A.; Parzefall, U.; Pasqualucci, E.; Passeri, A.; Pastore, F.; Pastore, Fr.; Pasztor, G.; Pataraia, S.; Patel, N.; Pater, J.R.; Patricelli, S.; Pauly, T.; Peak, L.S.; Pecsy, M.; Pedraza Morales, M.I.; Peeters, S.J.M.; Peleganchuk, S.V.; Peng, H.; Pengo, R.; Penson, A.; Penwell, J.; Perantoni, M.; Perez, K.; Perez Codina, E.; Perez Garcia-Estan, M.T.; Perez Reale, V.; Peric, I.; Perini, L.; Pernegger, H.; Perrino, R.; Perrodo, P.; Persembe, S.; Perus, P.; Peshekhonov, V.D.; Petereit, E.; Peters, O.; Petersen, B.A.; Petersen, J.; Petersen, T.C.; Petit, E.; Petridis, A.; Petridou, C.; Petrolo, E.; Petrucci, F.; Petschull, D; Petteni, M.; Pezoa, R.; Pfeifer, B.; Phan, A.; Phillips, A.W.; Phillips, P.W.; Piacquadio, G.; Piccaro, E.; Piccinini, M.; Pickford, A.; Piegaia, R.; Pilcher, J.E.; Pilkington, A.D.; Pina, J.; Pinamonti, M.; Pinfold, J.L.; Ping, J.; Pinto, B.; Pirotte, O.; Pizio, C.; Placakyte, R.; Plamondon, M.; Plano, W.G.; Pleier, M.A.; Pleskach, A.V.; Poblaguev, A.; Poddar, S.; Podlyski, F.; Poffenberger, P.; Poggioli, L.; Poghosyan, T.; Pohl, M.; Polci, F.; Polesello, G.; Policicchio, A.; Polini, A.; Poll, J.; Polychronakos, V.; Pomarede, D.M.; Pomeroy, D.; Pommes, K.; Ponsot, P.; Pontecorvo, L.; Pope, B.G.; Popeneciu, G.A.; Popescu, R.; Popovic, D.S.; Poppleton, A.; Popule, J.; Portell Bueso, X.; Porter, R.; Posch, C.; Pospelov, G.E.; Pospisil, S.; Potekhin, M.; Potrap, I.N.; Potter, C.J.; Potter, C.T.; Potter, K.P.; Poulard, G.; Poveda, J.; Prabhu, R.; Pralavorio, P.; Prasad, S.; Prata, M.; Pravahan, R.; Prell, S.; Pretzl, K.; Pribyl, L.; Price, D.; Price, L.E.; Price, M.J.; Prichard, P.M.; Prieur, D.; Primavera, M.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Prudent, X.; Przysiezniak, H.; Psoroulas, S.; Ptacek, E.; Puigdengoles, C.; Purdham, J.; Purohit, M.; Puzo, P.; Pylypchenko, Y.; Qi, M.; Qian, J.; Qian, W.; Qian, Z.; Qin, Z.; Qing, D.; Quadt, A.; Quarrie, D.R.; Quayle, W.B.; Quinonez, F.; Raas, M.; Radeka, V.; Radescu, V.; Radics, B.; Rador, T.; Ragusa, F.; Rahal, G.; Rahimi, A.M.; Rahm, D.; Raine, C.; Raith, B.; Rajagopalan, S.; Rajek, S.; Rammensee, M.; Rammes, M.; Ramstedt, M.; Ratoff, P.N.; Rauscher, F.; Rauter, E.; Raymond, M.; Read, A.L.; Rebuzzi, D.M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reeves, K.; Reichold, A.; Reinherz-Aronis, E.; Reinsch, A; Reisinger, I.; Reljic, D.; Rembser, C.; Ren, Z.L.; Renkel, P.; Rensch, B.; Rescia, S.; Rescigno, M.; Resconi, S.; Resende, B.; Reznicek, P.; Rezvani, R.; Richards, A.; Richards, R.A.; Richter, R.; Richter-Was, E.; Ridel, M.; Rieke, S.; Rijpstra, M.; Rijssenbeek, M.; Rimoldi, A.; Rinaldi, L.; Rios, R.R.; Riu, I.; Rivoltella, G.; Rizatdinova, F.; Rizvi, E.; Roa Romero, D.A.; Robertson, S.H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, JEM; Robinson, M.; Robson, A.; Rocha de Lima, J.G.; Roda, C.; Roda Dos Santos, D.; Rodier, S.; Rodriguez, D.; Rodriguez Garcia, Y.; Roe, A.; Roe, S.; Rohne, O.; Rojo, V.; Rolli, S.; Romaniouk, A.; Romanov, V.M.; Romeo, G.; Romero