ECO TECH LINK: PT3 Grant Builds Technology Circles in the K-18 Community.

Science.gov (United States)

Klinger, Katie; Duckett, Jane; Medrano, Maria; Crow, Nedra; Stowers, Gwen

Through the vehicle of the PT3 grant program, ECO TECH LINK has built a strong consortium to support technology circles of government, education and business in order to raise student achievement scores, shorten the time it takes to earn a teaching credential, and enhance the quality of teacher credential courses. The ECO TECH LINK grant enables…

[The mission of Princeton Plasma Physics Laboratory

International Nuclear Information System (INIS)

1993-01-01

This report discusses the following about Princeton Plasma Physics Laboratory: its mission; requirements and guidance documents for the QA program; architecture; assessment organization; and specific management issues

The Princeton colloquium

CERN Document Server

Bliss, Gilbert Ames

1913-01-01

Following the early tradition of the American Mathematical Society, the sixth colloquium of the Society was held as part of the summer meeting that took place at Princeton University. Two sets of lectures were presented: Fundamental Existence Theorems, by G. A. Bliss, and Geometric Aspects of Dynamics, by Edward Kasner. The goal of Bliss's Colloquium Lectures is an overview of contemporary existence theorems for solutions to ordinary or partial differential equations. The first part of the book, however, covers algebraic and analytic aspects of implicit functions. These become the primary too

Quentin Skinner, Staten og friheten. Oslo: Res Publica, 2011. José Luis Martí and Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero's Spain. Princeton: Princeton University Press, 2010 (Simon Laumann Jørgensen)

DEFF Research Database (Denmark)

Jørgensen, Simon Laumann

2012-01-01

Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95......Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95...

Health physics measurement of Princeton Tokamaks, 1977-1987

International Nuclear Information System (INIS)

Stencel, J.R.; Gilbert, J.D.; Couch, J.G.; Griesbach, O.A.; Fennimore, J.J.; Greco, J.M.

1989-01-01

The Princeton Plasma Physics Laboratory (PPPL) began fusion experiments in 1951. In the early years, the major health physics concerns were associated with x radiation produced by energetic electrons in the plasma. Within the past year, neutron and 3 H production from 2H-2H (represented hereafter as D-D) reactions has increased significantly on the larger fusion devices. Tritium retention noted in graphite tiles underscores the significance of material selection in present and future 3 H-fueled fusion devices. This paper reports on operational health physics radiation measurements made on various PPPL machines over the past 10 y

TechEdSat Nano-Satellite Series Fact Sheet

Science.gov (United States)

Murbach, Marcus; Martinez, Andres; Guarneros Luna, Ali

2014-01-01

TechEdSat-3p is the second generation in the TechEdSat-X series. The TechEdSat Series uses the CubeSat standards established by the California Polytechnic State University Cal Poly), San Luis Obispo. With typical blocks being constructed from 1-unit (1U 10x10x10 cm) increments, the TechEdSat-3p has a 3U volume with a 30 cm length. The project uniquely pairs advanced university students with NASA researchers in a rapid design-to-flight experience lasting 1-2 semesters.The TechEdSat Nano-Satellite Series provides a rapid platform for testing technologies for future NASA Earth and planetary missions, as well as providing students with an early exposure to flight hardware development and management.

Commercial introduction of the Advanced NOxTECH system

Energy Technology Data Exchange (ETDEWEB)

Sudduth, B.C. [NOxTECH, Inc., Irvine, CA (United States)

1997-12-31

NOxTECH is BACT for diesel electric generators. Emissions of NO{sub x} are reduced 95% or more with substantial concurrent reductions in CO, particulates, and ROG`s. No engine modifications or other exhaust aftertreatments can remove all criteria pollutants as effectively as NOxTECH. The NOxTECH system reliably maintains NH{sub 3} slip below 2 ppm. Unlike other emissions controls, NOxTECH does not generate hazardous by-products. The Advanced NOxTECH system reduces the size, weight, and cost for BACT emissions reductions. Based on the operation of a 150 kW prototype, NOxTECH, Inc. is quoting commercial units for diesel electric generators. Advanced NOxTECH equipment costs about half as much as SCR systems, and NO{sub x} reduction can exceed 95% with guarantees for emissions compliance.

Installation and early operation of a complex low inventory cryogenic distillation system for the Princeton TFTR

International Nuclear Information System (INIS)

Busigin, A.; Busigin, C.J.; Robins, J.R.; Woodall, K.B.; Bellamy, D.G.; Fong, C.; Kalyanam, K.; Sood, S.K.

1995-01-01

A low inventory Tritium Purification System (TPS) has just been installed at the Princeton Plasma Physics Laboratory (PPPL). The TPS was designed specifically for PPPL, based on their specifications for exhaust gases. The generic design, however, can easily be modified to accept a large variety of input conditions. The Princeton system is designed to have a total tritium inventory of approximately 0.5 g while producing pure product streams consisting of H 2 , D 2 , and T 2 . The purpose of the system is to separate and recycle unburnt tritium from the TFTR and to produce hydrogen and deuterium streams that are free of tritium. These streams can be disposed by stacking, thus eliminating the need to create large volume waste streams that are contaminated with tritium and that must be managed for permanent disposal. This paper will discuss the installation, the modifications and preliminary results of operation of this system at Princeton. 2 refs., 3 figs

FinTech in Norway : the effect of FinTech on the traditional Norwegian banking sector

OpenAIRE

Omreng, Stian; Gjendem, Ida

2017-01-01

The purpose of this thesis is to investigate the effect of FinTech on the Norwegian banking industry. We investigate the drivers of FinTech, the current and potential Norwegian FinTech market, and the international competitiveness of the Norwegian FinTech movement. We identify nine segments of FinTech within the traditional banking functions Financing, Asset management, Payments and Authentication, and we find the key drivers behind the rapid growth of the FinTech market as cha...

Tech House

Science.gov (United States)

1978-01-01

The members of the Swain family- Dr. Charles "Bill" Swain, wife Elaine, daughter Carol, 17, son "Chuck", 12, and dog Susie have an interesting assignment. They are active participants in an important NASA research program involving the application of space-age technology to home construction. b' Transplanted Floridians, the Swains now reside in NASA's Tech House, loatedat Langley Research Center, Hampton, Virginia. Their job is to use and help evaluate the variety of advanced technology systems in Tech House. A contemporary three-bedroom home, Tech House incorporates NASA technology, the latest commercial building techniques and other innovations, all designed to reduce energy and water consumption and to provide new levels of comfort, convenience, security and fire safety. Tech House equipment performed well in initial tests, but a house is not a home until it has people. That's where the Swains come in. NASA wants to see how the various systems work under actual living conditions, to confirm the effectiveness of the innovations or to determine necessary modifications for improvement. The Swains are occupying the house for a year, during which NASA engineers are computer monitoring the equipment and assembling a record of day-to-day performance. . Tech House is a laboratory rather than a mass production prototype, but its many benefits may influence home design and construction. In a period of sharply rising utility costs, widespread adoption of Tech House features could provide large-scale savings to homeowners and potentially enormous national benefit in resources conservation. Most innovations are aerospace spinoffs: Some of the equipment is now commercially available; other systems are expected to be in production within a few years. Around 1980, a Tech House-type of home could be built for $45-50,000 (1 976 dollars). It is estimated that the homeowner would save well over $20,000 (again 1976 dollars) in utility costs over the average mortgage span of 20 years.

High-tech entrepreneurship

DEFF Research Database (Denmark)

Bernasconi, Michel; Harris, Simon; Mønsted, Mette

High-tech businesses form a crucial part of entrepreneurial activity - in some ways representing very typical examples of entrepreneurship, yet in some ways representing quite different challenges. The uncertainty in innovation and advanced technology makes it difficult to use conventional economic...... focuses on the blend of theory and practice needed to inform advanced entrepreneurship students of the specifics of high-tech start-ups. Key topics covered include: uncertainty and innovation; entrepreneurial finance; marketing technological innovations; and high-tech incubation management.......Edited by a multi-national team, it draws together leading writers and researchers from across Europe, and is therefore a must-read for all those involved in advanced entrepreneurship with specific interests in high-tech start-ups....

The Science on Saturday Program at Princeton Plasma Physics Laboratory

Science.gov (United States)

Bretz, N.; Lamarche, P.; Lagin, L.; Ritter, C.; Carroll, D. L.

1996-11-01

The Science on Saturday Program at Princeton Plasma Physics Laboratory consists of a series of Saturday morning lectures on various topics in science by scientists, engineers, educators, and others with an interesting story. This program has been in existence for over twelve years and has been advertised to and primarily aimed at the high school level. Topics ranging from superconductivity to computer animation and gorilla conservation to pharmaceutical design have been covered. Lecturers from the staff of Princeton, Rutgers, AT and T, Bristol Meyers Squibb, and many others have participated. Speakers have ranged from Nobel prize winners, astronauts, industrialists, educators, engineers, and science writers. Typically, there are eight to ten lectures starting in January. A mailing list has been compiled for schools, science teachers, libraries, and museums in the Princeton area. For the past two years AT and T has sponsored buses for Trenton area students to come to these lectures and an effort has been made to publicize the program to these students. The series has been very popular, frequently overfilling the 300 seat PPPL auditorium. As a result, the lectures are videotaped and broadcast to a large screen TV for remote viewing. Lecturers are encouraged to interact with the audience and ample time is provided for questions.

Tech Prep Marketing Guide. The Complete Book of Strategies and Practical Experiences.

Science.gov (United States)

Williamson, Patty

This guide explains the concept of marketing tech prep and provides marketing principles and strategies to promote tech prep programs. The guide covers the following topics: (1) why it is necessary to market tech prep; (2) what a comprehensive tech prep marketing plan should include; (3) targeting the benefits message; (4) marketing tech prep to…

PITR: Princeton Ignition Test Reactor

International Nuclear Information System (INIS)

1978-12-01

The principal objectives of the PITR - Princeton Ignition Test Reactor - are to demonstrate the attainment of thermonuclear ignition in deuterium-tritium, and to develop optimal start-up techniques for plasma heating and current induction, in order to determine the most favorable means of reducing the size and cost of tokamak power reactors. This report describes the status of the plasma and engineering design features of the PITR. The PITR geometry is chosen to provide the highest MHD-stable values of beta in a D-shaped plasma, as well as ease of access for remote handling and neutral-beam injection

Investigation of air transportation technology at Princeton University, 1984

Science.gov (United States)

Stengel, Robert F.

1987-01-01

The Air Transportation Technology Program at Princeton University, a program emphasizing graduate and undergraduate student research, proceeded along four avenues during 1984: (1) guidance and control strategies for penetration of microbursts and wind shear; (2) application of artificial intelligence in flight control systems; (3) effects of control saturation on closed loop stability; and (4) response of open loop unstable aircraft. Areas of investigation relate to guidance and control of commercial transports as well as to general aviation aircraft. Interaction between the flight crew and automatic systems is a subject of principle concern. These areas of investigation are briefly discussed.

Exterior LED Lighting Projects at Princeton University

Energy Technology Data Exchange (ETDEWEB)

Davis, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Evans, William [Princeton Univ., NJ (United States); Murphy, Arthur T. [Princeton Univ., NJ (United States); Perrin, Tess E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-10-01

For this report, PNNL / the U.S. Department of Energy (DOE) studied a series of past exterior lighting projects at Princeton, in order to document Princeton’s experiences with solid-state lighting (SSL) and the lessons learned along the way, and to show how their approach to SSL projects evolved as their own learning expanded and as the products available improved in performance and sophistication.

GammaModeler 3-D gamma-ray imaging technology

International Nuclear Information System (INIS)

2000-01-01

The 3-D GammaModelertrademark system was used to survey a portion of the facility and provide 3-D visual and radiation representation of contaminated equipment located within the facility. The 3-D GammaModelertrademark system software was used to deconvolve extended sources into a series of point sources, locate the positions of these sources in space and calculate the 30 cm. dose rates for each of these sources. Localization of the sources in three dimensions provides information on source locations interior to the visual objects and provides a better estimate of the source intensities. The three dimensional representation of the objects can be made transparent in order to visualize sources located within the objects. Positional knowledge of all the sources can be used to calculate a map of the radiation in the canyon. The use of 3-D visual and gamma ray information supports improved planning decision-making, and aids in communications with regulators and stakeholders

Nederland krijgt belangstelling voor mid tech en low tech kassenbouw (interview met Anne Elings)

NARCIS (Netherlands)

Kierkels, T.; Elings, A.

2013-01-01

Nederland zet de toon in high tech kassenbouw over de hele wereld. Maar in toenemende mate kijken de toeleveringsbedrijven ook naar mogelijkheden binnen het mid tech en zelfs het low tech segment. De Nederlandse overheid ondersteunt demonstratieprojecten in bijvoorbeeld Mexico, Oost-Afrika en

The Princeton Protein Orthology Database (P-POD): a comparative genomics analysis tool for biologists.

OpenAIRE

Sven Heinicke; Michael S Livstone; Charles Lu; Rose Oughtred; Fan Kang; Samuel V Angiuoli; Owen White; David Botstein; Kara Dolinski

2007-01-01

Many biological databases that provide comparative genomics information and tools are now available on the internet. While certainly quite useful, to our knowledge none of the existing databases combine results from multiple comparative genomics methods with manually curated information from the literature. Here we describe the Princeton Protein Orthology Database (P-POD, http://ortholog.princeton.edu), a user-friendly database system that allows users to find and visualize the phylogenetic r...

Feedback stabilization of MHD instabilities. Report on the Workshop held at Princeton Plasma Physics Lab., Princeton Univ., Princeton, New Jersey, United States of America, 11-13 December 1996

International Nuclear Information System (INIS)

McGuire, K.M.; Kugel, H.W.; La Haye, R.J.; Mauel, M.E.; Nevins, W.M.; Prager, S.C.

1997-01-01

The transient operating performance of magnetic confinement devices is often limited by one or two unstable MHD modes. The feedback stabilization of MHD instabilities is an area of research that is critical for improving the steady state performance and economic attractiveness of magnetic confinement devices. This growing realization motivated a Workshop dedicated to feedback stabilization of MHD instabilities, which was held from 11 to 13 December 1996 at Princeton Plasma Physics Laboratory. The resulting presentations, conclusions and recommendations are summarized. (author)

Princeton Plasma Physics Laboratory. Annual report, October 1, 1989--September 30, 1990

Energy Technology Data Exchange (ETDEWEB)

1990-12-31

This report discusses the following topics: principal parameters achieved in experimental devices fiscal year 1990; tokamak fusion test reactor; compact ignition tokamak; Princeton beta experiment- modification; current drive experiment-upgrade; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma processing: deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for fiscal year 1990; graduate education; plasma physics; graduate education: plasma science and technology; science education program; and Princeton Plasma Physics Laboratory reports fiscal year 1990.

Settlement Ends Dispute between Princeton and Donors' Heirs

Science.gov (United States)

Masterson, Kathryn; Gose, Ben

2009-01-01

This article reports that Princeton University has settled a long-running dispute with the heirs of a major donor by agreeing to pay $50-million to the heirs' foundation and approximately the same amount for their legal fees. The case has been closely watched as a test of how strictly institutions must adhere to donors' wishes. The settlement…

Final Report: High Energy Physics Program (HEP), Physics Department, Princeton University

Energy Technology Data Exchange (ETDEWEB)

Callan, Curtis G. [Princeton University; Gubser, Steven S. [Princeton University; Marlow, Daniel R. [Princeton University; McDonald, Kirk T. [Princeton University; Meyers, Peter D. [Princeton University; Olsen, James D. [Princeton University; Smith, Arthur J.S. [Princeton University; Steinhardt, Paul J. [Princeton University; Tully, Christopher G. [Princeton University; Stickland, David P. [Princeton University

2013-04-30

The activities of the Princeton Elementary particles group funded through Department of Energy Grant# DEFG02-91 ER40671 during the period October 1, 1991 through January 31, 2013 are summarized. These activities include experiments performed at Brookhaven National Lab; the CERN Lab in Geneva, Switzerland; Fermilab; KEK in Tsukuba City, Japan; the Stanford Linear Accelerator Center; as well as extensive experimental and the- oretical studies conducted on the campus of Princeton University. Funded senior personnel include: Curtis Callan, Stephen Gubser, Valerie Halyo, Daniel Marlow, Kirk McDonald, Pe- ter Meyers, James Olsen, Pierre Pirou e, Eric Prebys, A.J. Stewart Smith, Frank Shoemaker (deceased), Paul Steinhardt, David Stickland, Christopher Tully, and Liantao Wang.

P53 suppresses expression of the 14-3-3gamma oncogene

Directory of Open Access Journals (Sweden)

Qi Wenqing

2011-08-01

Full Text Available Abstract Background 14-3-3 proteins are a family of highly conserved proteins that are involved in a wide range of cellular processes. Recent evidence indicates that some of these proteins have oncogenic activity and that they may promote tumorigenesis. We previously showed that one of the 14-3-3 family members, 14-3-3gamma, is over expressed in human lung cancers and that it can induce transformation of rodent cells in vitro. Methods qRTPCR and Western blot analysis were performed to examine 14-3-3gamma expression in non-small cell lung cancers (NSCLC. Gene copy number was analyzed by qPCR. P53 mutations were detected by direct sequencing and also by western blot. CHIP and yeast one hybrid assays were used to detect p53 binding to 14-3-3gamma promoter. Results Quantitative rtPCR results showed that the expression level of 14-3-3gamma was elevated in the majority of NSCLC that we examined which was also consistent with protein expression. Further analysis of the expression pattern of 14-3-3gamma in lung tumors showed a correlation with p53 mutations suggesting that p53 might suppress 14-3-3 gamma expression. Analysis of the gamma promoter sequence revealed the presence of a p53 consensus binding motif and in vitro assays demonstrated that wild-type p53 bound to this motif when activated by ionizing radiation. Deletion of the p53 binding motif eliminated p53's ability to suppress 14-3-3gamma expression. Conclusion Increased expression of 14-3-3gamma in lung cancer coincides with loss of functional p53. Hence, we propose that 14-3-3gamma's oncogenic activities cooperate with loss of p53 to promote lung tumorigenesis.

Nalco Fuel Tech

Energy Technology Data Exchange (ETDEWEB)

Michalak, S.

1995-12-31

The Nalco Fuel Tech with its seat at Naperville (near Chicago), Illinois, is an engineering company working in the field of technology and equipment for environmental protection. A major portion of NALCO products constitute chemical materials and additives used in environmental protection technologies (waste-water treatment plants, water treatment, fuel modifiers, etc.). Basing in part on the experience, laboratories and RD potential of the mother company, the Nalco Fuel Tech Company developed and implemented in the power industry a series of technologies aimed at the reduction of environment-polluting products of fuel combustion. The engineering solution of Nalco Fuel Tech belong to a new generation of environmental protection techniques developed in the USA. They consist in actions focused on the sources of pollutants, i.e., in upgrading the combustion chambers of power engineering plants, e.g., boilers or communal and/or industrial waste combustion units. The Nalco Fuel Tech development and research group cooperates with leading US investigation and research institutes.

Princeton University, Plasma Physics Laboratory annual report, October 1, 1988--September 30, 1989

International Nuclear Information System (INIS)

1989-01-01

This report contains discussions on the following topics: principal parameters achieved in experimental devices (FY89); tokamak fusion test reactor; compact ignition tokamak; princeton beta experiment- modification; current drive experiment; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for (FY89); graduate education: plasma physics; graduate education: plasma science and technology; and Princeton Plasmas Physics Laboratory Reports (FY89)

Princeton University, Plasma Physics Laboratory annual report, October 1, 1988--September 30, 1989

Energy Technology Data Exchange (ETDEWEB)

1989-12-31

This report contains discussions on the following topics: principal parameters achieved in experimental devices (FY89); tokamak fusion test reactor; compact ignition tokamak; princeton beta experiment- modification; current drive experiment; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for (FY89); graduate education: plasma physics; graduate education: plasma science and technology; and Princeton Plasmas Physics Laboratory Reports (FY89).

Princeton University, Plasma Physics Laboratory annual report, October 1, 1988--September 30, 1989

Energy Technology Data Exchange (ETDEWEB)

1989-01-01

This report contains discussions on the following topics: principal parameters achieved in experimental devices (FY89); tokamak fusion test reactor; compact ignition tokamak; princeton beta experiment- modification; current drive experiment; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for (FY89); graduate education: plasma physics; graduate education: plasma science and technology; and Princeton Plasmas Physics Laboratory Reports (FY89).

Princeton University Plasma Physics Laboratory, Princeton, New Jersey. Annual report, October 1, 1990--September 30, 1991

Energy Technology Data Exchange (ETDEWEB)

1991-12-31

This report discusses the following topics: Principal parameters of experimental devices; Tokamak Fusion Test Reactor; Burning Plasma Experiment; Princeton Beta Experiment-Modification; Current Drive Experiment-Upgrade; International Thermonuclear Experimental Reactor; International Collaboration; X-Ray Laser Studies; Hyperthermal Atomic Beam Source; Pure Electron Plasma Experiments; Plasma Processing: Deposition and Etching of Thin Films; Theoretical Studies; Tokamak Modeling; Engineering Department; Environment, Safety, and Health and Quality Assurance; Technology Transfer; Office of Human Resources and Administration; PPPL Patent Invention Disclosures; Office of Resource Management; Graduate Education: Plasma Physics; Graduate Education: Program in Plasma Science and Technology; and Science Education Program.

Pharmacist and Technician Perceptions of Tech-Check-Tech in Community Pharmacy Practice Settings.

Science.gov (United States)

Frost, Timothy P; Adams, Alex J

2018-04-01

Tech-check-tech (TCT) is a practice model in which pharmacy technicians with advanced training can perform final verification of prescriptions that have been previously reviewed for appropriateness by a pharmacist. Few states have adopted TCT in part because of the common view that this model is controversial among members of the profession. This article aims to summarize the existing research on pharmacist and technician perceptions of community pharmacy-based TCT. A literature review was conducted using MEDLINE (January 1990 to August 2016) and Google Scholar (January 1990 to August 2016) using the terms "tech* and check," "tech-check-tech," "checking technician," and "accuracy checking tech*." Of the 7 studies identified we found general agreement among both pharmacists and technicians that TCT in community pharmacy settings can be safely performed. This agreement persisted in studies of theoretical TCT models and in studies assessing participants in actual community-based TCT models. Pharmacists who had previously worked with a checking technician were generally more favorable toward TCT. Both pharmacists and technicians in community pharmacy settings generally perceived TCT to be safe, in both theoretical surveys and in surveys following actual TCT demonstration projects. These perceptions of safety align well with the actual outcomes achieved from community pharmacy TCT studies.

The National Spherical Tokamak Experiment at the Princeton Plasma Physics Laboratory

International Nuclear Information System (INIS)

1995-12-01

The Department of Energy (DOE) has prepared an Environmental Assessment (EA), DOE/EA-1108, evaluating the environmental effects of the proposed construction and operation of the National Spherical Tokamak Experiment (NSTX) within the existing C-Stellarator (CS) Building at the Princeton Plasma Physics Laboratory, Princeton, New Jersey. The purpose of the NSTX is to investigate the physics of spherically shaped plasmas as an alternative path to conventional tokamaks for development of fusion energy. Fusion energy has the potential to help compensate for dwindling supplies of fossil fuels and the eventual depletion of fissionable uranium used in present-day nuclear reactors. Construction of the NSTX in the CS Building would require the dismantling and removal of the existing unused Princeton Large Torus (PLT) device, part of which would be reused to construct the NSTX. Based on the analyses in the EA, the DOE has determined that the proposed action does not constitute a major federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act (NEPA) of 1969, 42 U.S.C. 4,321 et seq. The preparation of an Environmental Impact Statement is not required. Thus, the DOE is issuing a FONSI pursuant to the Council on Environmental Quality regulations implementing NEPA (40 CFR Parts 1500--1508) and the DOE NEPA implementing regulations (10 CFR Part 1021)

Overview of the modification to the poloidal divertor experiment (PDX) to produce the Princeton beta experiment (PBX)

International Nuclear Information System (INIS)

Knutson, D.

1984-01-01

The Poloidal Divertor Experiment at the Princeton Plasma Physics Laboratory has been recently transformed into the Princeton Beta Experiment. The purpose of the modification is to produce a bean-shaped plasma with beta values in excess of 10%, which is substantially above those achieved with more conventional plasma shapes. (author)

High tech in the Öresund region

DEFF Research Database (Denmark)

Hansen, Povl Adler; Serin, Göran Folke

This book discusses the development conditions in the high tech sector for both high tech manufacturing and services. A central issue in the book is the differences in externalities which exist between various industries in the high tech sector. In this connection the confusion of externalities...... related to different parts of the high tech sector will be addressed. The location of the high tech sector in the Öresund region will be analysed and the region will also be related to other high tech regions in Europe....

THE FUNDAMENTALS OF HIGH-TECH SECTOR AND HIGH-TECH COMPANIES OPERATION

Directory of Open Access Journals (Sweden)

Svetlana V. Gavrilova

2014-01-01

Full Text Available The article develops the concept of the«high-tech sector» and the «high-techcompany» as well as their differences and relation. Further the author accounts for the particularities of the high-tech company functioning compared to the common one. Finally the key factors and coreelements of high technology are identified.

High-tech entrepreneurship

DEFF Research Database (Denmark)

Bernasconi, Michel; Harris, Simon; Mønsted, Mette

; entrepreneurial finance; marketing technological innovations; and high-tech incubation management. Including case studies to give practical insights into genuine business examples, this comprehensive book has a distinctly 'real-world' focus throughout.Edited by a multi-national team, this comprehensive book......High-tech businesses form a crucial part of entrepreneurial activity - in some ways representing very typical examples of entrepreneurship, yet in some ways representing quite different challenges. The uncertainty in innovation and advanced technology makes it difficult to use conventional economic...... planning models, and also means that the management skills used in this area must be more responsive to issues of risk, uncertainty and evaluation than in conventional business opportunities. Whilst entrepreneurial courses do reflect the importance of high-tech businesses, they often lack the resources...

Progress on the occulter experiment at Princeton

Science.gov (United States)

Cady, Eric; Balasubramanian, Kunjithapatham; Carr, Michael; Dickie, Matthew; Echternach, Pierre; Groff, Tyler; Kasdin, Jeremy; Laftchiev, Christian; McElwain, Michael; Sirbu, Dan; Vanderbei, Robert; White, Victor

2009-08-01

An occulter is used in conjunction with a separate telescope to suppress the light of a distant star. To demonstrate the performance of this system, we are building an occulter experiment in the laboratory at Princeton. This experiment will use an etched silicon mask as the occulter, with some modifications to try to improve the performance. The occulter is illuminated by a diverging laser beam to reduce the aberrations from the optics before the occulter. We present the progress of this experiment and expectations for future work.

Multiple Gamma-Ray Detection Capability of a CeBr3 Detector for Gamma Spectroscopy

Directory of Open Access Journals (Sweden)

A. A. Naqvi

2017-01-01

Full Text Available The newly developed cerium tribromide (CeBr3 detector has reduced intrinsic gamma-ray activity with gamma energy restricted to 1400–2200 keV energy range. This narrower region of background gamma rays allows the CeBr3 detector to detect more than one gamma ray to analyze the gamma-ray spectrum. Use of multiple gamma-ray intensities in elemental analysis instead of a single one improves the accuracy of the estimated results. Multigamma-ray detection capability of a cylindrical 75 mm × 75 mm (diameter × height CeBr3 detector has been tested by analyzing the chlorine concentration in water samples using eight chlorine prompt gamma rays over 517 to 8578 keV energies utilizing a D-D portable neutron generator-based PGNAA setup and measuring the corresponding minimum detection limit (MDC of chlorine. The measured MDC of chlorine for gamma rays with 517–8578 keV energies varies from 0.07 ± 0.02 wt% to 0.80 ± 0.24. The best value of MDC was measured to be 0.07 ± 0.02 wt% for 788 keV gamma rays. The experimental results are in good agreement with Monte Carlo calculations. The study has shown excellent detection capabilities of the CeBr3 detector for eight prompt gamma rays over 517–8578 keV energy range without significant background interference.

Serendipity: Genesis of the Electrochemical Instrumentation at Princeton Applied Research Corporation

Science.gov (United States)

Flato, J. B.

2007-01-01

Princeton Applied Research Corporation (PAR) was a small electronic instrument company in early 1960s but once they entered electrochemistry they were very successful. Since then they have developed and designed successful instruments with their tremendous knowledge and have made great contribution to the field of analytical chemistry.

GATEWAY Demonstrations: Exterior LED Lighting Projects at Princeton University

Energy Technology Data Exchange (ETDEWEB)

Davis, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Evans, WIlliam E. [Princeton Univ., NJ (United States); Murphy, Arthur [Princeton Univ., NJ (United States); Perrin, Tess [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-10-30

This report focuses on four exterior solid-state lighting projects that have been completed at Princeton since 2008, when the University adopted a comprehensive sustainability plan. Through these initial projects – which include a parking garage, a pedestrian path, and two parking lot installations – the school’s facilities engineering staff learned important lessons about SSL technology and gained experience in dealing with the rapidly changing landscape of lighting manufacturers and their suppliers.

Environmental Survey preliminary report, Princeton Plasma Physics Laboratory, Princeton, New Jersey

International Nuclear Information System (INIS)

1989-05-01

This report presents the preliminary findings of the first phase of the Environmental Survey of the United States Department of Energy's (DOE) Princeton Plasma Physics Laboratory (PPPL), conducted June 13 through 17, 1988. The Survey is being conducted by an interdisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Team members are being provided by private contractors. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with PPPL. The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at PPPL, and interviews with site personnel. The Survey team developed a Sampling and Analysis (S ampersand A) Plan to assist in further assessing certain of the environment problems identified during its on-site activities. The S ampersand A plan is being developed by the Idaho National Engineering Laboratory. When completed, the S ampersand A results will be incorporated into the PPPL Survey findings for inclusion in the Environmental Survey Summary Report. 70 refs., 17 figs., 21 tabs

Yield oil of Jatropha curcas seeds of trees irrigated and fertilized with OMM-Tech; Rendimento de oleo de sementes de pinhao manso submetido a irrigacao e adubacao com OMM-Tech

Energy Technology Data Exchange (ETDEWEB)

Evangelista, Adao W.P.; Alves Junior, Jose; Barbosa, Ricardo A.F.; Frazao, Joaquim J.; Araujo, Fausto J.M. [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Escola de Agronomia e Engenharia de Alimentos. Setor de Engenharia Rural], E-mail: awpego@bol.com.br

2010-07-01

The purpose of this study was to evaluate the effects of irrigation and application of Organo-Minerals-Marine + Biotech (OMM-Tech) in yield oil of Jatropha curcas seeds. The experiment was conducted in an experimental area located in Federal University of Lavras, Brazil. A randomized block experimental design with subdivided parcels and three replications was used. The parcels were submitted to different OMM-Tech fertilizer application methods: T1 = control (no OMM-Tech); T2 = soil application (120 kg ha{sup -1} of OMM-Tech in a powder form); T3 = leaf application (OMM-Tech in a liquid form with a 5% concentration); T4 = soil + leaf application (60 kg ha{sup -1} of OMM-Tech in powder form + OMM-Tech in liquid form with a 2.5% concentration). The sub-plots received two different water management treatments: irrigated and no irrigated. A drip irrigation system with drippers spaced by 0.50 m was used. We evaluated yield oil of seeds in first production year. Jatropha trees irrigated showed a higher seeds oil yield than no irrigated trees. However, fertilization with OMM-Tech no influenced seed oil yield. Seeds oil yield of Jatropha trees irrigated was 34%, and no irrigated 27%. (author)

A Distributed Flight Software Design for Satellite Formation Flying Control

National Research Council Canada - National Science Library

Mueller, Joseph B; Brito, Margarita

2003-01-01

.... Princeton Satellite Systems developed the Formation Flying Module (FFM) for TechSat 21 to provide autonomous reconfiguration, formation keeping,and collision avoidance capabilities to the three-satellite cluster...

High Tech M&As

DEFF Research Database (Denmark)

Toppenberg, Gustav

2013-01-01

Technology driven industries have seen fast moving technology changes, higher complexity and reduced product life cycles. These emerging trends present challenges for companies in industries where technology is at the forefront. The extant research deals with ‘low-tech’ industries and majority...... of findings are not applicable to the high-tech industry; in fact this industry has many additional challenges. In this study, we aim to explore the process of M&A in the high-tech industry by drawing on extant literature and empirical field work. The paper outlines a research project in progress which...... intends to provide theoretical, empirical and practical contributions in answering the research question: what role does Operations and IT play in creating value in high-tech M&As? The research adds a needed perspective on M&A literature by unveiling unique challenges and opportunities faced by the M...

FinTech in Taiwan: a case study of a Bank's strategic planning for an investment in a FinTech company

OpenAIRE

Hung, Jui-long; Luo, Binjie

2016-01-01

Introduction: Since 2015 is the year of FinTech in Taiwan, it is worth investigating the challenges that emerged when banks were encouraged to invest in FinTech companies for collaboration. This study aims to identify the strategic considerations in the process of searching for FinTech investment targets. Case description: This study used a case study investigation of a top-5 bank in Taiwan. The major data sources include the meeting notes of the FinTech investment task force and interviews w...

After $74-Million and Counting, Frank Gehry's Library Opens at Princeton

Science.gov (United States)

Carlson, Scott

2008-01-01

In putting up its new, Frank Gehry-designed Lewis Library, Princeton University endured its share of challenges. It constructed models of the building to give the subcontractors a chance to practice. It fired a contractor halfway through the job when the building was past due. It learned that some subcontractors were trying to bribe their way onto…

Measurements of some basic constants of 68Ga(BAT-TECH) as an imaging agent

International Nuclear Information System (INIS)

Chen Huawei; Liu Boli

1994-01-01

The kinetic properties of a new myocardial imaging agent 68 Ga(BAT-TECH) are investigated and its thermodynamic constants are measured. The results are as follows: Citrate→BAT-TECH exchange reaction order is second-order; reaction rate k = 0.50 l/mol·s; activation energy E a = 56.6 kJ/mol; the stability constant of 68 Ga(BAT-TECH) lgβ = 14.9; the acid dissociation constants of BAT-TECH pK 1 = 4.62, pK 2 = 7.68, pK-3 = 8.68, pK 4 = 11.2

Investigation of air transportation technology at Princeton University, 1986

Science.gov (United States)

Stengel, Robert F.

1988-01-01

The Air Transportation Technology Program at Princeton proceeded along four avenues: Guidance and control strategies for penetration of microbursts and wind shear; Application of artificial intelligence in flight control systems; Computer aided control system design; and Effects of control saturation on closed loop stability and response of open loop unstable aircraft. Areas of investigation relate to guidance and control of commercial transports as well as general aviation aircraft. Interaction between the flight crew and automatic systems is a subject of prime concern.

FinTech in Denmark

OpenAIRE

Hategan, Ramona Anamaria; Mockus, Gytis; Trinkunaite, Sarune

2017-01-01

ABSTRACTThe purpose of this paper has been to seek understanding and knowledge of FinTech phenomenon, with a particular focus on the effect of its emergence on the Danish financial sector. We have attempted to answer our initial research question with the help of a theoretical and methodological framework conceived of concepts belonging to Actor-Network Theory, Diffusion of Innovation Theory and alluding to Foucault’s concepts of power, knowledge and discourses. We have followed FinTech as an...

About the reactions sup 3 H(alpha,gamma) sup 7 Li and sup 3 He(alpha,gamma) sup 7 Be

CERN Document Server

Loeffler, W

1993-01-01

In this article the current experimental and theoretical status of the radiative alpha capture reactions sup 3 H(alpha,gamma) sup 7 Li and sup 3 He(alpha,gamma) sup 7 Be and their relations to primordial nucleosynthesis and the solar neutrino problem are reviewed. (author)

Human capital in low-tech manufacturing

DEFF Research Database (Denmark)

Hansen, Teis; Winther, Lars; Hansen, Ronnie Fibæk

2014-01-01

An essential feature associated with the rise of the knowledge economy has been the increasing focus on the importance of human capital as a precondition for economic growth. Human capital has been found to have a positive impact on the economic growth of high-tech industries, however, the influe......An essential feature associated with the rise of the knowledge economy has been the increasing focus on the importance of human capital as a precondition for economic growth. Human capital has been found to have a positive impact on the economic growth of high-tech industries, however......, the influence of human capital on the development of low-tech industries is yet to be analysed. This paper provides such an examination of low-tech industries based on an analysis of employment data within manufacturing industries in Denmark in the period 1993–2006. The findings highlight, first, that human...... capital appears to be equally important for economic development in low-tech industries and, second, that the divide between the large urban regions, especially Copenhagen, and the rest of the country plays the primary role in explaining the geography of human capital. These findings stress the relevance...

Strong piezoelectricity in (1 - x)(K0.4Na0.6)(Nb0.96Sb0.04)O3-xBi0.5K0.5Zr1-ySnyO3 lead-free binary system: identification and role of multiphase coexistence.

Science.gov (United States)

Zheng, Ting; Wu, Jiagang; Xiao, Dingquan; Zhu, Jianguo; Wang, Xiangjian; Xin, Lipeng; Lou, Xiaojie

2015-03-18

Here we report a strong piezoelectric activity in (1 - x)(K0.4Na0.6)(Nb0.96Sb0.04)O3-xBi0.5K0.5Zr1-ySnyO3 lead-free ceramics by designing different phase boundaries. The phase boundaries concerning rhombohedral-orthorhombic-tetragonal (R-O-T) and rhombohedral-tetragonal (R-T) multiphase coexistence were attained by changing BKZS and Sn contents and then were identified by the X-ray diffraction patterns as well as temperature-dependent permittivity and ν1 Raman modes associated with BO6 perovskite octahedron. A high strain (strain = 0.21-0.28% and d33* = 707-880 pm/V) and a strong piezoelectric coefficient (d33 = 415-460 pC/N) were shown in the ceramics located at the multiphase coexistence region. The reported results of this work are superior to that (d33* ∼ 570 pm/V and d33 ∼ 416 pC/N) of the textured (K,Na,Li)(Nb,Ta,Sb)O3 ceramics [Nature 2004, 432, 84]. We believe that the material system of this work will become one of the most promising candidates for piezoelectric actuators.

Routine check and annual maintenance for industrial radiography gamma projector

International Nuclear Information System (INIS)

Shaharudin Sayuti; Abdul Nassir Ibrahim; Sukhri Ahmad; Arshad Yassin; Mohd Junaidi Jaapar; Khairul Anuar Mohd Salleh; Abdul Razak Hamzah

2009-04-01

The main objective of this paper is to share some experience pertaining to gamma projector maintenance programme. In Malaysia there are more than 100 gamma projectors, which need to be maintenance annually. Most of these projectors are Tech-Ops 660 series portable gamma radiography systems, which are used primarily for industrial radiography. The portability feature of the system provides both a safe means of transporting the radioactive source and operating flexibility, particularly useful in areas where access is limited. Generally, the national authorised service centre carries out the annual inspection of this system. In Malaysia, Malaysian Nuclear Agency has been recognised as the National Gamma Projector Maintenance Centre by the Atomic Energy Licensing Board (AELB). In this paper, a brief review of the design and operation is included in the discussion of the maintenance procedure, limitations and improvements of the gamma projector maintenance programme. (author)

Florida Tech professor gets three-year grant

CERN Multimedia

2003-01-01

"Dr. Marc Baarmand, Florida Tech associate professor of physics, has received a three-year grant from the U.S. Department of Energy's Division of High Energy Physics, to conduct research with the Compact Muon Solenoid experiment" (1/3 page).

Is there such a thing as Tech Trans?

DEFF Research Database (Denmark)

Helms, Niels Henrik

2009-01-01

This short paper is an attempt to start a discussion on some basic issues within the concept of Tech Trans especially the relationship between flow and structure within the concept. The background to this paper is first of all an academic interest in the relationship between flow and structure...... explores the concept of Tech Trans, show rooms and innovation systems, and it suggests that the notion of Tech Trans should be defined in the fix point of vertical and horizontal innovation. Finally this paper suggests a mathematical formula for evaluating Tech Trans....

Electronics Technology. Tech Prep Competency Profile.

Science.gov (United States)

Lakeland Tech Prep Consortium, Kirtland, OH.

This tech prep competency profile covers the occupation of electronics technician. Section 1 provides the occupation definition. Section 2 lists development committee members. Section 3 provides the leveling codes--abbreviations for grade level, (by the end of grade 12, by the end of associate degree), academic codes (communications, math, or…

Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet

Directory of Open Access Journals (Sweden)

Paweł Kędzia

2015-06-01

Full Text Available Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet The paper offers a critical evaluation of the power and usefulness of an automatic prompt system based on the extended Relaxation Labelling algorithm in the process of (manual mapping plWordNet on Princeton WordNet. To this end the results of manual mapping – that is inter-lingual relations between plWN and PWN synsets – are juxtaposed with the automatic prompts that were generated for the source language synsets to be mapped. We check the number and type of inter-lingual relations introduced on the basis of automatic prompts and the distance of the respective prompt synsets from the actual target language synsets.

Agglomeration Economies and the High-Tech Computer

OpenAIRE

Wallace, Nancy E.; Walls, Donald

2004-01-01

This paper considers the effects of agglomeration on the production decisions of firms in the high-tech computer cluster. We build upon an alternative definition of the high-tech computer cluster developed by Bardhan et al. (2003) and we exploit a new data source, the National Establishment Time-Series (NETS) Database, to analyze the spatial distribution of firms in this industry. An essential contribution of this research is the recognition that high-tech firms are heterogeneous collections ...

Implementation of a computer-controlled monitoring system at the Princeton AVF Cyclotron

International Nuclear Information System (INIS)

Moore, W.H.

1984-01-01

Stability in the parameters of the beams from cyclotrons is often crucial to the experiments laboratories perform. For example, when running a high-resolution experiment with Princeton's QDDD Spectrograph, there are 42 magnetic elements between the ion source and the detector. Instability or drift in any of these elements can easily nullify the sophisticated dispersion matching and kinematic correction that make such experiments possible with machines. At the Princeton Cyclotron they have purchased a commercial computer-controlled measurement system and interfaced it to 20 elements of their beamline. While this project is still far from complete, the authors have satisfied two of the conditions that must be met for such a system to be useful. These are, firstly, that measurements can be made under the conditions of a working laboratory to 1 part in 100,000, and secondly that the results can be presented in a form useful both to the experimenter concerned with the quality of his data and to the technical staff who must maintain and develop the equipment

Iterest grows for Dutch mid-tech and low-tech greenhouse technology : A greenhouse to suit all tropical conditions (interview with Anne Elings)

NARCIS (Netherlands)

Kierkels, T.; Elings, A.

2014-01-01

The Netherlands sets the standard for high-tech greenhouses worldwide. But increasingly suppliers are looking too at possibilities within the mid-tech and even the low-tech market segments. The Dutch government is supporting demonstration projects, for example in Mexico, East Africa and Malaysia.