Maltrana, D.; Roos, L.; Ros, E.; Rosati, S.; Rosenbaum, G.A.; Rosenberg, E.I.; Rosendahl, P.L.; Rosselet, L.; Rossetti, V.; Rossi, E.; Rossi, L.P.; Rossi, L.; Rotaru, M.; Rothberg, J.; Rottlander, I.; Rousseau, D.; Royon, C.R.; Rozanov, A.; Rozen, Y.; Ruan, X.; Ruckert, B.; Ruckstuhl, N.; Rud, V.I.; Rudolph, G.; Ruhr, F.; Ruggieri, F.; Ruiz-Martinez, A.; Rulikowska-Zarebska, E.; Rumiantsev, V.; Rumyantsev, L.; Runge, K.; Runolfsson, O.; Rurikova, Z.; Rusakovich, N.A.; Rust, D.R.; Rutherfoord, J.P.; Ruwiedel, C.; Ruzicka, P.; Ryabov, Y.F.; Ryadovikov, V.; Ryan, P.; Rybkin, G.; Rzaeva, S.; Saavedra, A.F.; Sadeh, I.; Sadrozinski, H.F-W.; Sadykov, R.; Safai Tehrani, F.; Sakamoto, H.; Sala, P.; Salamanna, G.; Salamon, A.; Saleem, M.; Salihagic, D.; Salnikov, A.; Salt, J.; Salvachua Ferrando, B.M.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sampsonidis, D.; Samset, B.H.; Sandaker, H.; Sander, H.G.; Sanders, M.P.; Sandhoff, M.; Sandhu, P.; Sandoval, T.; Sandstroem, R.; Sandvoss, S.; Sankey, D.P.C.; Sanny, B.; Sansoni, A.; Santamarina Rios, C.; Santoni, C.; Santonico, R.; Santos, H.; Saraiva, J.G.; Sarangi, T.; Sarkisyan-Grinbaum, E.; Sarri, F.; Sartisohn, G.; Sasaki, O.; Sasaki, T.; Sasao, N.; Satsounkevitch, I.; Sauvage, G.; Savard, P.; Savine, A.Y.; Savinov, V.; Savva, P.; Sawyer, L.; Saxon, D.H.; Says, L.P.; Sbarra, C.; Sbrizzi, A.; Scallon, O.; Scannicchio, D.A.; Schaarschmidt, J.; Schacht, P.; Schafer, U.; Schaetzel, S.; Schaffer, A.C.; Schaile, D.; Schaller, M.; Schamberger, R.D.; Schamov, A.G.; Scharf, V.; Schegelsky, V.A.; Scheirich, D.; Schernau, M.; Scherzer, M.I.; Schiavi, C.; Schieck, J.; Schioppa, M.; Schlenker, S.; Schlereth, J.L.; Schmidt, E.; Schmidt, M.P.; Schmieden, K.; Schmitt, C.; Schmitz, M.; Scholte, R.C.; Schoning, A.; Schott, M.; Schouten, D.; Schovancova, J.; Schram, M.; Schreiner, A.; Schroeder, C.; Schroer, N.; Schroers, M.; Schroff, D.; Schuh, S.; Schuler, G.; Schultes, J.; Schultz-Coulon, H.C.; Schumacher, J.W.; Schumacher, M.; Schumm, B.A.; Schune, Ph.; Schwanenberger, C.; Schwartzman, A.; Schweiger, D.; Schwemling, Ph.; Schwienhorst, R.; Schwierz, R.; Schwindling, J.; Scott, W.G.; Searcy, J.; Sedykh, E.; Segura, E.; Seidel, S.C.; Seiden, A.; Seifert, F.; Seixas, J.M.; Sekhniaidze, G.; Seliverstov, D.M.; Sellden, B.; Sellers, G.; Seman, M.; Semprini-Cesari, N.; Serfon, C.; Serin, L.; Seuster, R.; Severini, H.; Sevior, M.E.; Sfyrla, A.; Shabalina, E.; Shamim, M.; Shan, L.Y.; Shank, J.T.; Shao, Q.T.; Shapiro, M.; Shatalov, P.B.; Shaver, L.; Shaw, C.; Shaw, K.; Sherman, D.; Sherwood, P.; Shibata, A.; Shield, P.; Shimizu, S.; Shimojima, M.; Shin, T.; Shmeleva, A.; Shochet, M.J.; Shupe, M.A.; Sicho, P.; Sidoti, A.; Siebel, A.; Siegert, F; Siegrist, J.; Sijacki, Dj.; Silbert, O.; Silva, J.; Silver, Y.; Silverstein, D.; Silverstein, S.B.; Simak, V.; Simic, Lj.; Simion, S.; Simmons, B.; Simonyan, M.; Sinervo, P.; Sinev, N.B.; Sipica, V.; Siragusa, G.; Sisakyan, A.N.; Sivoklokov, S.Yu.; Sjolin, J.; Sjursen, T.B.; Skinnari, L.A.; Skovpen, K.; Skubic, P.; Skvorodnev, N.; Slater, M.; Slavicek, T.; Sliwa, K.; Sloan, T.J.; Sloper, J.; Smakhtin, V.; Smirnov, S.Yu.; Smirnov, Y.; Smirnova, L.N.; Smirnova, O.; Smith, B.C.; Smith, D.; Smith, K.M.; Smizanska, M.; Smolek, K.; Snesarev, A.A.; Snow, S.W.; Snow, J.; Snuverink, J.; Snyder, S.; Soares, M.; Sobie, R.; Sodomka, J.; Soffer, A.; Solans, C.A.; Solar, M.; Solc, J.; Solfaroli Camillocci, E.; Solodkov, A.A.; Solovyanov, O.V.; Soluk, R.; Sondericker, J.; Soni, N.; Sopko, V.; Sopko, B.; Sorbi, M.; Sosebee, M.; Soukharev, A.; Spagnolo, S.; Spano, F.; Speckmayer, P.; Spencer, E.; Spighi, R.; Spigo, G.; Spila, F.; Spiriti, E.; Spiwoks, R.; Spogli, L.; Spousta, M.; Spreitzer, T.; Spurlock, B.; St. Denis, R.D.; Stahl, T.; Stahlman, J.; Stamen, R.; Stancu, S.N.; Stanecka, E.; Stanek, R.W.; Stanescu, C.; Stapnes, S.; Starchenko, E.A.; Stark, J.; Staroba, P.; Starovoitov, P.; Stastny, J.; Staude, A.; Stavina, P.; Stavropoulos, G.; Steele, G.; Stefanidis, E.; Steinbach, P.; Steinberg, P.; Stekl, I.; Stelzer, B.; Stelzer, H.J.; Stelzer-Chilton, O.; Stenzel, H.; Stevenson, K.; Stewart, G.A.; Stiller, W.; Stockmanns, T.; Stockton, M.C.; Stodulski, M.; Stoerig, K.; Stoicea, G.; Stonjek, S.; Strachota, P.; Stradling, A.R.; Straessner, A.; Strandberg, J.; Strandberg, S.; Strandlie, A.; Strang, M.; Strauss, M.; Strizenec, P.; Strohmer, R.; Strom, D.M.; Strong, J.A.; Stroynowski, R.; Strube, J.; Stugu, B.; Stumer, I.; Stupak, J.; Sturm, P.; Soh, D.A.; Su, D.; Sugaya, Y.; Sugimoto, T.; Suhr, C.; Suita, K.; Suk, M.; Sulin, V.V.; Sultansoy, S.; Sumida, T.; Sun, X.H.; Sundermann, J.E.; Suruliz, K.; Sushkov, S.; Susinno, G.; Sutton, M.R.; Suzuki, Y.; Sviridov, Yu.M.; Swedish, S.; Sykora, I.; Sykora, T.; Szczygiel, R.R.; Szeless, B.; Szymocha, T.; Sanchez, J.; Ta, D.; Taboada Gameiro, S.; Tackmann, K.; Taffard, A.; Tafirout, R.; Taga, A.; Takahashi, Y.; Takai, H.; Takashima, R.; Takeda, H.; Takeshita, T.; Talby, M.; Talyshev, A.; Tamsett, M.C.; Tanaka, J.; Tanaka, R.; Tanaka, S.; Tanaka, S.; Tanaka, Y.; Tani, K.; Tappern, G.P.; Tapprogge, S.; Tardif, D.; Tarem, S.; Tarrade, F.; Tartarelli, G.F.; Tas, P.; Tasevsky, M.; Tassi, E.; Tatarkhanov, M.; Taylor, C.; Taylor, F.E.; Taylor, G.; Taylor, G.N.; Taylor, R.P.; Taylor, W.; Teixeira Dias Castanheira, M.; Teixeira-Dias, P.; Temming, K.K.; Ten Kate, H.; Teng, P.K.; Tennenbaum-Katan, Y.D.; Terada, S.; Terashi, K.; Terron, J.; Terwort, M.; Testa, M.; Teuscher, R.J.; Tevlin, C.M.; Thadome, J.; Therhaag, J.; Theveneaux-Pelzer, T.; Thioye, M.; Thoma, S.; Thomas, J.P.; Thompson, E.N.; Thompson, P.D.; Thompson, P.D.; Thompson, R.J.; Thompson, A.S.; Thomson, E.; Thomson, M.; Thun, R.P.; Tic, T.; Tikhomirov, V.O.; Tikhonov, Y.A.; Timmermans, C.J.W.P.; Tipton, P.; Tique Aires Viegas, F.J.; Tisserant, S.; Tobias, J.; Toczek, B.; Todorov, T.; Todorova-Nova, S.; Toggerson, B.; Tojo, J.; Tokar, S.; Tokunaga, K.; Tokushuku, K.; Tollefson, K.; Tomasek, L.; Tomasek, M.; Tomoto, M.; Tompkins, D.; Tompkins, L.; Toms, K.; Tonazzo, A.; Tong, G.; Tonoyan, A.; Topfel, C.; Topilin, N.D.; Torchiani, I.; Torrence, E.; Torro