Tech Prep Compendium of Models. [Revised].

Science.gov (United States)

Delaware Technical and Community Coll., Dover.

This publication discusses four models for technical preparation (tech prep): program organization; student progress; tech prep data collection and evaluation model; and school/community. The program organization model is divided into four sections. Section I, the business industry, and labor section, shows the flow from craft committee and…

PREFACE: 3rd International Conference on Science & Engineering in Mathematics, Chemistry and Physics 2015 (ScieTech 2015)

Science.gov (United States)

Gaol, F. L.

2015-06-01

The 3rd International Conference on Science & Engineering in Mathematics, Chemistry and Physics 2015 (ScieTech 2015), was held at The Westin Resort Nusa Dua, Bali on 31 January - 1 February 2015. The ScieTech 2015 conference is aimed to bring together researchers, engineers and scientists from around the world. ScieTech 2015 is placed on promoting interaction between the theoretical, experimental, and applied communities, so that a high level exchange is achieved in new and emerging areas within mathematics, chemistry and physics. As we already know that science and technology have brought tremendous benefits for human civilization. People are becoming healthier, wealthier, better educated, more peaceful, increasingly connected, and living longer. Of course, science and technology provide many answers to global challenges, but we will face more complex problems in the next decade due to increasing world population, limitation of energy, and climate change. Therefore, researchers should be more active in conducting research that enables collaboration between one and the others. Interdisciplinary cooperation is absolutely necessary in order to create a smart system for solving the global problems. We need a global and general long-term view of the future with long-range goals for solving complex problems in next decade. Therefore the conference was held to be a forum for researchers from different disciplines to start collaborating and conducting research that provides a solution to the global issues. The theme of ScieTech 2015 was ''The interdisciplinary Application between Mathematics, Chemistry and Physics to enhance the Quality of Life''. We would like to express our sincere gratitude to all in the Technical Program Committee who have reviewed the papers and developed a very interesting conference program as well as the invited and plenary speakers. This year, we received 197 papers and after rigorous review, 59 papers were accepted. The participants came from 19

5th Paris-Princeton Lectures on Mathematical Finance

CERN Document Server

Benth, Fred Espen; Guasoni, Paolo; Manolarakis, Konstantinos; Muhle-Karbe, Johannes; Nee, Colm; Protter, Philip

2013-01-01

The current volume presents four chapters touching on some of the most important and modern areas of research in Mathematical Finance: asset price bubbles (by Philip Protter); energy markets (by Fred Espen Benth); investment under transaction costs (by Paolo Guasoni and Johannes Muhle-Karbe); and numerical methods for solving stochastic equations (by Dan Crisan, K. Manolarakis and C. Nee).The Paris-Princeton Lecture Notes on Mathematical Finance, of which this is the fifth volume, publish cutting-edge research in self-contained, expository articles from renowned specialists. The aim is to produce a series of articles that can serve as an introductory reference source for research in the field.

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for calendar year 1993

International Nuclear Information System (INIS)

Finley, V.L.; Wiezcorek, M.A.

1995-01-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY93. The report is prepared to provide the U.S. Department of Energy (DOE) and the public with information on the level of radioactive and non-radioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs that were undertaken in 1993. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 1951. The long-range goal of the U.S. Magnetic Fusion Energy Research Program is to develop and demonstrate the practical application of fusion power as an alternate energy source. In 1993, PPPL had both of its two large tokamak devices in operation; the Tokamak Fusion Test Reactor (TFTR) and the Princeton Beta Experiment-Modification (PBX-M). PBX-M completed its modifications and upgrades and resumed operation in November 1991. TFTR began the deuterium-tritium (D-T) experiments in December 1993 and set new records by producing over six million watts of energy. The engineering design phase of the Tokamak Physics Experiment (TPX), which replaced the cancelled Burning Plasma Experiment in 1992 as PPPL's next machine, began in 1993 with the planned start up set for the year 2001. In 1993, the Environmental Assessment (EA) for the TFRR Shutdown and Removal (S ampersand R) and TPX was prepared for submittal to the regulatory agencies

Population Studies of Radio and Gamma-Ray Pulsars

Science.gov (United States)

Harding, Alice K; Gonthier, Peter; Coltisor, Stefan

2004-01-01

Rotation-powered pulsars are one of the most promising candidates for at least some of the 40-50 EGRET unidentified gamma-ray sources that lie near the Galactic plane. Since the end of the EGRO mission, the more sensitive Parkes Multibeam radio survey has detected mere than two dozen new radio pulsars in or near unidentified EGRET sources, many of which are young and energetic. These results raise an important question about the nature of radio quiescence in gamma-ray pulsars: is the non-detection of radio emission a matter of beaming or of sensitivity? The answer is very dependent on the geometry of the radio and gamma-ray beams. We present results of a population synthesis of pulsars in the Galaxy, including for the first time the full geometry of the radio and gamma-ray beams. We use a recent empirically derived model of the radio emission and luminosity, and a gamma-ray emission geometry and luminosity derived theoretically from pair cascades in the polar slot gap. The simulation includes characteristics of eight radio surveys of the Princeton catalog plus the Parkes MB survey. Our results indicate that EGRET was capable of detecting several dozen pulsars as point sources, with the ratio of radio-loud to radio-quiet gamma-ray pulsars increasing significantly to about ten to one when the Parkes Survey is included. Polar cap models thus predict that many of the unidentified EGRET sources could be radio-loud gamma- ray pulsars, previously undetected as radio pulsars due to distance, large dispersion and lack of sensitivity. If true, this would make gamma-ray telescopes a potentially more sensitive tool for detecting distant young neutron stars in the Galactic plane.

GAMSOR: Gamma Source Preparation and DIF3D Flux Solution

Energy Technology Data Exchange (ETDEWEB)

Smith, M. A. [Argonne National Lab. (ANL), Argonne, IL (United States); Lee, C. H. [Argonne National Lab. (ANL), Argonne, IL (United States); Hill, R. N. [Argonne National Lab. (ANL), Argonne, IL (United States)

2016-12-15

Nuclear reactors that rely upon the fission reaction have two modes of thermal energy deposition in the reactor system: neutron absorption and gamma absorption. The gamma rays are typically generated by neutron absorption reactions or during the fission process which means the primary driver of energy production is of course the neutron interaction. In conventional reactor physics methods, the gamma heating component is ignored such that the gamma absorption is forced to occur at the gamma emission site. For experimental reactor systems like EBR-II and FFTF, the placement of structural pins and assemblies internal to the core leads to problems with power heating predictions because there is no fission power source internal to the assembly to dictate a spatial distribution of the power. As part of the EBR-II support work in the 1980s, the GAMSOR code was developed to assist analysts in calculating the gamma heating. The GAMSOR code is a modified version of DIF3D and actually functions within a sequence of DIF3D calculations. The gamma flux in a conventional fission reactor system does not perturb the neutron flux and thus the gamma flux calculation can be cast as a fixed source problem given a solution to the steady state neutron flux equation. This leads to a sequence of DIF3D calculations, called the GAMSOR sequence, which involves solving the neutron flux, then the gamma flux, then combining the results to do a summary edit. In this manuscript, we go over the GAMSOR code and detail how it is put together and functions. We also discuss how to setup the GAMSOR sequence and input for each DIF3D calculation in the GAMSOR sequence. With the GAMSOR capability, users can take any valid steady state DIF3D calculation and compute the power distribution due to neutron and gamma heating. The MC2-3 code is the preferable companion code to use for generating neutron and gamma cross section data, but the GAMSOR code can accept cross section data from other sources. To further

Fee-based services in sci-tech libraries

CERN Document Server

Mount, Ellis

2013-01-01

This timely and important book explores how fee-based services have developed in various types of sci-tech libraries. The authoritative contributors focus on the current changing financial aspects of the sci-tech library operation and clarify for the reader how these changes have brought about conditions in which traditional methods of funding are no longer adequate. What new options are open and how they are best being applied in today's sci-tech libraries is fully and clearly explained and illustrated. Topics explored include cost allocation and cost recovery, fees for computer searching, an

Princeton Plasma Physics Laboratory: Annual report, October 1, 1986--September 30, 1987

International Nuclear Information System (INIS)

1987-01-01

This report contains papers on the following topics: Principle Parameters Achieved in Experimental Devices (FY87); Tokamak Fusion Test Reactor; Princeton Beta Experiment-Modification; S-1 Spheromak; Current-Drive Experiment; X-Ray Laser Studies; Theoretical Division; Tokamak Modeling; Compact Ignition Tokamak; Engineering Department; Project Planning and Safety Office; Quality Assurance and Reliability; Administrative Operations; and PPPL Patent Invention Disclosures (FY87)

Develop applications based on android: Teacher Engagement Control of Health (TECH)

Science.gov (United States)

Sasmoko; Manalu, S. R.; Widhoyoko, S. A.; Indrianti, Y.; Suparto

2018-03-01

Physical and psychological condition of teachers is very important because it helped determine the realization of a positive school climate and productive so that they can run their profession optimally. This research is an advanced research on the design of ITEI application that able to see the profile of teacher’s engagement in Indonesia and to optimize the condition is needed an application that can detect the health of teachers both physically and psychologically. The research method used is the neuroresearch method combined with the development of IT system design for TECH which includes server design, database and android TECH application display. The study yielded 1) mental health benchmarks, 2) physical health benchmarks, and 3) the design of Android Application for Teacher Engagement Control of Health (TECH).

Stocks as Money: Convenience Yield and the Tech-Stock Bubble

OpenAIRE

John H. Cochrane

2002-01-01

What caused the rise and fall of tech stocks? I argue that a mechanism much like the transactions demand for money drove many stock prices above the 'fundamental value' they would have had in a frictionless market. I start with the Palm/3Com microcosm and then look at tech stocks in general. High prices are associated with high volume, high volatility, low supply of shares, wide dispersion of opinion, and restrictions on long-term short selling. I review competing theories, and only the conve...

Collaborative Innovation Research on High-tech Industry in the Center Delta

Directory of Open Access Journals (Sweden)

Yan Jingdong

2017-01-01

Full Text Available As a strong point in the Middle Rises Strategy, the Center Delta is of great significance to high-tech industry development. While the collaborative innovation is an effective way to promote the coordinated development of regional economy. This article selected electronic and communication equipment manufacturing industry of 3 provinces in the Center Delta as samples, built evaluation index system of collaborative innovation of high-tech industry, and put the relevant data into the system coordination degree model, in order to get the synergy of industrial innovation system and innovation environment system of 3 provinces. The empirical results shown that the industrial innovation system and innovation environment system coordination degree of Hubei province was the highest, while Jiangxi province was the lowest. Based on the empirical result analysis of the above-mentioned systems, this article put forward suggestions to promote the development of the high-tech industry collaborative innovation in the Center Delta.

gamma-decay of resonance-like structure observed in sup 3 sup 0 Si(p,gamma) sup 3 sup 1 P reaction

CERN Document Server

Kachan, A S; Korda, L P; Mishchenko, V M; Korda, V Y

2002-01-01

gamma-Decay of a resonance-like structure observed in the reaction sup 3 sup 0 Si (p, gamma) sup 3 sup 1 P in the energy region E sub p = 1.4 - 2.7 MeV of accelerated protons is studied. The M1 resonance built on the ground state of sup 3 sup 1 P is identified. The position of the M1 resonance is explained taking into account pairing forces.

Transportable gamma backscattering TOR-3 gauge

International Nuclear Information System (INIS)

Lakhmanov, P.G.; Skoblo, Yu.A.; Timofeev, V.B.

1976-01-01

A portable reflection gamma thickness meter TOR-3 is described having a greater measurement accuracy and wider operation temperature interval as compared to earlier serial instrument TOR-1. Integrated circuits are used in the TOR-3 construction. The principal electric diagram and technical characteristics of TOR-3 are presented

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for calendar year 1994

International Nuclear Information System (INIS)

Finley, V.L.; Wieczorek, M.A.

1996-02-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY94. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs that were undertaken in 1994. The objective of the Annual Site Environmental Report is to document evidence that PPPL's environmental protection programs adequately protect the environment and the public health. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 195 1. The long-range goal of the US Magnetic Fusion Energy Research Program is to develop and demonstrate the practical application of fusion power as an alternate energy source. In 1994, PPPL had one of its two large tokamak devices in operation-the Tokamak Fusion Test Reactor (TFTR). The Princeton Beta Experiment-Modification or PBX-M completed its modifications and upgrades and resumed operation in November 1991 and operated periodically during 1992 and 1993; it did not operate in 1994 for funding reasons. In December 1993, TFTR began conducting the deuterium-tritium (D-T) experiments and set new records by producing over ten at sign on watts of energy in 1994. The engineering design phase of the Tokamak Physics Experiment (T?X), which replaced the cancelled Burning Plasma Experiment in 1992 as PPPL's next machine, began in 1993 with the planned start up set for the year 2001. In December 1994, the Environmental Assessment (EA) for the TFTR Shutdown and Removal (S ampersand R) and TPX was submitted to the regulatory agencies, and a finding of no significant impact (FONSI) was issued by DOE for these projects

Produtividade e rendimento de sementes de pinhão-manso submetido à irrigação e adubação com OMM-Tech Response of Jatropha Curcas L. crop to irrigation and fertilization with OMM-Tech

Directory of Open Access Journals (Sweden)

Adão W. P. Evangelista

2011-04-01

Full Text Available Com o objetivo de avaliar os efeitos da irrigação e aplicação do fertilizante Organo-Minerais-Marinhos + Biotech® (OMM-Tech na produtividade e rendimento do pinhão-manso, um experimento foi instalado em Lavras - MG. O delineamento estatístico utilizado foi o de blocos casualizados, com parcelas subdivididas, contendo três repetições. As parcelas receberam tratamentos constituídos por três formas de aplicação do fertilizante OMM-Tech, ou seja: T1 = Testemunha (Sem OMM-Tech; T2 = via solo (120 kg ha-1 de OMM-Tech na forma de pó; T3 = via foliar (OMM-Tech na forma líquida e na concentração de 5%; e T4 = via solo + foliar (60 kg ha-1 de OMM-Tech na forma de pó + OMM-Tech na forma líquida, na concentração de 2,5%. As sub-parcelas receberam os tratamentos de manejo de água, ou seja, com e sem irrigação. O sistema de irrigação utilizado foi o gotejamento, com emissores espaçados a cada 0,50 m. Para avaliar a resposta da cultura, utilizaram-se dados de produtividade e rendimento de sementes referentes ao primeiro ano de produção. Os tratamentos aplicados produziram efeitos significativos sobre o rendimento e a produtividade da cultura. As plantas irrigadas e adubadas com OMM-Tech pó, via solo, na dose de 120 kg ha-1, foram as que apresentaram o melhor resultado.The purpose of this study was to evaluate the effects of irrigation and application of Organo-Minerals-Marine+Biotech (OMM-Tech in yield and production efficiency of the Jatropha curcas. The experiment was conducted in an experimental area located in Federal University of Lavras, Brazil. A randomized block design with subdivided parcels and three replications was used. The parcels were submitted to different OMM-Tech fertilizer application methods: T1= control (no OMM-Tech; T2 = soil application (120 kg ha-1 of OMM-Tech in a powder form; T3 = leaf application (OMM-Tech in a liquid form with a 5% concentration; T4 = soil + leaf application (60 kg ha-1 of OMM-Tech as

The Methodical Instrumentarium for Analytical Monitoring of Markets for High-Tech Products

Directory of Open Access Journals (Sweden)

Mikaelian Suren G.

2017-10-01

Full Text Available The article is aimed at clarifying the essential characteristics of high-tech products and specifying the features of analytical monitoring of markets for high-tech products. The conceptual approaches to interpretation of the essence of high-tech products as a basic concept in the categorical apparatus for researching the systemic and complex processes of technological development have been clarified. The most efficient instruments for assessing innovation processes in the high-tech sphere have been systematized. The methodical instrumentarium for analytical monitoring of the markets for high-tech products has been clarified. The terminology of a high-tech product has been clarified in order to formulate the methodical instrumentarium for analytical monitoring of market for high-tech products. It has been determined that «high-tech products» are the original basic concept in the categorical apparatus for researching the systemic and complex processes of the high-tech market that needs to be concretized. Conceptual approaches to the essence of high-tech products have been systematized.

TechEdSat

Data.gov (United States)

National Aeronautics and Space Administration — TechEdSat is a 1U CubeSat built by San Jose State University in partnership with NASA Ames Research Center and AAC Microtec. Its mission is to evaluate Space...

Fuzzy model investic do High-tech projektů

Directory of Open Access Journals (Sweden)

Alžběta Kubíčková

2013-10-01

Full Text Available Purpose of the article: Relations among parameters of High-tech projects are very complex, vague, partially inconsistent and multidimensional. Optimal decisions to invest into High-tech companies require top field experts and knowledgeable investors. Therefore the conventional methods of investments analysis are not relevant. Therefore fuzzy logic is introduced. Methodology/methods: A fuzzy knowledge base is a flexible framework for acquisition of vague inconsistent knowledge items which are typical for knowledge economics and consequently for High-tech projects. The pooling of the records and / or observations represents a trade-off between minimal modification of the original data and elimination of inconsistencies among available sets of data. Scientific aim: The paper presents a detailed description of fuzzy model of investment decision making into High-tech firm’s projects. A set of conditional statements was used to formalize the effects of selected variables on investment feasibility of High-tech projects. The main aim is to quantify feasibilities of High-tech projects risk investors make good /not bad decisions. Findings: A set of 50 observations of High-tech companies was transformed into a set of 50 conditional statements using 14 variables. The result is the fuzzy model, which can be used to answer investors’ queries. Two queries are answered and presented in details as an example and as a nucleus of a fuzzy dialogue investor – computer. Conclusions: The main problem is the sparseness of the fuzzy model. Many fuzzy similarities are relatively low and the decision process is therefore often problematic. A much more complex set of variables must be applied to specify the fuzzy model to increase reliability of predictions and decisions.

Crystalline nanotubes of {gamma}-AlOOH and {gamma}-Al{sub 2}O{sub 3}: hydrothermal synthesis, formation mechanism and catalytic performance

Energy Technology Data Exchange (ETDEWEB)

Lu, C L; Lv, J G; Xu, L; Guo, X F; Hou, W H [Key Laboratory of Mesoscopic Chemistry of MOE, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Hu, Y; Huang, H [State Key Laboratory of Materials-Oriented Chemical Engineering, Nanjing University of Technology, Nanjing 210009 (China)], E-mail: guoxf@nju.edu.cn, E-mail: whou@nju.edu.cn

2009-05-27

Crystalline nanotubes of {gamma}-AlOOH and {gamma}-Al{sub 2}O{sub 3} have been synthesized. An anionic surfactant-assisted hydrothermal process yields {gamma}-AlOOH nanotubes, and appropriate calcination treatment of the {gamma}-AlOOH nanotubes yields {gamma}-Al{sub 2}O{sub 3} nanotubes. The nanotubes were characterized by XRD, SEM, TEM, TG-DSC, FTIR and nitrogen adsorption-desorption techniques. Both the {gamma}-AlOOH and {gamma}-Al{sub 2}O{sub 3} nanotubes are crystalline, with a representative length of {approx}500 nm and diameters of 20-40 nm. The {gamma}-Al{sub 2}O{sub 3} nanotubes exhibit a very high mesoporous specific surface area (SSA) of 201.0 m{sup 2} g{sup -1} and a high mesopore volume of 0.68 cm{sup 3} g{sup -1} with an average mesopore size of 27.7 nm, as well as a high microporous SSA of 186.0 m{sup 2} g{sup -1} and a micropore volume of 0.08 cm{sup 3} g{sup -1} with an average micropore size of 0.53 nm. The formation process was discussed and a possible mechanism was proposed, in which a lamellar phase was first formed by camphorsulfonic anions and Al(III) species, and then rolled up to form the crystalline nanotubes under the hydrothermal condition. The catalytic performance of the obtained {gamma}- Al{sub 2}O{sub 3} nanotubes was tested by using the dehydration of ethanol to ethylene as a probe reaction and it was shown that the obtained {gamma}- Al{sub 2}O{sub 3} nanotubes catalyst possesses a higher catalytic activity compared with the {gamma}- Al{sub 2}O{sub 3} nanoparticles.

Mixed alkali effect in borate glasses - electron paramagnetic resonance and optical absorption studies in Cu sup 2 sup + doped xNa sub 2 O- (30 - x)K sub 2 O- 70B sub 2 O sub 3 glasses

CERN Document Server

Chakradhar, R P S; Rao, J L; Ramakrishna, J

2003-01-01

The mixed alkali borate glasses xNa sub 2 O-(30 - x)K sub 2 O-70B sub 2 O sub 3 (5 sup sup 2 B sub 2 sub g) and a weak band on the higher energy side at 22 115 cm sup - sup 1 corresponding to the transition ( sup 2 B sub 1 sub g -> sup 2 E sub g). With x > 5, the higher energy band disappears and the lower energy band shifts slightly to the lower energy side. By correlating the EPR and optical absorption data, the molecular orbital coefficients alpha sup 2 and beta sub 1 sup 2 are evaluated for the different glasses investigated. The values indicate that the in-plane sigma bonding is moderately covalent while the in-plane pi bonding is significantly ionic in nature; these exhibit a minimum with x = 15, showing the MAE. The theoretical values of optical basicity of the glasses have also been evaluated. From optical absorption edges, the optical bandgap energies have been calculated and are found to lie in the range 3.00-3.40 eV. The physical properties of the glasses studied have also been evaluated with respe...