Pastor, E.; Toth, J.; Touchard, F.; Tovey, D.R.; Traynor, D.; Trefzger, T.; Treis, J.; Tremblet, L.; Tricoli, A.; Trigger, I.M.; Trincaz-Duvoid, S.; Trinh, T.N.; Tripiana, M.F.; Triplett, N.; Trischuk, W.; Trivedi, A.; Trocme, B.; Troncon, C.; Trottier-McDonald, M.; Trzupek, A.; Tsarouchas, C.; Tseng, J.C-L.; Tsiakiris, M.; Tsiareshka, P.V.; Tsionou, D.; Tsipolitis, G.; Tsiskaridze, V.; Tskhadadze, E.G.; Tsukerman, I.I.; Tsulaia, V.; Tsung, J.W.; Tsuno, S.; Tsybychev, D.; Tuggle, J.M.; Turala, M.; Turecek, D.; Turk Cakir, I.; Turlay, E.; Tuts, P.M.; Twomey, M.S.; Tylmad, M.; Tyndel, M.; Typaldos, D.; Tyrvainen, H.; Tzamarioudaki, E.; Tzanakos, G.; Uchida, K.; Ueda, I.; Ueno, R.; Ugland, M.; Uhlenbrock, M.; Uhrmacher, M.; Ukegawa, F.; Unal, G.; Underwood, D.G.; Undrus, A.; Unel, G.; Unno, Y.; Urbaniec, D.; Urkovsky, E.; Urquijo, P.; Urrejola, P.; Usai, G.; Uslenghi, M.; Vacavant, L.; Vacek, V.; Vachon, B.; Vahsen, S.; Valderanis, C.; Valenta, J.; Valente, P.; Valentinetti, S.; Valkar, S.; Valladolid Gallego, E.; Vallecorsa, S.; Valls Ferrer, J.A.; Van Berg, R.; van der Graaf, H.; van der Kraaij, E.; van der Poel, E.; van der Ster, D.; Van Eijk, B.; van Eldik, N.; van Gemmeren, P.; van Kesteren, Z.; van Vulpen, I.; Vandelli, W.; Vandoni, G.; Vaniachine, A.; Vankov, P.; Vannucci, F.; Varela Rodriguez, F.; Vari, R.; Varnes, E.W.; Varouchas, D.; Vartapetian, A.; Varvell, K.E.; Vasilyeva, L.; Vassilakopoulos, V.I.; Vazeille, F.; Vegni, G.; Veillet, J.J.; Vellidis, C.; Veloso, F.; Veness, R.; Veneziano, S.; Ventura, A.; Ventura, D.; Ventura, S.; Venturi, M.; Venturi, N.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, J.C.; Vertogardov, L.; Vetterli, M.C.; Vichou, I.; Vickey, T.; Viehhauser, G.H.A.; Viel, S.; Villa, M.; Villani, E.G.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M.G.; Vinek, E.; Vinogradov, V.B.; Virchaux, M.; Viret, S.; Virzi, J.; Vitale, A.; Vitells, O.; Vivarelli, I.; Vives Vaque, F.; Vlachos, S.; Vlasak, M.; Vlasov, N.; Vogel, A.; Vokac, P.; Volpi, M.; Volpini, G.; von der Schmitt, H.; von Loeben, J.; von Radziewski, H.; von Toerne, E.; Vorobel, V.; Vorobiev, A.P.; Vorwerk, V.; Vos, M.; Voss, R.; Voss, T.T.; Vossebeld, J.H.; Vovenko, A.S.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vu Anh, T.; Vudragovic, D.; Vuillermet, R.; Vukotic, I.; Wagner, W.; Wagner, P.; Wahlen, H.; Walbersloh, J.; Walder, J.; Walker, R.; Walkowiak, W.; Wall, R.; Waller, P.; Wang, C.; Wang, H.; Wang, J.; Wang, J.C.; Wang, S.M.; Warburton, A.; Ward, C.P.; Warsinsky, M.; Wastie, R.; Watkins, P.M.; Watson, A.T.; Watson, M.F.; Watts, G.; Watts, S.; Waugh, A.T.; Waugh, B.M.; Webel, M.; Weber, J.; Weber, M.; Weber, M.S.; Weber, P.; Weidberg, A.R.; Weingarten, J.; Weiser, C.; Wellenstein, H.; Wells, P.S.; Wen, M.; Wenaus, T.; Wendler, S.; Weng, Z.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M.; Werner, P.; Werth, M.; Werthenbach, U.; Wessels, M.; Whalen, K.; Wheeler-Ellis, S.J.; Whitaker, S.P.; White, A.; White, M.J.; White, S.; Whitehead, S.R.; Whiteson, D.; Whittington, D.; Wicek, F.; Wicke, D.; Wickens, F.J.; Wiedenmann, W.; Wielers, M.; Wienemann, P.; Wiglesworth, C.; Wiik, L.A.M.; Wildauer, A.; Wildt, M.A.; Wilhelm, I.; Wilkens, H.G.; Will, J.Z.; Williams, E.; Williams, H.H.; Willis, W.; Willocq, S.; Wilson, J.A.; Wilson, M.G.; Wilson, A.; Wingerter-Seez, I.; Winkelmann, S.; Winklmeier, F.; Wittgen, M.; Wolter, M.W.; Wolters, H.; Wosiek, B.K.; Wotschack, J.; Woudstra, M.J.; Wraight, K.; Wright, C.; Wright, D.; Wrona, B.; Wu, S.L.; Wu, X.; Wuestenfeld, J.; Wulf, E.; Wunstorf, R.; Wynne, B.M.; Xaplanteris, L.; Xella, S.; Xie, S.; Xie, Y.; Xu, C.; Xu, D.; Xu, G.; Xu, N.; Yabsley, B.; Yamada, M.; Yamamoto, A.; Yamamoto, K.; Yamamoto, S.; Yamamura, T.; Yamaoka, J.; Yamazaki, T.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, S.; Yang, U.K.; Yang, Y.; Yang, Y.; Yang, Z.; Yanush, S.; Yao, W-M.; Yao, Y.; Yasu, Y.; Ye, J.; Ye, S.; Yilmaz, M.; Yoosoofmiya, R.; Yorita, K.; Yoshida, H.; Yoshida, R.; Young, C.; Youssef, S.P.; Yu, D.; Yu, J.; Yu, J.; Yuan, J.; Yuan, L.; Yurkewicz, A.; Zaets, V.G.; Zaidan, R.; Zaitsev, A.M.; Zajacova, Z.; Zalite, Yo.K.; Zambrano, V.; Zanello, L.; Zarzhitsky, P.; Zaytsev, A.; Zdrazil, M.; Zeitnitz, C.; Zeller, M.; Zema, P.F.; Zemla, A.; Zendler, C.; Zenin, A.V.; Zenin, O.; Zenis, T.; Zenonos, Z.; Zenz, S.; Zerwas, D.; Zevi della Porta, G.; Zhan, Z.; Zhang, H.; Zhang, J.; Zhang, Q.; Zhang, X.; Zhao, L.; Zhao, T.; Zhao, Z.; Zhemchugov, A.; Zheng, S.; Zhong, J.; Zhou, B.; Zhou, N.; Zhou, Y.; Zhu, C.G.; Zhu, H.; Zhu, Y.; Zhuang, X.; Zhuravlov, V.; Zilka, B.; Zimmermann, R.; Zimmermann, S.; Zimmermann, S.; Ziolkowski, M.; Zitoun, R.; Zivkovic, L.; Zmouchko, V.V.; Zobernig, G.; Zoccoli, A.; Zolnierowski, Y.; Zsenei, A.; zur Nedden, M.; Zutshi, V.
2010-01-01
First measurements of the W -> lnu and Z/gamma* -> ll (l = e, mu) production cross sections in proton-proton collisions at sqrt(s) = 7 TeV are presented using data recorded by the ATLAS experiment at the LHC. The results are based on 2250 W -> lnu and 179 Z/gamma* -> ll candidate events selected from a data set corresponding to an integrated luminosity of approximately 320 nb-1. The measured total W and Z/gamma*-boson production cross sections times the respective leptonic branching ratios for the combined electron and muon channels are $\\stotW$ * BR(W -> lnu) = 9.96 +- 0.23(stat) +- 0.50(syst) +- 1.10(lumi) nb and $\\stotZg$ * BR(Z/gamma* -> ll) = 0.82 +- 0.06(stat) +- 0.05(syst) +- 0.09(lumi) nb (within the invariant mass window 66 < m_ll < 116 GeV). The W/Z cross-section ratio is measured to be 11.7 +- 0.9(stat) +- 0.4(syst). In addition, measurements of the W+ and W- production cross sections and of the lepton charge asymmetry are reported. Theoretical predictions based on NNLO QCD calculations are f...