Turbomolecular pump vacuum system for the Princeton Large Torus

International Nuclear Information System (INIS)

Dylla, H.F.

1977-10-01

A turbomolecular pump vacuum system has been designed and installed on the Princeton Large Torus (PLT). Four vertical shaft, oil-bearing, 1500 l/s turbomolecular pumps have been interfaced to the 6400 liter PLT Vacuum vessel to provide a net pumping speed of 3000 l/s for H 2 . The particular requirements and problems of tokamak vacuum systems are enumerated. A vacuum control system is described which protects the vacuum vessel from contamination, and protects the turbomolecular pumps from damage under a variety of possible failure modes. The performance of the vacuum system is presented in terms of pumping speed measurements and residual gas behavior

Ablation of phosphoinositide 3-kinase-gamma reduces the severity of acute pancreatitis.

Science.gov (United States)

Lupia, Enrico; Goffi, Alberto; De Giuli, Paolo; Azzolino, Ornella; Bosco, Ornella; Patrucco, Enrico; Vivaldo, Maria Cristina; Ricca, Marco; Wymann, Matthias P; Hirsch, Emilio; Montrucchio, Giuseppe; Emanuelli, Giorgio

2004-12-01

In pancreatic acini, the G-protein-activated phosphoinositide 3-kinase-gamma (PI3K gamma) regulates several key pathological responses to cholecystokinin hyperstimulation in vitro. Thus, using mice lacking PI3K gamma, we studied the function of this enzyme in vivo in two different models of acute pancreatitis. The disease was induced by supramaximal concentrations of cerulein and by feeding mice a choline-deficient/ethionine-supplemented diet. Although the secretive function of isolated pancreatic acini was identical in mutant and control samples, in both models, genetic ablation of PI3K gamma significantly reduced the extent of acinar cell injury/necrosis. In agreement with a protective role of apoptosis in pancreatitis, PI3K gamma-deficient pancreata showed an increased number of apoptotic acinar cells, as determined by terminal dUTP nick-end labeling and caspase-3 activity. In addition, neutrophil infiltration within the pancreatic tissue was also reduced, suggesting a dual action of PI3K gamma, both in the triggering events within acinar cells and in the subsequent neutrophil recruitment and activation. Finally, the lethality of the choline-deficient/ethionine-supplemented diet-induced pancreatitis was significantly reduced in mice lacking PI3K gamma. Our results thus suggest that inhibition of PI3K gamma may be of therapeutic value in acute pancreatitis.

GAMSOR: Gamma Source Preparation and DIF3D Flux Solution

Energy Technology Data Exchange (ETDEWEB)

Smith, M. A. [TerraPower, Bellevue, WA (United States); Lee, C. H. [TerraPower, Bellevue, WA (United States); Hill, R. N. [TerraPower, Bellevue, WA (United States)

2017-06-28

Nuclear reactors that rely upon the fission reaction have two modes of thermal energy deposition in the reactor system: neutron absorption and gamma absorption. The gamma rays are typically generated by neutron capture reactions or during the fission process which means the primary driver of energy production is of course the neutron interaction. In conventional reactor physics methods, the gamma heating component is ignored such that the gamma absorption is forced to occur at the gamma emission site. For experimental reactor systems like EBR-II and FFTF, the placement of structural pins and assemblies internal to the core leads to problems with power heating predictions because there is no fission power source internal to the assembly to dictate a spatial distribution of the power. As part of the EBR-II support work in the 1980s, the GAMSOR code was developed to assist analysts in calculating the gamma heating. The GAMSOR code is a modified version of DIF3D and actually functions within a sequence of DIF3D calculations. The gamma flux in a conventional fission reactor system does not perturb the neutron flux and thus the gamma flux calculation can be cast as a fixed source problem given a solution to the steady state neutron flux equation. This leads to a sequence of DIF3D calculations, called the GAMSOR sequence, which involves solving the neutron flux, then the gamma flux, and then combining the results to do a summary edit. In this manuscript, we go over the GAMSOR code and detail how it is put together and functions. We also discuss how to setup the GAMSOR sequence and input for each DIF3D calculation in the GAMSOR sequence.

Role of CD3 gamma in T cell receptor assembly

DEFF Research Database (Denmark)

Dietrich, J; Neisig, A; Hou, X

1996-01-01

. In contrast, treatment of T cells with tunicamycin suggested that N-linked glycosylation of CD3 delta is required for TCR assembly. Site-directed mutagenesis of the acidic amino acid in the TM domain of CD3 gamma demonstrated that this residue is involved in TCR assembly probably by binding to Ti beta......The T cell receptor (TCR) consists of the Ti alpha beta heterodimer and the associated CD3 gamma delta epsilon and zeta 2 chains. The structural relationships between the subunits of the TCR complex are still not fully known. In this study we examined the role of the extracellular (EC...... predicted in the EC domain of CD3 gamma. Site-directed mutagenesis demonstrated that these sites play a crucial role in TCR assembly probably by binding to CD3 epsilon. Mutagenesis of N-linked glycosylation sites showed that glycosylation of CD3 gamma is not required for TCR assembly and expression...

TechTrends 2010-2015: A Content Analysis

Science.gov (United States)

Stauffer, Eric

2017-01-01

This study is a content analysis of articles published within the journal "TechTrends" from 2000 to 2015. The study reveals that the publication "TechTrends" has increased the overall number of peer reviewed original papers over the last 6 years. The author describes the proportion of these original papers per volume and…

2009 Navy ManTech Project Book

Science.gov (United States)

2009-01-01

build a hybrid laser / GMAW system that combined deep keyhole penetration of laser welding with the high metal deposition rate of GMAW, enabling...committed to the successful outcome of the ManTech project. In addition, this close working relationship between the parties provides ManTech with a longer...the cost and time to build and repair Navy ships. The Center works closely with the Navy’s acquisition community and the shipbuilding industry to

On the Measurement of Morphology and Its Change.

Science.gov (United States)

1982-03-01

that transitions within the ceratopsian dinosaurs necessitated overly complex or impossible grid deformations. THETA-RHO ANALYSIS An alternative...1982, A robust comparison of the three dimensional configurations of protein molelcules. Tech. Rpt. 224, Ser. 2, Dept. Statistics Princeton Univ., 18 p

Verification of Gamma-ray Sensitivity for BF3 Neutron Detection System

International Nuclear Information System (INIS)

Choi, Yu Sun; Cho, Jin Bok; Lyou, Seok Jean

2016-01-01

The BF3(Boron Tri-Fluorides) gas filled neutron detector(hereafter BF3 Detector) is commonly used for nuclear reactor’s startup channel due to its relatively high neutron efficiency and good discrimination against gamma-ray backgrounds. In order to measure how much this gamma-ray will affect on BF3 neutron detector performance in view of gamma noise discrimination, Multi-Channel Analyzer(MCA) is utilized for spectrum based signal analysis. The pre-test of BF3 Detector should be performed in an area where the ionization does not exceed 2.5 micro Gy/Hr(Ref.1). In this paper, the discrimination level (Voltage Unit) is verified by experimentally measurement if that discrimination level is acceptable within the criteria or not before installation. The maximum discrimination level, so called LLD, is determined by experimentally measurement. This BF3 Detector (LND20372) is insensitive under 540 micro Gy/Hr of gamma ray and 0.3V of LLD could cut off a background and gamma induced signal in a laboratory. MCA could be a convenient tool for spectrum analysis of signals that induced from gamma ray and a time saving tool rather than oscilloscope investigation due to its function to integrate all input signals at a sudden duration

Regimes of operation in the Princeton Large Torus

Energy Technology Data Exchange (ETDEWEB)

Hosea, J.C.

1979-10-01

In the quest for optimum discharge conditions in the Princeton Large Torus (PLT), a variety of discharge regimes have been produced. These separate broadly into two main categories - those regimes with m greater than or equal to 2 oscillatory MHD instabilities and often hollow electron profiles for tungsten limiters, and those regimes for which the electron temperature is sufficiently peaked to support the internal sawtooth or near-sawtooth (m = 1) instability. The internal sawtooth regime is found to be optimum for confinement but to be more difficult to select when low-Z impurity concentrations have been reduced with low power discharge cleaning or gettering to permit extension of the high density operation limit. Gas programming is used to cool the plasma periphery, thereby reducing the high-Z impurity concentrations and causing the current channel to constrict into the sawtooth regime, and then to attain the desired plasma density. With discharges selected in this manner, gross energetic confinement times up to approx. 100 msec have been obtained at densities of approx. 10/sup 14/ cm/sup -3/, and very high ion and electron temperatures have been produced with neutral beam injection heating at lower densities with no observable deleterious effect on energy confinement.

High-tech industries' overseas investment performance evaluation - Application of data envelopment analysis

Directory of Open Access Journals (Sweden)

Ridong Hu

2013-12-01

Full Text Available With the rapid change of the social environment, Mainland China has become a new economic market due to the great domestic demand caused by its enormous population and the increasing economic growth rate. Taiwanese businesses have gradually turned to develop in China under the pressure of increasing domestic wages and land costs for expanding factories as well as the enhancement of environmental protection. Mainland China presents the advantages of ample land, low labor costs, monoethnicity, and easy language communication making it an attractive major investment location for Taiwanese high-tech industries. Data Envelopment Analysis (DEA is applied to measure overseas investment efficiency evaluation of Taiwanese high-tech businesses in China, where the Delphi Method is used for selecting the inputs of the number of employees, R&D expenses, and gross sales in total assets. Sensitivity Analysis is further utilized for acquiring the most efficient unit and individual units with operating efficiency. The research results show that 1.Three high-tech businesses that present constant returns to scale perform optimally with overseas investment efficiency 2.Two high-tech companies with decreasing returns to scale appear that they could improve the overseas investment efficiency by decreasing the scale to enhancing the marginal returns, and 3.Sixteen high-tech enterprises reveal increasing returns to scale, showing that they could expand the scale to enhance the marginal returns and further promote efficiency.

FinTech transformation: how it-enabled innovations shape the financial sector

OpenAIRE

Zavolokina, Liudmila; Dolata, Mateusz; Schwabe, Gerhard

2016-01-01

FinTech, the phenomenon which spans over the areas of information technologies and financial innovation, is currently on the rise and is gaining more and more attention from practitioners, investors and researchers. FinTech is broadly discussed by the media, which constitutes its understanding and represents social opinion, however, this perception of FinTech should be supported by empirical evidences. Therefore, we examine five Swiss FinTech companies through the lens of the conceptual frame...

Handheld real-time volumetric 3-D gamma-ray imaging

Energy Technology Data Exchange (ETDEWEB)

Haefner, Andrew, E-mail: ahaefner@lbl.gov [Lawrence Berkeley National Lab – Applied Nuclear Physics, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Barnowski, Ross [Department of Nuclear Engineering, UC Berkeley, 4155 Etcheverry Hall, MC 1730, Berkeley, CA 94720 (United States); Luke, Paul; Amman, Mark [Lawrence Berkeley National Lab – Applied Nuclear Physics, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Vetter, Kai [Department of Nuclear Engineering, UC Berkeley, 4155 Etcheverry Hall, MC 1730, Berkeley, CA 94720 (United States); Lawrence Berkeley National Lab – Applied Nuclear Physics, 1 Cyclotron Road, Berkeley, CA 94720 (United States)

2017-06-11

This paper presents the concept of real-time fusion of gamma-ray imaging and visual scene data for a hand-held mobile Compton imaging system in 3-D. The ability to obtain and integrate both gamma-ray and scene data from a mobile platform enables improved capabilities in the localization and mapping of radioactive materials. This not only enhances the ability to localize these materials, but it also provides important contextual information of the scene which once acquired can be reviewed and further analyzed subsequently. To demonstrate these concepts, the high-efficiency multimode imager (HEMI) is used in a hand-portable implementation in combination with a Microsoft Kinect sensor. This sensor, in conjunction with open-source software, provides the ability to create a 3-D model of the scene and to track the position and orientation of HEMI in real-time. By combining the gamma-ray data and visual data, accurate 3-D maps of gamma-ray sources are produced in real-time. This approach is extended to map the location of radioactive materials within objects with unknown geometry.

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1999

International Nuclear Information System (INIS)

Finley, Virginia

2001-01-01

The results of the 1999 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the U.S. Department of Energy and the public with information on the level of radioactive and non-radioactive pollutants (if any) that are added to the environment as a result of PPPL's operations. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 1999. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 1951. The long-range goal of the U.S. Magnetic Fusion Energy Research Program is to create innovations to make fusion power a practical reality--an alternative energy source. 1999 marked the first year of National Spherical Torus Experiment (NSTX) operations and Tokamak Fusion Test Reactor (TFTR) dismantlement and deconstruction activities. A collaboration among fourteen national laboratories, universities, and research institutions, the NSTX is a major element in the U.S. Fusion Energy Sciences Program. It has been designed to test the physics principles of spherical torus (ST) plasmas. The ST concept could play an important role in the development of smaller, more economical fusion reactors. With its completion within budget and ahead of its target schedule, NSTX first plasma occurred on February 12, 1999. The 1999 performance of the Princeton Plasma Physics Laboratory was rated ''outstanding'' by the U.S. Department of Energy in the Laboratory Appraisal report issued early in 2000. The report cited the Laboratory's consistently excellent scientific and technological achievements, its successful management practices, and included high marks in a host of other areas including environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1999

Energy Technology Data Exchange (ETDEWEB)

Virginia Finley

2001-04-20

The results of the 1999 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the U.S. Department of Energy and the public with information on the level of radioactive and non-radioactive pollutants (if any) that are added to the environment as a result of PPPL's operations. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 1999. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 1951. The long-range goal of the U.S. Magnetic Fusion Energy Research Program is to create innovations to make fusion power a practical reality--an alternative energy source. 1999 marked the first year of National Spherical Torus Experiment (NSTX) operations and Tokamak Fusion Test Reactor (TFTR) dismantlement and deconstruction activities. A collaboration among fourteen national laboratories, universities, and research institutions, the NSTX is a major element in the U.S. Fusion Energy Sciences Program. It has been designed to test the physics principles of spherical torus (ST) plasmas. The ST concept could play an important role in the development of smaller, more economical fusion reactors. With its completion within budget and ahead of its target schedule, NSTX first plasma occurred on February 12, 1999. The 1999 performance of the Princeton Plasma Physics Laboratory was rated ''outstanding'' by the U.S. Department of Energy in the Laboratory Appraisal report issued early in 2000. The report cited the Laboratory's consistently excellent scientific and technological achievements, its successful management practices, and included high marks in a host of other areas including environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary

Displacement in new economy labor markets: Post-displacement wage loss in high tech versus low tech cities.

Science.gov (United States)

Davis, Daniel J; Rubin, Beth A

2016-11-01

While scholars and politicians tout education as the salve to employment disruptions, we argue that the geography of the new economy, and the social closure mechanisms that geography creates, may be just as important as individuals' characteristics for predicting post-displacement wage loss (or gain). We use data from the 2012 Displaced Workers ement of the Current Population Survey and from the 2010 United States Census to test hypotheses linking local labor markets in different industrial contexts to post-displacement wage loss. Our results point to age as a closure mechanism, and to the partially protective effect of education in high-tech versus low-tech economic sectors. This study is the first to use national level data to examine how employment in high-tech cities influences post-displacement wages. These findings are relevant both for theorizing about the new economy and for public policy. Copyright © 2016 Elsevier Inc. All rights reserved.

Arkansas Tech University TRIGA nuclear reactor

International Nuclear Information System (INIS)

Sankoorikal, J.; Culp, R.; Hamm, J.; Elliott, D.; Hodgson, L.; Apple, S.

1990-01-01

This paper describes the TRIGA nuclear reactor (ATUTR) proposed for construction on the campus of Arkansas Tech University in Russellville, Arkansas. The reactor will be part of the Center for Energy Studies located at Arkansas Tech University. The reactor has a steady state power level of 250 kW and can be pulsed with a maximum reactivity insertion of $2.0. Experience gained in dismantling and transporting some of the components from Michigan State University, and the storage of these components will be presented. The reactor will be used for education, training, and research. (author)

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for calendar year 1990

Energy Technology Data Exchange (ETDEWEB)

Stencel, J.R.; Finley, V.L.

1991-12-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory for CY90. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health. The PPPL has engaged in fusion energy research since 1951 and in 1990 had one of its two large tokamak devices in operation: namely, the Tokamak Fusion Test Reactor. The Princeton Beta Experiment-Modification is undergoing new modifications and upgrades for future operation. A new machine, the Burning Plasma Experiment -- formerly called the Compact Ignition Tokamak -- is under conceptual design, and it is awaiting the approval of its draft Environmental Assessment report by DOE Headquarters. This report is required under the National Environmental Policy Act. The long-range goal of the US Magnetic Fusion Energy Research Program is to develop and demonstrate the practical application of fusion power as an alternate energy source. 59 refs., 39 figs., 45 tabs.

Evaluation of an LED Retrofit Project at Princeton University’s Carl Icahn Laboratory

Energy Technology Data Exchange (ETDEWEB)

Davis, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Murphy, Arthur L. [Princeton Univ., NJ (United States); Perrin, Tess E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-11-25

The LED lighting retrofit at the Carl Icahn Laboratory of the Lewis-Sigler Institute for Integrative Genomics was the first building-wide interior LED project at Princeton University, following the University’s experiences from several years of exterior and small-scale interior LED implementation projects. The project addressed three luminaire types – recessed 2x2 troffers, cove and other luminaires using linear T8 fluorescent lamps, and CFL downlights - which combined accounted for over 564,000 kWh of annual energy, over 90% of the lighting energy used in the facility. The Princeton Facilities Engineering staff used a thorough process of evaluating product alternatives before selecting an acceptable LED retrofit solution for each luminaire type. Overall, 815 2x2 luminaires, 550 linear fluorescent luminaires, and 240 downlights were converted to LED as part of this project. Based solely on the reductions in wattage in converting from the incumbent fluorescent lamps to LED retrofit kits, the annual energy savings from the project was over 190,000 kWh, a savings of 37%. An additional 125,000 kWh of energy savings is expected from the implementation of occupancy and task-tuning control solutions, which will bring the total savings for the project to 62%.

Ball handling system for tech united soccer robots

NARCIS (Netherlands)

Gerrits, K.P.; Molengraft, van de M.J.G.; Hoogendijk, R.; Steinbuch, M.

2012-01-01

This pre-master end project is done for team Tech United of Eindhoven University of Technology. The Tech United team is a group of students and employees who design, build and program soccer robots to compete in the RoboCup Middle Size League. RoboCup is a worldwide competition in which two teams of

P.S. I love you...and other growth hacking strategies used by disruptive tech start-ups : A case study on the relevance and enactment of growth hacking by Sweden's tech start-ups

OpenAIRE

Bergendal, Taghrid Sara

2017-01-01

Disruption innovation theory has been the zeitgeist for building globally disruptive tech companies since 1997. One decade later, disruptive tech start-ups are moving away from traditional marketing strategies in favour of growth hacking. There is a seemingly growing consensus by online tech experts, tech entrepreneurs, advisors and investors, that suggests that growth hacking is becoming increasingly important practice for disruption based tech start-ups. Furthermore, Sweden is becoming the ...

TurboTech Technical Evaluation Automated System

Science.gov (United States)

Tiffany, Dorothy J.

2009-01-01

TurboTech software is a Web-based process that simplifies and semiautomates technical evaluation of NASA proposals for Contracting Officer's Technical Representatives (COTRs). At the time of this reporting, there have been no set standards or systems for training new COTRs in technical evaluations. This new process provides boilerplate text in response to interview style questions. This text is collected into a Microsoft Word document that can then be further edited to conform to specific cases. By providing technical language and a structured format, TurboTech allows the COTRs to concentrate more on the actual evaluation, and less on deciding what language would be most appropriate. Since the actual word choice is one of the more time-consuming parts of a COTRs job, this process should allow for an increase in quantity of proposals evaluated. TurboTech is applicable to composing technical evaluations of contractor proposals, task and delivery orders, change order modifications, requests for proposals, new work modifications, task assignments, as well as any changes to existing contracts.

Estate of Behringer v. Medical Center at Princeton.

Science.gov (United States)

1991-04-25

Dr. William Behringer, a staff member at the Medical Center at Princeton, was diagnosed with AIDS. Afterwards, Behringer received numerous phone calls from various people expressing awareness of his illness, and his surgical privileges at the Center were suspended. He sued the Medical Center, alleging a breach of confidentiality and discrimination. The Superior Court of New Jersey, Mercer County, held that the Medical Center had breached its duty of confidentiality when it failed to take reasonable precautions to prevent Behringer's AIDS diagnosis from becoming public knowledge. Nevertheless, although New Jersey's anti-discrimination statutes protected Dr. Behringer from having his surgical privileges revoked, the Medical Center demonstrated a reasonable risk to patients that justified suspending Dr. Behringer's privileges, or alternatively, requiring his patients' informed consent before operating. The court found that the risk included not only actual HIV transmission, but also the possibility of surgical accidents.

Assisting the rehabilitation by hi-tech

Directory of Open Access Journals (Sweden)

Mateusz Tomanek

2017-03-01

Full Text Available High-tech, which the use is becoming increasingly popular in medicine, media and education has several advantages as increasing the number of persons to whom these services can hit. Example of such activities is the use of videoconference during rehabilitation, where patients perform basic exercises at home, and physiotherapist could control the movement by on-line video. The use of modern technology is only assisting the rehabilitation, rather than a complete replacement. As the purpose of the article was adopted to show the range of possibilities for the use of high-tech in rehabilitation.

{gamma} decay of spin-isospin states in {sup 13}N via ({sup 3}He, t{gamma}) reaction

Energy Technology Data Exchange (ETDEWEB)

Ihara, F; Akimune, H; Daito, I; Fujimura, H; Fujiwara, M; Inomata, T; Ishibashi, K; Yoshida, H [Osaka Univ., Ibaraki (Japan). Research Center for Nuclear Physics; Fujita, Y

1998-03-01

Spin-isospin states in {sup 13}N have been studied by means of the {sup 13}C ({sup 3}He,t) reaction at and near zero degree, at E({sup 3}He)=450 MeV. Decayed {gamma}-rays from each state were measured at backward angle in coincidence with the ejectile tritons. The branching ratio of {gamma} decay for some of spin-isospin states were determined and were compared to those from previous data. (author)

CH3-ReO3 on gamma-Al2O3: understanding its structure, initiation,and reactivity in olefin metathesis

Energy Technology Data Exchange (ETDEWEB)

Salameh, Alain; Joubert, Jerome; Baudouin, Anne; Lukens, Wayne; Delbecq, Francoise; Sautet, Philippe; Basset, Jean Marie; Coperet,Christophe

2007-01-20

Me-ReO3 on gamma-alumina: understanding the structure, theinitiation and thereactivity of a highly active olefin metathesiscatalyst Heterolytic splitting of the C-H bond of the methyl group ofCH3ReO3 on AlsO reactive sites of alumina as a way to generate the activesite of CH3ReO3 supported on gamma-Al203.

Geant4 simulation of a 3D high resolution gamma camera

International Nuclear Information System (INIS)

Akhdar, H.; Kezzar, K.; Aksouh, F.; Assemi, N.; AlGhamdi, S.; AlGarawi, M.; Gerl, J.

2015-01-01

The aim of this work is to develop a 3D gamma camera with high position resolution and sensitivity relying on both distance/absorption and Compton scattering techniques and without using any passive collimation. The proposed gamma camera is simulated in order to predict its performance using the full benefit of Geant4 features that allow the construction of the needed geometry of the detectors, have full control of the incident gamma particles and study the response of the detector in order to test the suggested geometries. Three different geometries are simulated and each configuration is tested with three different scintillation materials (LaBr3, LYSO and CeBr3)

Effects of farming systems on ground-water quality at the management systems evaluation area near Princeton, Minnesota, 1991-95

Science.gov (United States)

Landon, M.K.; Delin, G.N.; Lamb, J.A.; Anderson, J.L.; Dowdy, R.H.

1998-01-01

Ground-water quality in an unconfined sand and gravel aquifer was monitored during 1991-95 at the Minnesota Management Systems Evaluation Area (MSEA) near Princeton, Minnesota. The objectives of the study were to:

Synchrotron measurement of the 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of nickel-base superalloys

Energy Technology Data Exchange (ETDEWEB)

Epishin, Alexander; Link, Thomas; Ulbricht, Alexander; Bansal, Mamta [Technical Univ. of Berlin (Germany). Inst. of Material Science and Technology; Zizak, Ivo [Helmholtz-Zentrum Berlin for Materials and Energy BESSY II, Berlin (Germany)

2011-12-15

The 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of a nickel-base superalloy was investigated using synchrotron X-ray radiation and a position sensitive area detector. The measurements were performed on the 4{sup th} generation single-crystal nickel-base superalloy TMS138. The results show that X-ray reflections from non-cubic crystallographic planes have a complex 3D shape which changes during rafting. The 3D intensity distributions contain information about the spacing of the planes and their orientation as well. Whereas h00 reflections show the usual splitting into a {gamma}{sup '} and one {gamma}-subreflection, the hh0 and hhh reflections show two and three {gamma}-peaks respectively, resulting from the different types of {l_brace}100{r_brace} matrix channels. Therefore, these 3D diffraction measurements supply additional information about the spatial distribution of microstrains. (orig.)

High-Tech Security Help.

Science.gov (United States)

Flanigan, Robin L.

2000-01-01

Advocates embrace high-tech security measures as necessary to avoid Columbine-style massacres. Critics contend that school systems can go overboard, making students feel less safe and too closely scrutinized. Current electronic, biometric, and computer-mapping devices and school applications are discussed. Vendors are listed. (MLH)

Initial Gamma Spectrometry Examination of the AGR-3/4 Irradiation

Energy Technology Data Exchange (ETDEWEB)

Harp, Jason M.; Demkowicz, Paul A.; Stempien, John D.

2016-11-01

The initial results from gamma spectrometry examination of the different components from the combined third and fourth US Advanced Gas Reactor Fuel Development TRISO-coated particle fuel irradiation tests (AGR-3/4) have been analyzed. This experiment was designed to provide information about in-pile fission product migration. In each of the 12 capsules, a single stack of four compacts with designed-to-fail particles surrounded by two graphitic diffusion rings (inner and outer) and a graphite sink were irradiated in the Idaho National Laboratory’s Advanced Test Reactor. Gamma spectrometry has been used to evaluate the gamma-emitting fission product inventory of compacts from the irradiation and evaluate the burnup of these compacts based on the activity of the radioactive cesium isotopes (Cs-134 and Cs-137) in the compacts. Burnup from gamma spectrometry compares well with predicted burnup from simulations. Additionally, inner and outer rings were also examined by gamma spectrometry both to evaluate the fission product inventory and the distribution of gamma-emitting fission products within the rings using gamma emission computed tomography. The cesium inventory of the scanned rings compares acceptably well with the expected inventory from fission product transport modeling. The inventory of the graphite fission product sinks is also being evaluated by gamma spectrometry.

MERCURE-3, Gamma Attenuation by Line-of-Flight in 3-D Heterogeneous Geometry

International Nuclear Information System (INIS)

Devillers, C.; Szondi, Egon J.

1995-01-01

1 - Nature of physical problem solved: MERCURE-3/PC performs three- dimensional gamma shielding calculations around extended gamma sources. These may be even non-homogeneous. 2 - Method of solution: The algorithm of the code is the point kernel integration model combined with buildup calculations. The geometry can be described analytically using linear and quadratic surfaces of any type. A standard gamma cross section library is provided with the code. 3 - Restrictions on the complexity of the problem: To make possible the solution of large problems, all the problem size-dependent arrays are declared using symbolic constants. The default values are sufficient for most of the practical problems (e.g. 100 space elements; 100 equations; 300 surface elements; 40 materials; 25 energy groups, etc.); the code uses in this case only 200-250 Kbytes of memory, depending on the compiler used. If the problem is very large, the symbolic constants have to be modified, and the code has to be compiled using the Lahey F77L3 (protected mode) compiler

Nurturing a FinTech Ecosystem

DEFF Research Database (Denmark)

Leong, Carmen; Tan, Barney; Xiao, Xiao

2017-01-01

Financial technology, or FinTech, involves the design and delivery of financial products and services through technology. It impacts financial institutions, regulators, customers, and merchants across a wide range of industries. Pervasive digital technologies are challenging the fundamentals...... of the highly regulated financial sector, leading to the emergence of non-traditional payment systems, peer-to-peer money exchanges and increased turbulence in currency markets. This case study explores the development of a FinTech company in China that offers microloans to college students. Five lessons...... learned are presented for organizations to better manage the challenges and to leverage the opportunities amidst the disruption of financial sector. Our findings also shed light on how digital technology 1) offers the strategic capability for a firm to occupy a market niche in financial sector, 2) enables...

Novel Radiobiological Gamma Index for Evaluation of 3-Dimensional Predicted Dose Distribution

Energy Technology Data Exchange (ETDEWEB)

Sumida, Iori, E-mail: sumida@radonc.med.osaka-u.ac.jp [Department of Radiation Oncology, Osaka University Graduate School of Medicine, Osaka (Japan); Yamaguchi, Hajime; Kizaki, Hisao; Aboshi, Keiko; Tsujii, Mari; Yoshikawa, Nobuhiko; Yamada, Yuji [Department of Radiation Oncology, NTT West Osaka Hospital, Osaka (Japan); Suzuki, Osamu; Seo, Yuji [Department of Radiation Oncology, Osaka University Graduate School of Medicine, Osaka (Japan); Isohashi, Fumiaki [Department of Radiation Oncology, NTT West Osaka Hospital, Osaka (Japan); Yoshioka, Yasuo [Department of Radiation Oncology, Osaka University Graduate School of Medicine, Osaka (Japan); Ogawa, Kazuhiko [Department of Radiation Oncology, NTT West Osaka Hospital, Osaka (Japan)

2015-07-15

Purpose: To propose a gamma index-based dose evaluation index that integrates the radiobiological parameters of tumor control (TCP) and normal tissue complication probabilities (NTCP). Methods and Materials: Fifteen prostate and head and neck (H&N) cancer patients received intensity modulated radiation therapy. Before treatment, patient-specific quality assurance was conducted via beam-by-beam analysis, and beam-specific dose error distributions were generated. The predicted 3-dimensional (3D) dose distribution was calculated by back-projection of relative dose error distribution per beam. A 3D gamma analysis of different organs (prostate: clinical [CTV] and planned target volumes [PTV], rectum, bladder, femoral heads; H&N: gross tumor volume [GTV], CTV, spinal cord, brain stem, both parotids) was performed using predicted and planned dose distributions under 2%/2 mm tolerance and physical gamma passing rate was calculated. TCP and NTCP values were calculated for voxels with physical gamma indices (PGI) >1. We propose a new radiobiological gamma index (RGI) to quantify the radiobiological effects of TCP and NTCP and calculate radiobiological gamma passing rates. Results: The mean RGI gamma passing rates for prostate cases were significantly different compared with those of PGI (P<.03–.001). The mean RGI gamma passing rates for H&N cases (except for GTV) were significantly different compared with those of PGI (P<.001). Differences in gamma passing rates between PGI and RGI were due to dose differences between the planned and predicted dose distributions. Radiobiological gamma distribution was visualized to identify areas where the dose was radiobiologically important. Conclusions: RGI was proposed to integrate radiobiological effects into PGI. This index would assist physicians and medical physicists not only in physical evaluations of treatment delivery accuracy, but also in clinical evaluations of predicted dose distribution.

Innovative Behaviour of High-Tech Internationalized Firms: Survey Results from Poland

Directory of Open Access Journals (Sweden)

Krzysztof Wach

2016-09-01

Full Text Available Objective: The aim of the article is to identify and verify the relationship between internationalization and innovativeness as well as innovative behaviour of high-tech businesses in Polish context. Research Design & Methods: A quantitative research design was employed. A survey was conducted on the sample of 263 firms operating in high-tech industries in Poland. To verify the assumed relationships statistical instruments were used, including descriptive statistics, Chi-Square test, the Kruskal-Wallis test and multivariate regression. Findings: The level of innovativeness of investigated hi-tech firms was relatively high. Results suggest that the innovativeness of a business contributes to the intensification of the internationalization process of firms operating in high-tech industries. The regression model confirms the dependence of internationalization on three innovative behaviours, such as the general evaluation of innovativeness of the firm, the pace of innovation diffusion and the number of implemented innovations. Implications & Recommendations: Polish high-tech businesses seem to be relatively well internationalized, especially in comparisons to general business population. Policy makers should continue to support innovativeness of Polish economy, but especia­lly these industries which are highly innovative. Contribution & Value Added: The research presented in the article seems to be one of the first in Poland investigating into internationalization and innovation in high-tech industries. The results are in line with the majority of empirical evidence worldwide. The preliminary link between innovation and internationalization among Polish high–tech businesses was confirmed.

Definition of a short-cut methodology for assessing earthquake-related Na-Tech risk

International Nuclear Information System (INIS)

Busini, Valentina; Marzo, Enrico; Callioni, Andrea; Rota, Renato

2011-01-01

Highlights: → In industrial sites located in natural hazard-prone areas technological accidents may be triggered by natural events, generating the so-called Na-Tech accidents. → In this paper, a qualitative screening methodology for assessing the earthquake Na-Tech risk has been developed with the aim of identifying which situations deserve a much more expensive Quantitative Risk Analysis. → The simple procedure developed, which summarizes in a suitable Key Hazard Indicator the Na-Tech risk level, has been validated by comparing its results with those of some Quantitative Risk Analyses involving also Na-Tech events and previously presented in the literature. - Abstract: Na-Tech (Natural and Technological) refers to industrial accidents triggered by natural events such as storms, earthquakes, flooding, and lightning. Herein, a qualitative methodology for the initial assessment of earthquake Na-Tech risk has been developed as a screening tool to identify which situations require a much more expensive Quantitative Risk Analysis (QRA). The proposed methodology, through suitable Key Hazard Indicators (KHIs), identifies the Na-Tech risk level associated with a given situation (i.e., a process plant located in a given territory), using the Analytical Hierarchy Process as a multi-criteria decision tool for the evaluation of such KHIs. The developed methodology was validated by comparing its computational results with QRA results that involved Na-Tech events previously presented in literature.

Does Service Innovation Matter in High-Tech Industry

Directory of Open Access Journals (Sweden)

Chao-Hung Wang

2014-05-01

Full Text Available Service innovation has been found to be a major driver of innovation performance in service contexts. But this issue raises questions concerning the extent to which the relationship between market orientation and innovation performance holds in the high-tech industry. Relatively little research has examined how market orientation contributes to innovation performance through service innovation. We here report an empirical study of 235 Taiwanese high-tech firms to examine the influence of market orientation on service innovation and innovation performance. A noteworthy finding is that the impacts of customer orientation and competitor orientation on innovation performance are fully mediated by service innovation. However, service innovation does only partially mediate the relationship between inter-functional orientation and innovation performance. The findings of this study should help managers consider appropriate service innovation in high-tech industry.

Development of an Extreme Environment Materials Research Facility at Princeton

International Nuclear Information System (INIS)

Cohen, A.B.; Gentile, C.A.; Tully, C.G.; Austin, R.; Calaprice, F.; McDonald, K.; Ascione, G.; Baker, G.; Davidson, R.; Dudek, L.; Grisham, L.; Kugel, H.; Pagdon, K.; Stevenson, T.; Woolley, R.; Zwicker, A.

2010-01-01

The need for a fundamental understanding of material response to a neutron and/or high heat flux environment can yield development of improved materials and operations with existing materials. Such understanding has numerous applications in fields such as nuclear power (for the current fleet and future fission and fusion reactors), aerospace, and other research fields (e.g., high-intensity proton accelerator facilities for high energy physics research). A proposal has been advanced to develop a facility for testing various materials under extreme heat and neutron exposure conditions at Princeton. The Extreme Environment Materials Research Facility comprises an environmentally controlled chamber (48 m 3 ) capable of high vacuum conditions, with extreme flux beams and probe beams accessing a central, large volume target. The facility will have the capability to expose large surface areas (1 m 2 ) to 14 MeV neutrons at a fluence in excess of 10 13 n/s. Depending on the operating mode. Additionally beam line power on the order of 15-75 MW/m 2 for durations of 1-15 seconds are planned. The multi-second duration of exposure can be repeated every 2-10 minutes for periods of 10-12 hours. The facility will be housed in the test cell that held the Tokamak Fusion Test Reactor (TFTR), which has the desired radiation and safety controls as well as the necessary loading and assembly infrastructure. The facility will allow testing of various materials to their physical limit of thermal endurance and allow for exploring the interplay between radiation-induced embrittlement, swelling and deformation of materials, and the fatigue and fracturing that occur in response to thermal shocks. The combination of high neutron energies and intense fluences will enable accelerated time scale studies. The results will make contributions for refining predictive failure modes (modeling) in extreme environments, as well as providing a technical platform for the development of new alloys, new

The Debreather and NuTech: A Reply to Kleespies

Science.gov (United States)

Ogden, Russel D.

2010-01-01

This article responds to Phillip Kleespies's (2010/this issue) commentary on NuTech fieldworkers and their use of the debreather. Non-medical assistance with suicide raises legitimate concerns about accountability, public safety, and care for those who are suffering. Given that suicide is not a crime, an outcome of the NuTech movement may be that…

Running-gear Tech 2001; Fahrwerk-Tech 2001. Tagung

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

Dynamic driving characteristics, active safety and high comfort are conflicting goals which can be combined by active vehicle management systems. The conference discussed modern tools and methods in the fields of design, simulation and experiment. [German] Im Zielkonflikt zwischen Fahrdynamik, aktiver Sicherheit und Komfort bieten Fahrzeugregelsysteme enorme Moeglichkeiten. Systeme fuer Bremsen, Stabilisierung, Daempfung, Aufbaukontrolle und Fahrerassistenz werden in der Zukunft zu einem Fahrwerksmanagement verschmelzen. Diese Fahrzeugintelligenz erfordert moderne Tools und Methoden im Bereich Konzeption, Simulation und Versuch. Die Tagung Fahrwerk-Tech 2001 wird das Fahrwerk in dieser Gesamtheit betrachten und Experten aus den verschiedenen Bereichen zusammen bringen. (orig.)

Does Service Innovation Matter in High-Tech Industry?

OpenAIRE

Wang, Chao-Hung

2014-01-01

Service innovation has been found to be a major driver of innovation performance in service contexts. But this issue raises questions concerning the extent to which the relationship between market orientation and innovation performance holds in the high-tech industry. Relatively little research has examined how market orientation contributes to innovation performance through service innovation. We here report an empirical study of 235 Taiwanese high-tech firms to examine the influence of mark...

A new myocardial imaging agent: Synthesis, characterization, and biodistribution of gallium-68-BAT-TECH

International Nuclear Information System (INIS)

Kung, H.F.; Liu, B.L.; Mankoff, D.; Kung, M.P.; Billings, J.J.; Francesconi, L.; Alavi, A.

1990-01-01

In order to develop a new myocardial perfusion agent for positron emission tomography (PET), a new lipid-soluble gallium complex was evaluated. Synthesis, radiolabeling, characterization, and biodistribution of a unique gallium complex, [ 67 Ga]BAT-TECH (bis-aminoethanethiol-tetraethyl-cyclohexyl), are described. The complex formation between Ga+3 and BAT-TECH ligand is simple, rapid, and of high yield (greater than or equal to 95%). This process is amenable to kit formulation. The complex has a net charge of +1 and a Ga/ligand ratio of 1:1. Biodistribution in rats shows high uptake in the heart as well as in the liver. When [ 68 Ga] BAT-TECH was injected into a monkey, the heart and liver are clearly delineated by PET imaging, suggesting that this complex may be a possible tracer for myocardial perfusion imaging

77 FR 26588 - In the Matter of Recycle Tech, Inc.; Order of Suspension of Trading

Science.gov (United States)

2012-05-04

... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] In the Matter of Recycle Tech, Inc.; Order of... of current and accurate information concerning the securities of Recycle Tech, Inc. (``Recycle Tech... protection of investors require a suspension of trading in the securities of Recycle Tech. Therefore, it is...

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1998

Energy Technology Data Exchange (ETDEWEB)

V. Finley

2000-03-06

The results of the 1998 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the US Department of Energy and the public with information on the level of radioactive and non-radioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 1998. One significant initiative is the Integrated Safety Management (ISM) program that embraces environment, safety, and health principles as one.

Hi tech microeconomics and information nonintensive calculi

Directory of Open Access Journals (Sweden)

Mirko Dohnal

2013-11-01

Full Text Available The article establishes link between the contributions made to the study of hi tech phenomena. It analyzes the evolution undergone by studies on the topic of the knowledge economics (HI-TECH process carried out by different disciplines (hard and soft sciences – sociology, ecology etc. from the point of view of the objectives they pursue. The attentions are concentrated on analysis of applicable mathematical tools used to develop realistic formal models. Information intensity is defined as the amount of information which is needed for the realistic application of a corresponding formal tool. High information intensity is desirable because it influences the model accuracy. Low information intensity is preferred when high information intensity requires more information items than are available and this is usually the case in knowledge engineering. Fuzzy models seem to be a useful extension of formal tool used in hi tech microeconomics. However, even fuzzy sets could be prohibitively information intensive. Therefore the range of available formal tools must be considerably broader. This paper introduces qualitative and semiqualitative models and rough sets. Each formal tool is briefly characterized.

Baza danych BazTech – integracja i poszerzanie dostępu

OpenAIRE

Derfert-Wolf, Lidia; Buzdygan, Dorota

2014-01-01

The BazTech database – integration and widening access. The BazTech base enables the access to scientific publications in Polish journals in the field of technical sciences, and as one of the resources of open science is available at the Virtual Library of Science. The paper presents the current state of BazTech as an introduction to the review of the development of the base in the direction of integration with other resources. Integration – apart from multibrowsers (eg PRIMO), data aggregato...