50 CFR 660.320 - Open access fishery-crossover provisions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Open access fishery-crossover provisions... West Coast Groundfish-Open Access Fisheries § 660.320 Open access fishery—crossover provisions. (a) Operating in both limited entry and open access fisheries. See provisions at § 660.60, subpart C. (b...
Tank farm restoration and safe operation, project W-314, upgrade scope summary report (USSR)
International Nuclear Information System (INIS)
Jacobson, R.W.
1997-01-01
This revision to the Project W-314 Upgrade Scope Summary Report (USSR), incorporates changes to the project scope from Alternative Generation Analysis (AGA), customer guidance, and changing requirements. It defines the actual upgrades currently in scope, and provides traceability to the requirements and/or drivers
Characterization results for 106-AN grout produced in a pilot-scale test
International Nuclear Information System (INIS)
Lokken, R.O.; Bagaasen, L.M.; Martin, P.F.C.; Palmer, S.E.; Anderson, C.M.
1993-06-01
The Grout Treatment Facility (GTF) at Hanford. Washington, will process the low-level fraction of selected double-shell tank (DST) wastes into a cementitious waste form. This facility, which is operated by Westinghouse Hanford Company (WHC), mixes liquid waste with cementitious materials to produce a waste form that immobilizes hazardous constituents through chemical reactions and/or microencapsulation. Over one million gallons of phosphate/sulfate waste were solidified in the first production campaign with this facility. The next tank waste scheduled for treatment is 106-AN (the waste from Tank 241-AN-106). After laboratory studies were conducted to select the grout formulation, tests using the 1/4-scale pilot facilities at the Pacific Northwest Laboratory (PNL) were conducted as part of the formulation verification process. The major objectives of these pilot-scale tests were to determine if the proposed grout formulation could be processed in the pilotscale equipment. to collect thermal information to help determine the best way to manage the grout hydration heat, and to characterize the solidified grout
Conceptual design report, plutonium stabilization and handling,project W-460
Energy Technology Data Exchange (ETDEWEB)
Weiss, E.V.
1997-03-06
Project W-460, Plutonium Stabilization and Handling, encompasses procurement and installation of a Stabilization and Packaging System (SPS) to oxidize and package for long term storage remaining plutonium-bearing special nuclear materials currently in inventory at the Plutonium Finishing Plant (PFP), and modification of vault equipment to allow storage of resulting packages of stabilized SNM for up to fifty years. This Conceptual Design Report (CDR) provides conceptual design details for the vault modification, site preparation and site interface with the purchased SPS. Two concepts are described for vault configuration; acceleration of this phase of the project did not allow completion of analysis which would clearly identify a preferred approach.
2013-01-01
Background Antimicrobial peptides have been the focus of much research over the last decade because of their effectiveness and broad-spectrum activity against microbial pathogens. These peptides also participate in inflammation and the innate host defense system by modulating the immune function that promotes immune cell adhesion and migration as well as the respiratory burst, which makes them even more attractive as therapeutic agents. This has led to the synthesis of various antimicrobial peptides, including KSL-W (KKVVFWVKFK-NH2), for potential clinical use. Because this peptide displays antimicrobial activity against bacteria, we sought to determine its antifungal effect on C. albicans. Growth, hyphal form, biofilm formation, and degradation were thus examined along with EFG1, NRG1, EAP1, HWP1, and SAP 2-4-5-6 gene expression by quantitative RT-PCR. Results This study demonstrates that KSL-W markedly reduced C. albicans growth at both early and late incubation times. The significant effect of KSL-W on C. albicans growth was observed beginning at 10 μg/ml after 5 h of contact by reducing C. albicans transition and at 25 μg/ml by completely inhibiting C. albicans transition. Cultured C. albicans under biofilm-inducing conditions revealed that both KSL-W and amphotericin B significantly decreased biofilm formation at 2, 4, and 6 days of culture. KSL-W also disrupted mature C. albicans biofilms. The effect of KSL-W on C. albicans growth, transition, and biofilm formation/disruption may thus occur through gene modulation, as the expression of various genes involved in C. albicans growth, transition and biofilm formation were all downregulated when C. albicans was treated with KSL-W. The effect was greater when C. albicans was cultured under hyphae-inducing conditions. Conclusions These data provide new insight into the efficacy of KSL-W against C. albicans and its potential use as an antifungal therapy. PMID:24195531
5 MeV 300 kW electron accelerator project
International Nuclear Information System (INIS)
Auslender, V.L.; Cheskidov, V.G.; Gornakov, I.V.
2004-01-01
The paper presents a project of a high power linear accelerator for industrial applications. The accelerator has a modular structure and consists of the chain of accelerating cavities connected by the axis-located coupling cavities with coupling slots in the common walls. Main parameters of the accelerator are: operating frequency of 176 MHz, electron energy of up to 5 MeV, average beam power of 300 kW. The required RF pulse power can be supplied by the TH628 diacrode
Tank 241-A-104 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-A-104. This Tank Characterization Plan will identify characterization objectives pertaining to sample collection, hot cell sample isolation, and laboratory analytical evaluation and reporting requirements in addition to reporting the current contents and status of the tank as projected from historical information
7 CFR 3052.320 - Report submission.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Report submission. 3052.320 Section 3052.320 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditees § 3052...
DEFF Research Database (Denmark)
Hamam, D; Ali, D; Vishnubalaji, R
2014-01-01
The molecular mechanisms promoting lineage-specific commitment of human mesenchymal (skeletal or stromal) stem cells (hMSCs) into adipocytes (ADs) are not fully understood. Thus, we performed global microRNA (miRNA) and gene expression profiling during adipocytic differentiation of h...... differentiation and accelerated formation of mature ADs in ex vivo cultures. Integrated analysis of bioinformatics and global gene expression profiling in miR-320c overexpressing cells and during adipocytic differentiation of hMSC identified several biologically relevant gene targets for miR-320c including RUNX2...
24 CFR 235.320 - Limitation of sales price.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Limitation of sales price. 235.320 Section 235.320 Housing and Urban Development Regulations Relating to Housing and Urban Development... Payments-Homes for Lower Income Families § 235.320 Limitation of sales price. To qualify for assistance...
Karagol, Belma Saygili; Zenciroglu, Aysegul; Okumus, Nurullah; Karadag, Nilgun; Dursun, Arzu; Hakan, Nilay
2012-06-01
To determine the clinical spectrum of hemolytic disease due to irregular blood subgroup incompatibility in hospitalized neonates. The medical records of the all hospitalized newborn patients diagnosed with indirect hyperbilirubinemia due to subgroup incompatibility in Kell, C, c, E, and e systems were included in the study. Data from 106 newborns with hemolytic jaundice due to irregular blood subgroups were retrospectively evaluated, and clinical and laboratory findings were compared between patients . The treatment modalities given to the patients of each subgroup types and the laboratory findings and treatment modalities of the cases according to Coombs tests results were also analyzed. Fetal affection of the hemolysis and also fetal losses due to irregular red-cell alloimmunization were not detected in prenatal course, as there was no follow-up of these pregnancies. The mean postnatal hospitalizing age was 6.1 ± 5.2 days after birth. The mean total bilirubin level and the mean hemoglobin value on hospitalization were 343.7 ± 63.3 µmol/L (=20.1 ± 3.7 mg/dL) and 14.9 ± 3.4 g/dL, respectively. Of 106 patients identified with irregular subgroup incompatibility, 40 infants (37.7%) were associated with C, 22 (20.8%) with c, 30 (28.3%) with E, 9 (8.5%) with e, and 5 (4.7%) with Kell subgroup system. Positive Coombs tests (either direct and/or indirect) occurred in 28.3% of the study cases. Hydrops fetalis was determined in 5 of 106 neonates (4.7%). Twenty-two of 106 (20.8%) patients required total exchange transfusion. Positive Coombs test in cases required total exchange transfusion was 63.6%. Our data expose the magnitude and spectrum of the potential developing severe hemolytic disease and immune hydrops due to irregular subgroup incompatibility. Minor group antibody screening is recommended both in the mother and the high-risk infants with hyperbilirubinemia and hemolytic disease of the newborn. Copyright © 2012 Thieme Medical Publishers, Inc., 333 Seventh
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Action plan. 91.320 Section 91.320 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development...), evaluate and reduce lead-based paint hazards, reduce the number of poverty level families, develop...
24 CFR 583.320 - Site control.
2010-04-01
... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Site control. 583.320 Section 583... DEVELOPMENT COMMUNITY FACILITIES SUPPORTIVE HOUSING PROGRAM Program Requirements § 583.320 Site control. (a) Site control. (1) Where grant funds will be used for acquisition, rehabilitation, or new construction...
24 CFR 320.10 - Financial reporting.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Financial reporting. 320.10 Section...-BACKED SECURITIES Pass-Through Type Securities § 320.10 Financial reporting. Issuers shall submit to the Association audited annual financial statements within 90 days of their fiscal year end. All financial...
12 CFR 24.1 - Authority, purpose, and OMB control number.
2010-01-01
... the Currency (OCC) issues this part pursuant to its authority under 12 U.S.C. 24(Eleventh), 93a, and 481. (b) Purpose. This part implements 12 U.S.C. 24 (Eleventh). It is the OCC's policy to encourage a....1 Section 24.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY COMMUNITY...