Does the high–tech industry consistently reduce CO{sub 2} emissions? Results from nonparametric additive regression model

Energy Technology Data Exchange (ETDEWEB)

Xu, Bin [School of Statistics, Jiangxi University of Finance and Economics, Nanchang, Jiangxi 330013 (China); Research Center of Applied Statistics, Jiangxi University of Finance and Economics, Nanchang, Jiangxi 330013 (China); Lin, Boqiang, E-mail: bqlin@xmu.edu.cn [Collaborative Innovation Center for Energy Economics and Energy Policy, China Institute for Studies in Energy Policy, Xiamen University, Xiamen, Fujian 361005 (China)

2017-03-15

China is currently the world's largest carbon dioxide (CO{sub 2}) emitter. Moreover, total energy consumption and CO{sub 2} emissions in China will continue to increase due to the rapid growth of industrialization and urbanization. Therefore, vigorously developing the high–tech industry becomes an inevitable choice to reduce CO{sub 2} emissions at the moment or in the future. However, ignoring the existing nonlinear links between economic variables, most scholars use traditional linear models to explore the impact of the high–tech industry on CO{sub 2} emissions from an aggregate perspective. Few studies have focused on nonlinear relationships and regional differences in China. Based on panel data of 1998–2014, this study uses the nonparametric additive regression model to explore the nonlinear effect of the high–tech industry from a regional perspective. The estimated results show that the residual sum of squares (SSR) of the nonparametric additive regression model in the eastern, central and western regions are 0.693, 0.054 and 0.085 respectively, which are much less those that of the traditional linear regression model (3.158, 4.227 and 7.196). This verifies that the nonparametric additive regression model has a better fitting effect. Specifically, the high–tech industry produces an inverted “U–shaped” nonlinear impact on CO{sub 2} emissions in the eastern region, but a positive “U–shaped” nonlinear effect in the central and western regions. Therefore, the nonlinear impact of the high–tech industry on CO{sub 2} emissions in the three regions should be given adequate attention in developing effective abatement policies. - Highlights: • The nonlinear effect of the high–tech industry on CO{sub 2} emissions was investigated. • The high–tech industry yields an inverted “U–shaped” effect in the eastern region. • The high–tech industry has a positive “U–shaped” nonlinear effect in other regions. • The linear impact

Identification and cloning of a gamma 3 subunit splice variant of the human GABA(A) receptor.

Science.gov (United States)

Poulsen, C F; Christjansen, K N; Hastrup, S; Hartvig, L

2000-05-31

cDNA sequences encoding two forms of the GABA(A) gamma 3 receptor subunit were cloned from human hippocampus. The nucleotide sequences differ by the absence (gamma 3S) or presence (gamma 3L) of 18 bp located in the presumed intracellular loop between transmembrane region (TM) III and IV. The extra 18 bp in the gamma 3L subunit generates a consensus site for phosphorylation by protein kinase C (PKC). Analysis of human genomic DNA encoding the gamma 3 subunit reveals that the 18 bp insert is contiguous with the upstream proximal exon.

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Years 2002 and 2003

International Nuclear Information System (INIS)

Finley, Virginia L.

2004-01-01

This report provides the U.S. Department of Energy (DOE) and the public with information on the level of radioactive and non-radioactive pollutants (if any) that are added to the environment as a result of Princeton Plasma Physics Laboratory's (PPPL) operations. The results of the 2002 and 2003 environmental surveillance and monitoring program for PPPL are presented and discussed. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 2002 and 2003

High‐Tech Export from the V4 Countries – Structure and Factors

Directory of Open Access Journals (Sweden)

Judyta Lubacha-Sember

2013-03-01

Full Text Available The purpose of this article is to verify the relation between the value of high‐tech export and the value of intellectual capital assets. At the first stage of the study, an analysis of the value and structure of high‐tech export in the V4 countries was performed. At the second stage, the Synthetic Intellectual Capital Asset Index (ICA was calculated using the Perkal index. At the last stage, in order to examine the relation between the value of high‐tech export and the value of intellectual capital assets, an estimation of panel models for selected variables was performed. The results of analysis show that the value of high‐tech export from the V4 countries varies, and the V4 countries score lower in the ranking of EU countries arranged by the value of ICA is than in the ranking of EU countries arranged by the value of high‐tech export. The  relation  between  the  value  of  high‐tech export and the value of ICA was negative for the V4 countries, but models created with the data for all EU countries showed a positive correlation. Identify the causes of such a situation could be very valuable.  Linking  intellectual  capital  assets to  the  high‐tech export could be helpful to find the sources of the high level of exports in this sector.

Untitled

African Journals Online (AJOL)

2004-04-30

Apr 30, 2004 ... Geothermal gradients, heat flow and hydrocarbon recovery, In: A.G. Fisher and S. Judson (editors), Petroleum and. Global Tectonics. Princeton, New Jersey, Princeton University Press,. 5. Conclusions. 251-304. The results of gamma spectrometer and energy dispersive. National Research Council., 1988.

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for Calendar Year 1992

International Nuclear Information System (INIS)

Finley, V.L.; Wieczorek, M.A.

1994-03-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY92. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for calendar year 1991

Energy Technology Data Exchange (ETDEWEB)

Finley, V.L.; Stencel, J.R.

1992-11-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY91. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health.

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for Calendar Year 1992

Energy Technology Data Exchange (ETDEWEB)

Finley, V.L.; Wieczorek, M.A.

1994-03-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY92. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health.

Princeton Plasma Physics Laboratory (PPPL) annual site environmental report for calendar year 1991

International Nuclear Information System (INIS)

Finley, V.L.; Stencel, J.R.

1992-11-01

This report gives the results of the environmental activities and monitoring programs at the Princeton Plasma Physics Laboratory (PPPL) for CY91. The report is prepared to provide the US Department of Energy (DOE) and the public with information on the level of radioactive and nonradioactive pollutants, if any, added to the environment as a result of PPPL operations, as well as environmental initiatives, assessments, and programs. The objective of the Annual Site Environmental Report is to document evidence that DOE facility environmental protection programs adequately protect the environment and the public health

[Enhanced electro-chemical oxidation of Acid Red 3R solution with phosphotungstic acid supported on gamma-Al2O3].

Science.gov (United States)

Yue, Lin; Wang, Kai-Hong; Guo, Jian-Bo; Yang, Jing-Liang; Liu, Bao-You; Lian, Jing; Wang, Tao

2013-03-01

Supported phosphotungstic acid catalysts on gamma-Al2O3 (HPW/gamma-Al2O3) were prepared by solution impregnation and characterized by FTIR, XRD, TG-DTA and SEM. The heteropolyanion shows a Keggin structure. Electro-chemical oxidation of Acid Red 3R was investigated in the presence of HPW supported on gamma-Al2O3 as packing materials in the reactor. The results show that HPW/gamma-Al2O3 has a good catalytic activity for decolorization of Acid Red 3R. When HPW loading was 4.6%, pH value of Acid Red 3R was 3, the voltage was 25.0 V, air-flow was 0.04 m3 x h(-1), and electrode span was 3.0 cm, the decolorization efficiency of Acid Red 3R can reach 97.6%. The removal rate of color had still about 80% in this electro-chemical oxidation system, after HPW/gamma-Al2O3 was used for 10 times, but active component loss existed. The interim product was analyzed by means of Vis-UV absorption spectrum. It shows that the conjugated structure of dye is destroyed primarily.

Virginia Tech honors women in March

OpenAIRE

Lazenby, Jenna

2007-01-01

Commemorating National Women's History Month in March, the Virginia Tech community will host a variety of informative, educational, and entertaining events and programs that highlight women's diverse experiences and achievements.

STAR-JET INTERACTIONS AND GAMMA-RAY OUTBURSTS FROM 3C454.3

Energy Technology Data Exchange (ETDEWEB)

Khangulyan, D. V. [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Barkov, M. V. [Max-Planck-Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); Bosch-Ramon, V. [Departament d' Astronomia i Meteorologia, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain); Aharonian, F. A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Dorodnitsyn, A. V. [Laboratory for High Energy Astrophysics, NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States)

2013-09-10

We propose a model to explain the ultra-bright GeV gamma-ray flares observed from the blazar 3C454.3. The model is based on the concept of a relativistic jet interacting with compact gas condensations produced when a star (a red giant) crosses the jet close to the central black hole. The study includes an analytical treatment of the evolution of the envelope lost by the star within the jet, and calculations of the related high-energy radiation. The model readily explains the day-long that varies on timescales of hours, GeV gamma-ray flare from 3C454.3, observed during 2010 November on top of a plateau lasting weeks. In the proposed scenario, the plateau state is caused by a strong wind generated by the heating of the stellar atmosphere due to nonthermal particles accelerated at the jet-star interaction region. The flare itself could be produced by a few clouds of matter lost by the red giant after the initial impact of the jet. In the framework of the proposed scenario, the observations constrain the key model parameters of the source, including the mass of the central black hole: M{sub BH} {approx_equal} 10{sup 9} M{sub Sun }, the total jet power: L{sub j} {approx_equal} 10{sup 48} erg s{sup -1}, and the Doppler factor of the gamma-ray emitting clouds: {delta} {approx_equal} 20. Whereas we do not specify the particle acceleration mechanisms, the potential gamma-ray production processes are discussed and compared in the context of the proposed model. We argue that synchrotron radiation of protons has certain advantages compared to other radiation channels of directlyaccelerated electrons. An injected proton distribution {proportional_to}E {sup -1} or harder below the relevant energies would be favored to alleviate the tight energetic constraints and to avoid the violation of the observational low-energy constraints.

Evaluation of an LED Retrofit Project at Princeton University's Carl Icahn Laboratory

Energy Technology Data Exchange (ETDEWEB)

Davis, Robert [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Murphy, Arthur [Princeton Univ., NJ (United States); Perrin, Tess [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-11-01

At Princeton University’s Carl Icahn Laboratory, DOE’s Commercial Buildings Integration Program documented the implementation of LED retrofit products for recessed troffers, linear cove lighting, and downlights – as part of Princeton’s first building-wide interior LED project. The conversion to LED enables more extensive use of lighting controls to tailor the lighting to the task and limit the operating hours based on occupancy, and the estimated energy savings including controls is 62% compared to the incumbent system.

Planned Experiments on the Princeton Advanced Test Stand

Science.gov (United States)

Stepanov, A.; Gilson, E. P.; Grisham, L.; Kaganovich, I.; Davidson, R. C.

2010-11-01

The Princeton Advanced Test Stand (PATS) device is an experimental facility based on the STS-100 high voltage test stand transferred from LBNL. It consists of a multicusp RF ion source, a pulsed extraction system capable of forming high-perveance 100keV ion beams, and a large six-foot-long vacuum with convenient access for beam diagnostics. This results in a flexible system for studying high perveance ion beams relevant to NDCX-I/II, including experiments on beam neutralization by ferroelectric plasma sources (FEPS) being developed at PPPL. Research on PATS will concern the basic physics of beam-plasma interactions, such as the effects of volume neutralization on beam emittance, as well as optimizing technology of the FEPS. PATS combines the advantage of an ion beam source and a large-volume plasma source in a chamber with ample access for diagnostics, resulting in a robust setup for investigating and improving relevant aspects of neutralized drift. There are also plans for running the ion source with strongly electro-negative gases such as chlorine, making it possible to extract positive or negative ion beams.

Princeton Plasma Physics Laboratory FY2003 Annual Highlights

Energy Technology Data Exchange (ETDEWEB)

Editors: Carol A. Phillips; Anthony R. DeMeo

2004-08-23

The Princeton Plasma Physics Laboratory FY2003 Annual Highlights report provides a summary of the activities at the Laboratory for the fiscal year--1 October 2002 through 30 September 2003. The report includes the Laboratory's Mission and Vision Statements, a message ''From the Director,'' summaries of the research and engineering activities by project, and sections on Technology Transfer, the Graduate and Science Education Programs, Awards and Honors garnered by the Laboratory and the employees, and the Year in Pictures. There is also a listing of the Laboratory's publications for the year and a section of the abbreviations, acronyms, and symbols used throughout the report. In the PDF document, links have been created from the Table of Contents to each section. You can also return to the Table of Contents from the beginning page of each section. The PPPL Highlights for fiscal year 2003 is also available in hardcopy format. To obtain a copy e-mail Publications and Reports at: pub-reports@pppl.gov. Be sure to include your complete mailing address

香港金融科技的未来%La future de FinTech à Hong Kong

Institute of Scientific and Technical Information of China (English)

香港金融发展局; 杨鑫

2017-01-01

FinTech - l'innovation financiére grace à la technologie - a le potentiel d'apporter des améliorations substantielles de la productivité et de la qualité des services financiers à Hong Kong. Hong Kong, avec son grand secteur financier, est en mesure de gagner de la tendance FinTech et de perdre à d'autres centres si cela ne fonctionne pas. Ce rapport propose une stratégie FinTech comprenant cinq programmes FinTech - Cyber sécurité, paiement et réglement de titre un identifiant numérique et KYC, WealthTech, InsurTech et RegTech - pris en charge par un bureau FinTech par lequel le territoire peut être avancé de maniére décisive.

Measurements of beam-ion confinement during tangential beam-driven instabilities in PBX [Princeton Beta Experiment

International Nuclear Information System (INIS)

Heidbrink, W.W.; Kaita, R.; Takahashi, H.; Gammel, G.; Hammett, G.W.; Kaye, S.

1987-01-01

During tangential injection of neutral beams into low density tokamak plasmas with β > 1% in the Princeton Beta Experiment (PBX), instabilities are observed that degrade the confinement of beam ions. Neutron, charge-exchange, and diamagnetic loop measurements are examined in order to identify the mechanism or mechanisms responsible for the beam-ion transport. The data suggest a resonant interaction between the instabilities and the parallel energetic beam ions. Evidence for some nonresonant transport also exists

Investment in high-tech industries : An example from the LCD industry

NARCIS (Netherlands)

Huisman, K.J.M.; Kort, P.M.; Plasmans, J.E.J.; Bensoussan, A.; Peng, S.; Sung, J.

2013-01-01

This chapter considers a representative firm taking investment decisions in a high-tech environment where different generations of production facilities are invented over time. First, we develop a general real options investment model for high-tech industries in which, according to standard

Princeton Plasma Physics Laboratory annual report, October 1, 1991--September 30, 1992

Energy Technology Data Exchange (ETDEWEB)

1992-12-31

This report discusses the following topics: Principal parameters achieved in experimental devices for fiscal year 1992; tokamak fusion test reactor; princeton beta experiment-modification; current drive experiment-upgrade; tokamak physics experiment/steady-state advanced tokamak; international thermonuclear experimental reactor; international collaboration; x-ray laser studies; plasma processing: Deposition and etching of thin films; pure electron plasma experiments; theoretical studies; tokamak modeling; high-field magnet project; engineering department; environment, safety, and health and quality assurance; technology transfer; office of human resources and administration; PPPL invention disclosures for fiscal year 1992; office of resource management; graduate education: plasma physics; graduate education: program in plasma science and technology; and science education program.

Princeton Plasma Physics Laboratory annual report, October 1, 1991--September 30, 1992

International Nuclear Information System (INIS)

1992-01-01

This report discusses the following topics: Principal parameters achieved in experimental devices for fiscal year 1992; tokamak fusion test reactor; princeton beta experiment-modification; current drive experiment-upgrade; tokamak physics experiment/steady-state advanced tokamak; international thermonuclear experimental reactor; international collaboration; x-ray laser studies; plasma processing: Deposition and etching of thin films; pure electron plasma experiments; theoretical studies; tokamak modeling; high-field magnet project; engineering department; environment, safety, and health and quality assurance; technology transfer; office of human resources and administration; PPPL invention disclosures for fiscal year 1992; office of resource management; graduate education: plasma physics; graduate education: program in plasma science and technology; and science education program

Get on Board the Cost Effective Way: A Tech Prep Replication Process.

Science.gov (United States)

Moore, Wayne A.; Szul, Linda F.; Rivosecchi, Karen

1997-01-01

The Northwestern Pennsylvania Tech Prep Consortium model for replicating tech prep programs includes these steps: fact finding, local industry analysis, curriculum development, detailed description, marketing strategies, implementation, and program evaluation. (SK)

SU-E-T-231: Cross-Validation of 3D Gamma Comparison Tools

International Nuclear Information System (INIS)

Alexander, KM; Jechel, C; Pinter, C; Lasso, A; Fichtinger, G; Salomons, G; Schreiner, LJ

2015-01-01

Purpose: Moving the computational analysis for 3D gel dosimetry into the 3D Slicer (www.slicer.org) environment has made gel dosimetry more clinically accessible. To ensure accuracy, we cross-validate the 3D gamma comparison module in 3D Slicer with an independently developed algorithm using simulated and measured dose distributions. Methods: Two reference dose distributions were generated using the Varian Eclipse treatment planning system. The first distribution consisted of a four-field box irradiation delivered to a plastic water phantom and the second, a VMAT plan delivered to a gel dosimeter phantom. The first reference distribution was modified within Eclipse to create an evaluated dose distribution by spatially shifting one field by 3mm, increasing the monitor units of the second field, applying a dynamic wedge for the third field, and leaving the fourth field unchanged. The VMAT plan was delivered to a gel dosimeter and the evaluated dose in the gel was calculated from optical CT measurements. Results from the gamma comparison tool built into the SlicerRT toolbox were compared to results from our in-house gamma algorithm implemented in Matlab (via MatlabBridge in 3D Slicer). The effects of noise, resolution and the exchange of reference and evaluated designations on the gamma comparison were also examined. Results: Perfect agreement was found between the gamma results obtained using the SlicerRT tool and our Matlab implementation for both the four-field box and gel datasets. The behaviour of the SlicerRT comparison with respect to changes in noise, resolution and the role of the reference and evaluated dose distributions was consistent with previous findings. Conclusion: Two independently developed gamma comparison tools have been cross-validated and found to be identical. As we transition our gel dosimetry analysis from Matlab to 3D Slicer, this validation serves as an important test towards ensuring the consistency of dose comparisons using the 3D Slicer

A comparative study of LaBr3(Ce(3+)) and CeBr3 based gamma-ray spectrometers for planetary remote sensing applications.

Science.gov (United States)

Kozyrev, A; Mitrofanov, I; Owens, A; Quarati, F; Benkhoff, J; Bakhtin, B; Fedosov, F; Golovin, D; Litvak, M; Malakhov, A; Mokrousov, M; Nuzhdin, I; Sanin, A; Tretyakov, V; Vostrukhin, A; Timoshenko, G; Shvetsov, V; Granja, C; Slavicek, T; Pospisil, S

2016-08-01

The recent availability of large volume cerium bromide crystals raises the possibility of substantially improving gamma-ray spectrometer limiting flux sensitivities over current systems based on the lanthanum tri-halides, e.g., lanthanum bromide and lanthanum chloride, especially for remote sensing, low-level counting applications or any type of measurement characterized by poor signal to noise ratios. The Russian Space Research Institute has developed and manufactured a highly sensitive gamma-ray spectrometer for remote sensing observations of the planet Mercury from the Mercury Polar Orbiter (MPO), which forms part of ESA's BepiColombo mission. The Flight Model (FM) gamma-ray spectrometer is based on a 3-in. single crystal of LaBr3(Ce(3+)) produced in a separate crystal development programme specifically for this mission. During the spectrometers development, manufacturing, and qualification phases, large crystals of CeBr3 became available in a subsequent phase of the same crystal development programme. Consequently, the Flight Spare Model (FSM) gamma-ray spectrometer was retrofitted with a 3-in. CeBr3 crystal and qualified for space. Except for the crystals, the two systems are essentially identical. In this paper, we report on a comparative assessment of the two systems, in terms of their respective spectral properties, as well as their suitability for use in planetary mission with respect to radiation tolerance and their propensity for activation. We also contrast their performance with a Ge detector representative of that flown on MESSENGER and show that: (a) both LaBr3(Ce(3+)) and CeBr3 provide superior detection systems over HPGe in the context of minimally resourced spacecraft and (b) CeBr3 is a more attractive system than LaBr3(Ce(3+)) in terms of sensitivities at lower gamma fluxes. Based on the tests, the FM has now been replaced by the FSM on the BepiColombo spacecraft. Thus, CeBr3 now forms the central gamma-ray detection element on the MPO spacecraft.

Competitive low-tech manufacturing and challenges for regional policy in the European context

DEFF Research Database (Denmark)

Hansen, Teis; Winther, Lars

2014-01-01

Today, low-tech firms in high-wage countries are focusing on increasing investments in highly skilled labour and advanced machinery, incremental innovation and high value-added niches. Danish policy, however, gives little attention to the new specificities of low-tech manufacturing......, and the understanding of innovation in national and regional strategies is dominated by a science-based perspective. There is a strong policy focus on human capital and research and development in manufacturing. Human capital is vital to manufacturing in general, but the latter is of less importance for low-tech firms....... Conversely, user–producer interactions and machinery investments, which are critical to low-tech competitiveness, are disregarded by policies....

Characteristics of 3D gamma evaluation according to phantom rotation error and dose gradient

Energy Technology Data Exchange (ETDEWEB)

Kim, Kyeong Hyun; Kim, Dong Su; Kim, Tae Ho; Kang, Seong Hee; Shin, Dong Seok; Noh, Yu Yoon; Suh, Tae Seok [Dept. of Biomedical Engineering, Research Institute of Biomedical Engineering, College of Medicine, the Catholic University of Korea, Seoul (Korea, Republic of); Cho, Min Seok [Dept. of Radiation Oncology, Asan Medical Center, Seoul (Korea, Republic of)

2016-12-15

In intensity modulated radiation therapy (IMRT) quality assurance (QA) using dosimetric phantom, a spatial uncertainty induced from phantom set-up inevitably occurs and gamma index that is used to evaluate IMRT plan quality can be affected differently by a combination of the spatial uncertainty and magnitude of dose gradient. In this study, we investigated the impacts of dose gradient and the phantom set-up error on 3D gamma evaluation. In this study, we investigated the characteristics of gamma evaluation according to dose gradient and phantom rotation axis. As a result, 3D gamma had better performance than 2D gamma. Therefore, it can be useful for IMRT QA analysis at clinical field.

Pricing Policy and Strategies for Consumer High-Tech Products

Directory of Open Access Journals (Sweden)

Dovleac, L.

2014-06-01

Full Text Available This paper highlights the complex process of price setting for consumer high-tech products. These prices are highly influenced by some external factors from the economic and social environment. The main objective of this paper is to establish the most effective pricing policies and strategies used by high-tech companies of various sizes. Decisions about price fixing for consumer high-technology products are largely influenced by consumer behaviour, too.

The mirror symmetric centroid difference method for picosecond lifetime measurements via {gamma}-{gamma} coincidences using very fast LaBr{sub 3}(Ce) scintillator detectors

Energy Technology Data Exchange (ETDEWEB)

Regis, J.-M., E-mail: regis@ikp.uni-koeln.d [Institut fuer Kernphysik, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany); Pascovici, G.; Jolie, J.; Rudigier, M. [Institut fuer Kernphysik, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany)

2010-10-01

The ultra-fast timing technique was introduced in the 1980s and is capable of measuring picosecond lifetimes of nuclear excited states with about 3 ps accuracy. Very fast scintillator detectors are connected to an electronic timing circuit and detector vs. detector time spectra are analyzed by means of the centroid shift method. The very good 3% energy resolution of the nowadays available LaBr{sub 3}(Ce) scintillator detectors for {gamma}-rays has made possible an extension of the well-established fast timing technique. The energy dependent fast timing characteristics or the prompt curve, respectively, of the LaBr{sub 3}(Ce) scintillator detector has been measured using a standard {sup 152}Eu {gamma}-ray source. For any energy combination in the range of 200keVgamma}<}1500keV, the {gamma}-{gamma} fast timing characteristics is calibrated as a function of energy with an accuracy of 2-4 ps. An extension of the centroid shift method providing very attractive features for picosecond lifetime measurements is presented. The mirror symmetric centroid difference method takes advantage of the symmetry obtained when performing {gamma}-{gamma} lifetime measurements using a pair of almost identical very fast scintillator detectors. In particular cases, the use of the mirror symmetric centroid difference method also allows the direct determination of picosecond lifetimes, hence without the need of calibrating the prompt curve.

Early Fermi Gamma-ray Space Telescope Observations of the Quasar 3C454.3

Energy Technology Data Exchange (ETDEWEB)

Abdo, A

2009-05-07

This is the first report of Fermi Gamma-ray Space Telescope observations of the quasar 3C 454.3, which has been undergoing pronounced long-term outbursts since 2000. The data from the Large Area Telescope (LAT), covering 2008 July 7-October 6, indicate strong, highly variable {gamma}-ray emission with an average flux of {approx} 3 x 10{sup -6} photons cm{sup -2} s{sup -1}, for energies > 100 MeV. The {gamma}-ray flux is variable, with strong, distinct, symmetrically-shaped flares for which the flux increases by a factor of several on a time scale of about three days. This variability indicates a compact emission region, and the requirement that the source is optically thin to pair-production implies relativistic beaming with Doppler factor {delta} > 8, consistent with the values inferred from VLBI observations of superluminal expansion ({delta} {approx} 25). The observed {gamma}-ray spectrum is not consistent with a simple power-law, but instead steepens strongly above {approx} 2 GeV, and is well described by a broken power-law with photon indices of {approx} 2.3 and {approx} 3.5 below and above the break, respectively. This is the first direct observation of a break in the spectrum of a high luminosity blazar above 100 MeV, and it is likely direct evidence for an intrinsic break in the energy distribution of the radiating particles. Alternatively, the spectral softening above 2GeV could be due to -ray absorption via photonphoton pair production on the soft X-ray photon field of the host AGN, but such an interpretation would require the dissipation region to be located very close ({approx}< 100 gravitational radii) to the black hole, which would be inconsistent with the X-ray spectrum of the source.

Virginia Tech's K-9 unit to receive Kevlar vest from alumni organization

OpenAIRE

Dickerson, Susan

2004-01-01

Hokie, the Virginia Tech Police Department's German shepherd, will be presented with a custom-fitted Virginia Tech Kevlar bulletproof vest to protect him from all the dangers he faces while performing his daily duties.

TRAINING EMPLOYEES TO WORK WITH HI-TECH EQUIPMENT

Directory of Open Access Journals (Sweden)

M. A. Dremina

2016-01-01

Full Text Available The aim of the study is to describe a research relying on the capabilities of networking, which improves the quality of vocational training of skilled workers that are intended to work with new hi-tech equipment.Methods. Methods of system and comparative analysis, modeling, synthesis and generalization are used. Specification of the model of workers training offered by authors is carried out on the basis of deep interviews to experts – the representatives of the large enterprises who are carrying out training of the personnel.Results. Social and pedagogical contradictions are revealed, on the one hand, in the growing need for highly professional personnel for hi-tech productions, and, on the other hand, in insufficiently effective countermeasures of the system of vocational education and training on closing actual requirements of productions. The discrepancies reducing the quality of preparation of skilled workers are revealed by comparative analysis of competences based on an ideal competence model of the trainer and teacher of VET with the competences presented in educational both professional standards and the discussed projects. Characteristics of the existing pedagogical process in the hi-tech production environment are described. For the purpose of quality improvement of the pedagogical process, the network format of interactions of the enterprise, educational and the business organizations is offered.Scientific novelty. The concept «pedagogical process» for the purpose of making it more instrumental is specified; it joins a technological process and the design of its ideal model for the hi-tech production environment. The unique network project including design and development of innovative manuals and teaching materials for the welding equipment of Fronius International GmbH.Practical significance. The research results can be useful to the management of staff development and career advancement of hi-tech productions, and VET

Recombining plasma in the gamma-ray-emitting mixed-morphology supernova remnant 3C 391

Energy Technology Data Exchange (ETDEWEB)

Ergin, T.; Sezer, A. [TUBITAK Space Technologies Research Institute, ODTU Campus, 06531 Ankara (Turkey); Saha, L.; Majumdar, P.; Chatterjee, A. [Saha Institute of Nuclear Physics, Kolkata, West Bengal 700064 (India); Bayirli, A.; Ercan, E. N., E-mail: tulun.ergin@tubitak.gov.tr [Physics Department, Bogazici University, Bebek, 34342 Istanbul (Turkey)

2014-07-20

A group of middle-aged mixed-morphology (MM) supernova remnants (SNRs) interacting with molecular clouds (MCs) has been discovered to be strong GeV gamma-ray emitters by the Large Area Telescope (LAT) on board the Fermi Gamma-Ray Space Telescope (Fermi-LAT). The recent observations of the Suzaku X-ray satellite have revealed that some of these interacting gamma-ray-emitting SNRs, such as IC443, W49B, W44, and G359.1-0.5, have overionized plasmas. 3C 391 (G31.9+0.0) is another Galactic MM SNR interacting with MCs. It was observed in GeV gamma rays by Fermi-LAT as well as in the 0.3-10.0 keV X-ray band by Suzaku. In this work, 3C 391 was detected in GeV gamma rays with a significance of ∼18σ and we showed that the GeV emission is point-like in nature. The GeV gamma-ray spectrum was shown to be best explained by the decay of neutral pions assuming that the protons follow a broken power-law distribution. We revealed radiative recombination structures of silicon and sulfur from 3C 391 using Suzaku data. In this paper, we discuss the possible origin of this type of radiative plasma and hadronic gamma rays.

Creating a vibrant innovation ecosystem : the High Tech Campus Eindhoven case

NARCIS (Netherlands)

Romme, A.G.L.

2017-01-01

The High Tech Campus Eindhoven is a campus-based ecosystem for high-tech R&D, located in the city of Eindhoven (Netherlands). It is currently home to more than 140 companies and institutions, involving more than 10,000 product developers, researchers, entrepreneurs, and service providers. The

High-Tech Means High-Efficiency: The Business Case for EnergyManagement in High-Tech Industries

Energy Technology Data Exchange (ETDEWEB)

Shanshoian, Gary; Blazek, Michele; Naughton, Phil; Seese, RobertS.; Mills, Evan; Tschudi, William

2005-11-15

In the race to apply new technologies in ''high-tech'' facilities such as data centers, laboratories, and clean rooms, much emphasis has been placed on improving service, building capacity, and increasing speed. These facilities are socially and economically important, as part of the critical infrastructure for pharmaceuticals,electronics, communications, and many other sectors. With a singular focus on throughput, some important design issues can be overlooked, such as the energy efficiency of individual equipment (e.g., lasers, routers and switches) as well as the integration of high-tech equipment into the power distribution system and the building envelope. Among technology-based businesses, improving energy efficiency presents an often untapped opportunity to increase profits, enhance process control,maximize asset value, improve the work place environment, and manage a variety of business risks. Oddly enough, the adoption of energy efficiency improvements in this sector lags behind many others. As a result, millions of dollars are left on the table with each year ofoperation.

ContiTronic - The intelligent conveyor belt from ContiTech; ContiTronic - Das intelligente Transportband von ContiTech

Energy Technology Data Exchange (ETDEWEB)

Alles, R; Wach, T [ContiTech Transportbandsysteme GmbH, Hannover (Germany)

1998-05-01

ContiTech has investigated the use of RFID (Radio Frequency Identification) and found that specially developed transponders can be vulcanized into rubber conveyor belts without impairing their performance capabilities. The system opens up a whole host of new applications in bulk materials handling within various sectors of industry (mining, steel industry, etc.). With the support of the Cologne-based Rheinbraun AG, the ContiTronic system was tested in lignite mining Operations in Hambach. (orig.) [Deutsch] Untersuchungen bei ContiTech ueber die Radio-Frequenz-Identifikation (RFID) ergaben, dass sich speziell entwickelte Transponder in Gummifoerdergurte einvulkanisieren lassen, ohne dass deren Funktion beeintraechtigt wird. Das System eroeffnet bei der Schuettgutfoerderung in den verschiedensten Industriebereichen (Bergbau, Stahlindustrie usw.) neue Anwendungen. Mit Unterstuetzung der Rheinbraun AG, Koeln, wurde das ContiTronic-System im Braunkohlentagebau Hambach erprobt. (orig.)

3rd Interplanetary Network Gamma-Ray Burst Website

Science.gov (United States)

Hurley, Kevin

1998-05-01

We announce the opening of the 3rd Interplanetary Network web site at http://ssl.berkeley.edu/ipn3/index.html This site presently has four parts: 1. A bibliography of over 3000 publications on gamma-ray bursts, 2. IPN data on all bursts triangulated up to February 1998, 3. A master list showing which spacecraft observed which bursts, 4. Preliminary IPN data on the latest bursts observed.

CeBr3 as a room-temperature, high-resolution gamma-ray detector

International Nuclear Information System (INIS)

Guss, Paul; Reed, Michael; Yuan Ding; Reed, Alexis; Mukhopadhyay, Sanjoy

2009-01-01

Cerium bromide (CeBr 3 ) has become a material of interest in the race for high-resolution gamma-ray spectroscopy at room temperature. This investigation quantified the potential of CeBr 3 as a room-temperature, high-resolution gamma-ray detector. The performance of CeBr 3 crystals was compared to other scintillation crystals of similar dimensions and detection environments. Comparison of self-activity of CeBr 3 to cerium-doped lanthanum tribromide (LaBr 3 :Ce) was performed. Energy resolution and relative intrinsic efficiency were measured and are presented.

Second public meeting of Governor Kaine's Independent Virginia Tech Incident Review Panel

OpenAIRE

Owczarski, Mark

2007-01-01

The second public meeting of Governor Kaine's Independent Virginia Tech Incident Review Panel will convene on Monday, May 21, at The Inn at Virginia Tech and Skelton Conference Center Latham Ballroom, 901 Prices Fork Road in Blacksburg.

Effects of an 8-Week Outdoor Brisk Walking Program on Fatigue in Hi-Tech Industry Employees: A Randomized Control Trial.

Science.gov (United States)

Wu, Li-Ling; Wang, Kuo-Ming; Liao, Po-I; Kao, Yu-Hsiu; Huang, Yi-Ching

2015-10-01

Over 73% of hi-tech industry employees in Taiwan lack regular exercise. They are exposed to a highly variable and stressful work environment for extended periods of time, and may subsequently experience depression, detrimental to workers' physiological and mental health. In this cross-sectional survey, the authors explored the effect of an 8-week brisk walking program on the fatigue of employees in the hi-tech industry. The participants, from a hi-tech company in northern Taiwan, were randomly assigned to an experimental group (EG; 41 subjects, Mage = 33.34 ± 6.40) or control group (CG; 45 subjects, Mage = 29.40 ± 3.60). Following the 8-week brisk walking program, the EG showed significantly lower scores for subjective fatigue, working motivation, attention, and overall fatigue. The authors confirmed that the 8-week outdoor brisk walking program significantly improved the level of fatigue among employees of the hi-tech industry. The finding serves as an important reference for health authorities in Taiwan and provides awareness of workplace health promotion in the hi-tech industry. © 2015 The Author(s).

T cell receptor zeta allows stable expression of receptors containing the CD3gamma leucine-based receptor-sorting motif

DEFF Research Database (Denmark)

Dietrich, J; Geisler, C

1998-01-01

The leucine-based motif in the T cell receptor (TCR) subunit CD3gamma constitutes a strong internalization signal. In fully assembled TCR this motif is inactive unless phosphorylated. In contrast, the motif is constitutively active in CD4/CD3gamma and Tac/CD3gamma chimeras independently of phosph......The leucine-based motif in the T cell receptor (TCR) subunit CD3gamma constitutes a strong internalization signal. In fully assembled TCR this motif is inactive unless phosphorylated. In contrast, the motif is constitutively active in CD4/CD3gamma and Tac/CD3gamma chimeras independently...... of phosphorylation and leads to rapid internalization and sorting of these chimeras to lysosomal degradation. Because the TCRzeta chain rescues incomplete TCR complexes from lysosomal degradation and allows stable surface expression of fully assembled TCR, we addressed the question whether TCRzeta has the potential...... to mask the CD3gamma leucine-based motif. By studying CD4/CD3gamma and CD16/CD3gamma chimeras, we found that CD16/CD3gamma chimeras associated with TCRzeta. The CD16/CD3gamma-TCRzeta complexes were stably expressed at the cell surface and had a low spontaneous internalization rate, indicating...

TechTutorer - en ny måde at integrere teknologi i læreruddannelsen?

DEFF Research Database (Denmark)

Heiberg, Tobias; Arstorp, Ann-Thérèse

’TechTutor-enheden’ skal ses. I rapporten uddybes initiativet, men helt enkelt kan TechTutorerne beskrives som en gruppe af lærerstuderende med særlige kompetencer og interesser inden for det teknologiske felt. Og de samarbejder som TechTutorer om udbud af diverse kursusforløb samt udvikling af...... læreruddannelsen, når det kommer til didaktisering og implementering af teknologi – alt sammen med rapportens forfattere som koordinerende og kvalificerende element. TechTutor-initiativet skal altså overordnet ses som et eksperiment, der centrerer sig omkring nye vinkler på kvalificering og optimering af...

Deuterium implantation in first wall candidate materials by exposure in the Princeton large torus

Energy Technology Data Exchange (ETDEWEB)

Chang, J.; Tobin, A. (Grumman Aerospace Corp., Bethpage, NY (USA). Research and Development Center); Manos, D. (Princeton Univ., NJ (USA). Plasma Physics Lab.)

Titanium alloys are of interest as a first wall material in fusion reactors because of their excellent thermophysical and thermomechanical properties. A major concern with their application to the first wall is associated with the known affinity of titanium for hydrogen and the related consequences for fuel recycling, tritium inventory, and hydrogen embrittlement. Little information exists on trapping and release of hydrogen isotopes implanted at energies below 500 eV. This work was undertaken to measure hydrogen isotope trapping and release at the first wall of the Princeton Large Torus Tokamak (PLT).

Overview of the modification to the Poloidal Divertor Experiment (PDX) to produce the Princeton Beta Experiment (PBX)

International Nuclear Information System (INIS)

Kuntson, D.

1985-01-01

The Poloidal Divertor Experiment at the Princeton Plasma Physics Laboratory has been recently transformed into the Princeton Beta Experiment. The purpose of the modification is to produce a bean-shaped plasma with beta values in excess of 10%, which is substantially above those achieved with more conventional plasma shapes. This transformation is accomplished by relocating several of the existing coils within the vacuum vessel, without a major disassembly of the device. One of the former PDX divertor coils is relocated on the mid-plane to be used as a ''pusher'' coil to create the plasma indentation. The ''pusher'' coil is protected from neutral beam impingement by watercooled graphite armor. The remaining internal PDX poloidal field coils are moved vertically to optimize the new configuration. The major new component is the set of passive stabilization coils. These coils are fabricated in segments and installed inside of the vacuum vessel. The purpose of the passive coils is to dampen the vertical instability of the bean-shaped plasma. The conversion to PBX also required reworking of internal and external poloidal coil bus leads, and the fabrication of new mechanical support structure

The FinTech phenomenon: antecedents of financial innovation perceived by the popular press

OpenAIRE

Zavolokina, Liudmila; Dolata, Mateusz; Schwabe, Gerhard

2016-01-01

The financial industry has been strongly influenced by digitalization in the past few years reflected by the emergence of 'FinTech,' which represents the marriage of 'finance' and 'information technology.' FinTech provides opportunities for the creation of new services and business models and poses challenges to traditional financial service providers. Therefore, FinTech has become a subject of debate among practitioners, investors, and researchers and is highly visible in the popular media. ...

Delivering a Paper (and other works) at #LowTechLabLondon2016

OpenAIRE

O'Connell, Micheal

2016-01-01

Performance 'Delivering a Paper' and screened/presented/exhibited other works such as 'How to Buy Nothing' related to author's interventionist art practice at this three-day event.\\ud \\ud #LowTechLabLondon2016 is a project developed by Raúl Marroquín and coordinated by Daniela Medina Poch for the Educational Program of the Saatchi Gallery that will take place on January 15th, 16th and 17th of 2016.\\ud \\ud “‘LowTech means technology that is cheap or free.”\\ud James Wallback, LowTech Manifest f...

A new code for spectrometric analysis for environmental radiological surveillance on monitors focused on gamma radioactivity on aerosols

Energy Technology Data Exchange (ETDEWEB)

De Blas, Alfredo; Tapia, Carlos; Riego, Albert; Garcia, Roger; Dies, Javier; Diaz, Pedro [Nuclear Engineering Research Group, Departament of Physics and Nuclear Engineering, Technical University of Catalonia, Barcelona (Spain); Toral, Juan [Raditel Serveis, Tarragona (Spain); Batalla, Enric [Radiological Activities Corrdination Service - SCAR, Generalitat de Catalunya. Barcelona (Spain)

2015-07-01

pGamma is a code developed by the NERG group of the Technical University of Catalonia - Barcelona Tech for the analysis of gamma spectra generated by the Equipment for the Continuous Measurement and Identification of Gamma Radioactivity on Aerosols with Paper Filter developed for our group and Raditel Servies company. Nowadays the code is in the process of adaptation for the monitors of the Environmental Radiological Surveillance Network of the Local Government of Catalonia (Generalitat of Catalonia), Spain. The code is a Spectrum Analysis System, it identifies the gamma emitters on the spectrum, determines its Concentration of Activity, generates alarms depending on the Activity of the emitters and generates a report. The Spectrum Analysis System includes a library with emitters of interest, NORM and artificial. The code is being used on the three stations with the aerosol monitor of the Network (Asco and Vandellos, near both Nuclear Power Plants and Barcelona). (authors)

Considering a redesign of the Tech United keeper for improved acceleration

NARCIS (Netherlands)

Roest, de A.; Steinbuch, M.; Rosielle, P.C.J.N.

2011-01-01

The report describes the explorations to design a new keeper for Tech United. The performance of the current robot was disappointing and one of the reasons that Tech United lost the finals at the world championship last year. The goal of this report is to provide suggestions for the design of a new

The FinTech phenomenon: antecedents of financial innovation perceived by the popular press

OpenAIRE

Zavolokina, Liudmila; Dolata, Mateusz; Schwabe, Gerhard

2016-01-01

The financial industry has been strongly influenced by digitalization in the past few years reflected by the emergence of “FinTech,” which represents the marriage of “finance” and “information technology.” FinTech provides opportunities for the creation of new services and business models and poses challenges to traditional financial service providers. Therefore, FinTech has become a subject of debate among practitioners, investors, and researchers and is highly visible in the popular media. ...

Od bazy bibliograficznej do pe?notekstowej ? wsp??praca og?lnopolskiego Konsorcjum BazTech

OpenAIRE

Buzdygan, Dorota

2015-01-01

W artykule przedstawiono baz? BazTech indeksuj?c? zawarto?? polskich czasopism technicznych. W szczeg?lno?ci om?wiono: zas?b bazy, rodzaje rekord?w, sposoby dost?pu i prezentacji zawartych w bazie informacji. Om?wiono etapy przekszta?cania bazy z bibliograficznej-abstraktowej w pe?notekstow?. Zaprezentowano tw?rc?w bazy czyli wsp??pracuj?ce, od prawie 20 lat, tworz?ce Konsorcjum BazTech, biblioteki wy?szych uczelni technicznych i instytut?w naukowych. The article presents the BazTech da...

Measurements of keV-neutron capture {gamma} rays of fission products. 3

Energy Technology Data Exchange (ETDEWEB)

Igashira, Masayuki [Tokyo Inst. of Tech. (Japan). Research Lab. for Nuclear Reactors

1997-03-01

{gamma} rays from the keV-neutron capture reactions by {sup 143,145}Nd and {sup 153}Eu have been measured in a neutron energy region of 10 to 80 keV, using a large anti-Compton NaI(Tl) {gamma}-ray spectrometer and the {sup 7}Li(p,n){sup 7}Be pulsed neutron source with a 3-MV Pelletron accelerator. The preliminary results for the capture cross sections and {gamma}-ray spectra of those nuclei are presented and discussed. (author)

Atmospheric deposition of 7Be by rain events, incentral Argentina

Science.gov (United States)

Ayub, J. Juri; Di Gregorio, D. E.; Huck, H.; Velasco, H.; Rizzotto, M.