Gamma ray spectrum of Am 241 in a backscattering geometry using a high purity germanium detector
International Nuclear Information System (INIS)
Chong Chon Sing; Ibrahim Salih Elyaseery; Ahmad Shukri Mustapa Kamal; Abdul Aziz Tajuddin
1997-01-01
In back scattering geometry using an annular Am-241 source and a HPGE detector has been set up to study both the coherent and incoherent scattering of photon emissions of Am-241 from medium-Z and high-Z elements. Besides the coherent and incoherent scattered peaks of the emissions from the source, the gamma ray spectrum from the different target elements obtained using a microcomputer based multichannel analyser showed the presence of several other peaks. These peaks have been identified to arise from the fluorescence of the targets, the fluorescence of the shielding material Pb, and also as fluorescence sum peaks and X-ray escape peaks of the detector material Ge. The spectra are presented for three target elements viz. Mo, Zn and W
27 CFR 24.320 - Chemical record.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Chemical record. 24.320... OF THE TREASURY LIQUORS WINE Records and Reports § 24.320 Chemical record. A proprietor who uses chemicals, preservatives, or other such materials shall maintain a record of the purchase, receipt and...
Discovery of a thermally persistent h.c.p. solid-solution phase in the Ni-W system
International Nuclear Information System (INIS)
Kurz, S. J. B.; Leineweber, A.; Maisel, S. B.; Höfler, M.; Müller, S.; Mittemeijer, E. J.
2014-01-01
Although the accepted Ni-W phase diagram does not reveal the existence of h.c.p.-based phases, h.c.p.-like stacking sequences were observed in magnetron-co-sputtered Ni-W thin films at W contents of 20 to 25 at. %, by using transmission electron microscopy and X-ray diffraction. The occurrence of this h.c.p.-like solid-solution phase could be rationalized by first-principles calculations, showing that the vicinity of the system's ground-state line is populated with metastable h.c.p.-based superstructures in the intermediate concentration range from 20 to 50 at. % W. The h.c.p.-like stacking in Ni-W films was observed to be thermally persistent, up to temperatures as high as at least 850 K, as evidenced by extensive X-ray diffraction analyses on specimens before and after annealing treatments. The tendency of Ni-W for excessive planar faulting is discussed in the light of these new findings
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2014-01-01
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)
2014-01-08
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
W3C head Berners-Lee to be knighted
Gross, G
2004-01-01
"Tim Berners-Lee, credited with inventing the World Wide Web and now director of the World Wide Web Consortium, will be named a knight commander, Order of the British Empire, by Queen Elizabeth II, the W3C announced Wednesday" (1 page)
Rola leptyny w regulacji metabolizmu lipidów i węglowodanów
Directory of Open Access Journals (Sweden)
Patrycja Gogga*
2011-01-01
Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.
2012-10-24
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 14367-001] Don W. Gilbert...: Original Minor License. b. Project No.: 14367-001. c. Date filed: May 30, 2012. d. Applicant: Don W...(a)-825(r). (2006). h. Applicant Contact: Don W. Gilbert and DeAnn G. Somonich, Don W. Gilbert Hydro...
23 CFR 773.106 - Application requirements for participation in the program.
2010-04-01
...; (ii) A description of any changes to the State DOT's organizational structure that are deemed... RIGHT-OF-WAY AND ENVIRONMENT SURFACE TRANSPORTATION PROJECT DELIVERY PILOT PROGRAM § 773.106 Application... information: (1) The highway project(s) or classes of highway projects for which the State is requesting to...
Low temperature synthesis of Mo2C/W2C superlattices via ultra-thin modulated reactants
International Nuclear Information System (INIS)
Johnson, C.D.; Johnson, D.C.
1996-01-01
The authors report here a synthesis method of preparing carbide superlattices using ultra-thin modulated reactants. Initial investigations into the synthesis of the binary systems, Mo 2 C and W 2 C using ultra-thin modulated reactants revealed that both can be formed at relatively low temperatures (500 and 600 C respectively). DSC and XRD data suggested a two step reaction pathway involving interdiffusion of the initial modulated reactant followed by crystallization of the final product, if the modulation length is on the order of 10 angstrom. This information was used to form Mo 2 C/W 2 C superlattices using the structure of the ultra-thin modulated reactant to control the final superlattice period. Relatively large superlattice modulations were kinetically trapped by having several repeat units of each binary within the total repeat of the initial reactant. DSC and XRD data again are consistent with a two step reaction pathway leading to the formation of carbide superlattices
77 FR 27451 - Boott Hydropower, Inc.; Notice of Section 106 Consultation Meeting
2012-05-10
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2790-055] Boott Hydropower, Inc.; Notice of Section 106 Consultation Meeting On May 24, 2012, Federal Energy Regulatory Commission... Historic Preservation, Boott Hydropower, Inc., and any other consulting parties for the section 106 process...