2008-08-01

Beryllium-7 is a natural radionuclide that enters into the ecosystems through wet and dry depositions and has numerous environmental applications in terrestrial and aquatic ecosystems. Atmospheric wet deposition of 7Be was measured in central Argentina. Rain traps were installed (1 m above ground) and individual rain events have been collected. Rain samples were filtered and analyzed by gamma spectrometry. The gamma counting was undertaken using a 40%-efficient p-type coaxial intrinsic high-purity natural germanium crystal built by Princeton Gamma-Tech. The cryostat was made from electroformed high-purity copper using ultralow-background technology. The detector was surrounded by 50 cm of lead bricks to provide shielding against radioactive background. The detector gamma efficiency was determined using a water solution with known amounts of chemical compounds containing long-lived naturally occurring radioisotopes, 176Lu, 138La and 40K. Due to the geometry of the sample and its position close to the detector, the efficiency points from the 176Lu decay, had to be corrected for summing effects. The measured samples were 400 ml in size and were counted curing one day. The 7Be detection limit for the present measurements was as low as 0.2 Bq l-1. Thirty two rain events were sampled and analyzed (November 2006-May 2007). The measured values show that the events corresponding to low rainfall (<20 mm) are characterized by significantly higher activity concentrations (Bq l-1). The activity concentration of each individual event varied from 0.8 to 3.5 Bq l-1, while precipitations varied between 4 and 70 mm. The integrated activity by event of 7Be was fitted with a model that takes into account the precipitation amount and the elapsed time between two rain events. The integrated activities calculated with this model show a good agreement with experimental values.

Engineering Technology Showcase to feature high-tech products from 18 companies

OpenAIRE

Gilbert, Karen

2007-01-01

The Student Technology Council (STC) at Virginia Tech is sponsoring an Engineering Technology Showcase on Tuesday, March 27. In addition to providing a platform for technology companies to show off their most recent innovations, technology presentations will be offered by Virginia Tech faculty and staff on topics ranging from a virtual greenhouse to the System X supercomputer.

Reconciliation of high-tech and high-touch for SME innovation performance in Indonesia

OpenAIRE

RIDUAN R.

2017-01-01

The euphoria of technology in the Internet of Things (IOT) era is not only more advantageous but also provides double-edged sword effect for high-tech SMEs. In general, high-tech SMEs have a dependence on technology and neglect high touch aspect capacity to build relationships with human resources. Ironically, it is otherwise allegedly in an action as it is assumed to cause innovation imbalance where the product of SME innovation is high-tech but low-touch. Given its importance, this study ai...

Orientace na konkurenci u hi-tech podniků

Directory of Open Access Journals (Sweden)

Lucie Kaňovská

2013-10-01

Full Text Available Purpose: The purpose of this paper is to examine the connection between market orientation and mainly competitor orientation and business performance at the hi-tech companies in the Czech Republic. Design/methodology/approach: The paper involves the New Method for measuring of market orientation. Data are collected through the survey and were used for the data analysis. Findings: The paper involves new aspects for perceiving competitor orientation, as a part of market orientation, and business performance. The result concurs with the results of researches of market orientation realized at this branch. Results show that competitor orientation has significant influence on business performance. Research limitations implications: The limitations are based on the methodology used for gaining data. However, the overall response rate is almost 20 %. The hi-tech industry is fast changing. From this reason, there can be many changes and it is impossible to repeat the research at the same companies. Practical implications: Our findings can help to understand market orientation and its relationship to competitors and business performance. Managers can use method for measuring of market orientation and can find out the level of market orientation at their companies. They can compare their results with the published average results of hi-tech companies. Originality/value: The originality of the paper comes from combining market orientation, the view of competition and business performance at hi-tech companies. The measurement of market orientation was made through the New Method. The model of the New method was constructed along after analysis of other 25 methods; we tried to eliminate the failings criticized in other methods.

Capturing the real value in high-tech acquisitions.

Science.gov (United States)

Chaudhuri, S; Tabrizi, B

1999-01-01

Eager to stay ahead of fast-changing markets, more and more high-tech companies are going outside for competitive advantage. Last year in the United States alone, there were 5,000 high-tech acquisitions, but many of them yielded disappointing results. The reason, the authors contend, is that most managers have a shortsighted view of strategic acquisitions--they focus on the specific products or market share. That focus might make sense in some industries, where those assets can confer substantial advantages, but in high tech, full-fledged technological capabilities--tied to skilled people--are the key to long-term success. Instead of simply following the "buzz," successful acquires systematically assess their own capability needs. They create product road maps to identify holes in their product line. While the business group determines if it can do the work in-house, the business development office scouts for opportunities to buy it. Once business development locates a candidate, it conducts an expanded due diligence, which goes beyond strategic, financial, and legal checks. Successful acquires are focused on long-term capabilities, so they make sure that the target's products reflect a real expertise. They also look to see if key people would be comfortable in the new environment and if they have incentives to stay on board. The final stage of a successful acquisition focuses on retaining the new people--making sure their transition goes smoothly and their energies stay focused. Acquisitions can cause great uncertainty, and skilled people can always go elsewhere. In short, the authors argue, high-tech acquisitions need a new orientation around people, not products.

Epidermis-type lipoxygenase 3 regulates adipocyte differentiation and peroxisome proliferator-activated receptor gamma activity

DEFF Research Database (Denmark)

Hallenborg, Philip; Jørgensen, Claus; Petersen, Rasmus K

2010-01-01

preadipocytes. Here, we show that forced expression of eLOX3 or addition of eLOX3 products stimulated adipogenesis under conditions that normally require an exogenous PPAR gamma ligand for differentiation. Hepoxilins, a group of oxidized arachidonic acid derivatives produced by eLOX3, bound to and activated...... PPAR gamma. Production of hepoxilins was increased transiently during the initial stages of adipogenesis. Furthermore, small interfering RNA-mediated or retroviral short hairpin RNA-mediated knockdown of eLOX3 expression abolished differentiation of 3T3-L1 preadipocytes. Finally, we demonstrate...... differentiation has remained enigmatic. Previously, we showed that lipoxygenase (LOX) activity is involved in activation of PPAR gamma during the early stages of adipocyte differentiation. Of the seven known murine LOXs, only the unconventional LOX epidermis-type lipoxygenase 3 (eLOX3) is expressed in 3T3-L1...

Princeton Plasma Physics Laboratory for FY2003. Annual Highlights

International Nuclear Information System (INIS)

Phillips, Carol A.; DeMeo, Anthony R.

2004-01-01

The Princeton Plasma Physics Laboratory FY2003 Annual Highlights report provides a summary of the activities at the Laboratory for the fiscal year--1 October 2002 through 30 September 2003. The report includes the Laboratory's Mission and Vision Statements, a message ''From the Director,'' summaries of the research and engineering activities by project, and sections on Technology Transfer, the Graduate and Science Education Programs, Awards and Honors garnered by the Laboratory and the employees, and the Year in Pictures. There is also a listing of the Laboratory's publications for the year and a section of the abbreviations, acronyms, and symbols used throughout the report. In the PDF document, links have been created from the Table of Contents to each section. You can also return to the Table of Contents from the beginning page of each section. The PPPL Highlights for fiscal year 2003 is also available in hardcopy format. To obtain a copy e-mail Publications and Reports at: pub-reports at pppl.gov. Be sure to include your complete mailing address

The marketing of high-tech innovation: research and teaching as a multidisciplinary communication task

OpenAIRE

Hasenauer, Rainer; Fi8lo, Peter; Störi, Herbert

2013-01-01

Economically successful high-tech innovation is one of the driving forces for global welfare. Like innovation half-life, break-even time to market or technology acceptance, effective multidisciplinary communication between engineering and marketing is a critical success factor. This paper aims to show the requirements of multidisciplinary communication in B2B marketing of high-tech innovation and methodical approaches in research and academic education: 1. Requirements in high-tech innovat...

Supplier challenges in health tech innovation

DEFF Research Database (Denmark)

Rolfstam, Max

Suppliers, in particular small innovative firms, is an important contributor not only for innovation in health-tech, but also a component to consider in the light of the emerging policy interest for using public procurement as a means to stimulate innovation. Research on barriers preventing...

A small diameter, flexible, all attitude, self-contained germanium spectrometer. Operator's manual

International Nuclear Information System (INIS)

Bordzindki, R.L.; Lepel, E.A.; Reeves, J.H.; Kohli, R.

1997-05-01

The end of the Cold War has brought about tremendous changes in the nuclear complex of the Department of Energy. One of the many changes has been the shutdown or decommissioning of many facilities that performed nuclear work. One of the steps in the process of decommissioning a facility involves the decontamination or removal of drain lines or pipes that may have carried radioactive materials at one time. The removal of all these pipes and drain lines to a nuclear disposal facility could be quite costly. It was suggested by Pacific Northwest National Laboratory (PNNL) that a germanium spectrometer could be built that could fit through straight pipes with a diameter as small as 5.08 cm (2 inches) and pass through curved pipes with a diameter as small as 7.6 cm (3 inches) such as that of a 3-inch p-trap in a drain line. The germanium spectrometer could then be used to simultaneously determine all gamma-ray emitting radionuclides in or surrounding the pipe. By showing the absence of any gamma-ray emitting radionuclides, the pipes could then be reused in place or disposed of as non-radioactive material, thus saving significantly in disposal costs. A germanium spectrometer system has been designed by PNNL and fabricated by Princeton Gamma Tech (PGT) that consists of three segments, each 4.84 cm in diameter and about 10 cm in length. Flexible stainless steel bellows were used to connect the segments. Segment 1 is a small liquid nitrogen reservoir. The reservoir is filled with a sponge-like material which enables the detector to be used in any orientation. A Stirling cycle refrigerator is under development which can replace the liquid nitrogen reservoir to provide continuous cooling and operation

Modulated High-Energy Gamma-Ray Emission from the Micro-quasar Cygnus X-3

International Nuclear Information System (INIS)

Abdo, A.A.; Cheung, C.C.; Dermer, C.D.; Grove, J.E.; Johnson, W.N.; Lovellette, M.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wood, K.S.; Abdo, A.A.; Cheung, C.C.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Focke, W.B.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Johnson, A.S.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tanaka, T.; Thayer, J.B.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Waite, A.P.; Wang, P.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Focke, W.B.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Johnson, A.S.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tanaka, T.; Thayer, J.B.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Waite, A.P.; Wang, P.; Axelsson, M.; Hjalmarsdotter, L.; Axelsson, M.; Conrad, J.; Hjalmarsdotter, L.; Jackson, M.S.; Meurer, C.; Ryde, F.; Ylinen, T.; Baldini, L.; Bellazzini, R.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Ballet, J.; Casandjian, J.M.; Chaty, S.; Corbel, S.; Grenier, I.A.; Koerding, E.; Rodriguez, J.; Starck, J.L.; Tibaldo, L.

2009-01-01

Micro-quasars are accreting black holes or neutron stars in binary systems with associated relativistic jets. Despite their frequent outburst activity, they have never been unambiguously detected emitting high-energy gamma rays. The Fermi Large Area Telescope (LAT) has detected a variable high-energy source coinciding with the position of the x-ray binary and micro-quasar Cygnus X-3. Its identification with Cygnus X-3 is secured by the detection of its orbital period in gamma rays, as well as the correlation of the LAT flux with radio emission from the relativistic jets of Cygnus X-3. The gamma-ray emission probably originates from within the binary system, opening new areas in which to study the formation of relativistic jets. (authors)

78 FR 14359 - Verizon Business Networks Services, Inc., Specialist-Tech Customer Service, Philadelphia, PA...

Science.gov (United States)

2013-03-05

... Business Networks Services, Inc., Specialist-Tech Customer Service, Philadelphia, PA; Verizon Business Networks Services, Inc., Specialist-Tech Customer Service, Tampa, Florida; Amended Certification Regarding... should [[Page 14360

State of FinTech in Europe: Mutation perspectives of the banking sector

OpenAIRE

Marasco, Marco

2017-01-01

This paper studies the relationship between FinTech start-ups and the banking sector. The aim is to assess the impact that the FinTech sector might have on the business model and profitability of banks. Master [120] en sciences de gestion (Mons), Université catholique de Louvain, 2017

The Study of Radiation of Gamma-Ray Background at Sedimentology Laboratorium, P3TIR, BATAN, Using Gamma Spectrometry

International Nuclear Information System (INIS)

Lubis, Ali Arman; Aliyanta, Barokah; Darman

2002-01-01

The measurement of background radiation of gamma-ray has been done at Sedimentology Laboratory, SDAL building, P3TIR, BATAN using gamma spectrometer. The measurement was done without shielding with the range of energy between 50 keV and 1500 keV. The identified radiations are coming from environmental radionuclide and man-made radionuclide as well with 32 energy peaks. The environmental radionuclides are from Uranium series, Thorium series, and 4 0 K having dose rate of 12.510 ± O.980, 36.408 ± 3.243, 9.455 ±O.016 n Sv/day, respectively, whilst man-made radionuclide is 6 O C o having dose rate of O.136 ±O.078 n Sv/day

Time of use metering : the experience of Princeton Light and Power

International Nuclear Information System (INIS)

Hall, J.

2004-01-01

Princeton Light and Power (PLP) provides power distribution services to 7,000 customers in the Similkameen Valley in British Columbia. This PowerPoint presentation described how the utility has implemented time-of-use (TOU) rates and metering. The drivers for TOU that are most often overlooked include: the cost of additional power generation, deferral of system upgrades, improving system load factor, system reliability, controlling rate increase, growing sales, and offering choices to the customer. It was noted that unbundled rates are required for a successful TOU program. PLP's rate design and billing formula were presented along with its plan to make it worthwhile for the customers to install load shifting equipment such as delay timers, thermal storage heating units, and powerline carrier signal equipment. A review of peak hour operation and off-peak hour operation was also presented. tabs., figs

Do gender and personality traits (BFI-10) influence self-perceived tech savviness?

DEFF Research Database (Denmark)

Sudzina, Frantisek

2015-01-01

Nowadays, it is necessary to use technology in various everyday activities. A certain level of what used to be called high-tech savviness is needed to access certain services. The aim of this paper is to analyze if gender and personality traits (Big Five Inventory-10) influence self-perceived tech...

Virginia tech freshman class becoming more competitive; Rise in grades and test scores noted

OpenAIRE

Virginia Tech News

2004-01-01

Admission to Virginia Tech continues to become more competitive as applicants report higher grade point averages and test scores than previous years. The incoming class of 4,975 students has an average grade point average (GPA) of 3.68 and SAT 1203, up from 3.60 GPA and 1197 SAT in 2003.

A study on correlation between 2D and 3D gamma evaluation metrics in patient-specific quality assurance for VMAT

Energy Technology Data Exchange (ETDEWEB)

Rajasekaran, Dhanabalan, E-mail: dhanabalanraj@gmail.com; Jeevanandam, Prakash; Sukumar, Prabakar; Ranganathan, Arulpandiyan; Johnjothi, Samdevakumar; Nagarajan, Vivekanandan

2014-01-01

In this study, we investigated the correlation between 2-dimensional (2D) and 3D gamma analysis using the new PTW OCTAVIUS 4D system for various parameters. For this study, we selected 150 clinically approved volumetric-modulated arc therapy (VMAT) plans of head and neck (50), thoracic (esophagus) (50), and pelvic (cervix) (50) sites. Individual verification plans were created and delivered to the OCTAVIUS 4D phantom. Measured and calculated dose distributions were compared using the 2D and 3D gamma analysis by global (maximum), local and selected (isocenter) dose methods. The average gamma passing rate for 2D global gamma analysis in coronal and sagittal plane was 94.81% ± 2.12% and 95.19% ± 1.76%, respectively, for commonly used 3-mm/3% criteria with 10% low-dose threshold. Correspondingly, for the same criteria, the average gamma passing rate for 3D planar global gamma analysis was 95.90% ± 1.57% and 95.61% ± 1.65%. The volumetric 3D gamma passing rate for 3-mm/3% (10% low-dose threshold) global gamma was 96.49% ± 1.49%. Applying stringent gamma criteria resulted in higher differences between 2D planar and 3D planar gamma analysis across all the global, local, and selected dose gamma evaluation methods. The average gamma passing rate for volumetric 3D gamma analysis was 1.49%, 1.36%, and 2.16% higher when compared with 2D planar analyses (coronal and sagittal combined average) for 3 mm/3% global, local, and selected dose gamma analysis, respectively. On the basis of the wide range of analysis and correlation study, we conclude that there is no assured correlation or notable pattern that could provide relation between planar 2D and volumetric 3D gamma analysis. Owing to higher passing rates, higher action limits can be set while performing 3D quality assurance. Site-wise action limits may be considered for patient-specific QA in VMAT.

Wood residue production and utilization research at Virgina Tech

Energy Technology Data Exchange (ETDEWEB)

Grace, L.A.; Stuart, W.B.; Sharp, J.C. (Virginia Polytechnic Inst. and State Univ., Blacksburg, VA (US)); Yu Jian-guo (Northeastern Forestry Univ., Harbin (CN))

1988-01-01

This paper describes the activities in crushing, drying and segregating wood residues currently underway at Virginia Tech. Experiments with high speed roll crushing as a means of reducing logging residues and small diameter stems to a form suitable for transportation and further processing appear promising. Deflecting whole tree chip streams across a double set of screens coupled with stripping transport air has been shown to reduce bark content and remove fines, bark and grit. Testing and refinement of two prototype sawdust driers is currently under way. Both driers offer increased opportunity for suspension burning and transport. (4 refs., 3 tabs., 3 figs.) (au).

MUSEUM GEOLOGI DAN PRASEJARAH DI MAKASSAR DENGAN PENDEKATAN ARSITEKTUR HIGH TECH

Directory of Open Access Journals (Sweden)

Saefullah Saefullah

2015-12-01

Full Text Available Abstrak—Indonesia kaya akan sumber daya geologi yang terdiri dari batuan, mineral dan bahan tambang. Berbicara mengenai geologi sangat erat kaitannya dengan zaman prasejarah.karena belum ditemukannya bukti-bukti tertulis dari zaman prasejarah tersebut, keterangan mengenai zaman ini diperoleh melalui bidang-bidang seperti paleontologi, astronomi, biologi, geologi, antropologi, dan arkeologi pentingnya melestarikan dan menjaga peninggalan-peninggalan prasejarah. Sehingga akan menumbuhkan rasa tanggungjawab terhadapnya. Hal ini sejalan dengan tugas Direktorat Jendral Kebudayaan Kementrian Pendidikan dan Kebudyaaan Indonesia dalam laporan kinerjanya .yang mengemukakan bahwa sisa-sisa peninggalan sejarah penting dipelihara sebagai pelajaran hidup bagi generasi berikutnya.Tujuan penelitian menyusun suatu landasan konseptual desain perancangan Museum Geologi dan prasejarah dengan pendekatan arsitektur high-tech, menerapkan system Double fasade, Ligth Pipe dan system fotovoltaic pada bangunan, mengaplikasikan intelegent system pada utilitas pada bangunan.Hasil Laporan ini adalah mendesain bangunan museum geologi dan prasejarah di Makassar dengan pendekatan arsitektur high-tech. Kata Kunci :Museum geologi, prasejarah, high-tech Abstract-Indonesia is rich geological resources consisting of rocks, minerals and minerals. Talking about the geology is very closely related to prehistoric times because of not finding written evidence from prehistoric times, the information concerning this age obtained through fields like paleontology, astronomy, biology, geology, anthropology, and archeology importance of preserving and maintaining prehistoric relics. So will foster a sense of responsibility to it. This is in line with the duties of the Directorate General of Culture Ministry of Education and Indonesian culture in its performance report which suggested that the remains of important historical remains preserved as a living lesson for the next generation. The

Entrepreneurship in high-tech and knowledge-intensive sectors

DEFF Research Database (Denmark)

Christensen, Patrizia V.; Madsen, Henning; Neergaard, Helle

development of new enterprises in high-tech and knowledge-intensive sectors are analysed in relation to the educational and professional background of the entrepreneur/entrepreneurial team, as well as the personal and professional social networks of the entrepreneurs. The analysis is based on a theoretical...... framework combining theories of human and social capital. Secondary aspects addressed in the research project are questions of male vs. female entrepreneurship, internationalisation-globalisation, and business success/failure.......The paper investigates key factors influencing the establishment and early growth of high-tech and knowledge-intensive new firms in Denmark. Particular attention is paid to the human and social variables affecting the creation, survival, and growth of such firms. The establishment and subsequent...

Time resolved reflectivity measurements of the amorphous-to-gamma and gamma-to-alpha phase transitions in ion-implanted Al2O3

International Nuclear Information System (INIS)

McCallum, J.C.; Simpson, T.W.; Mitchell, I.V.

1994-01-01

Time resolved optical reflectivity (TRR) has been used to measure the growth kinetics associated with the amorphous-to-gamma and gamma-to-alpha phase transitions in ion-beam amorphised c-axis oriented α-Al 2 O 3 . The optical reflectivity technique allows the recrystallisation behaviour to be monitored dynamically during regrowth so that the growth kinetics associated with the two phase transitions can be measured simply and accurately from a relatively small number of samples. The amorphous-to-gamma and gamma-to-alpha phase transitions were studied over the temperature ranges of 670-770 C and 900-1070 C, respectively. The growth kinetics obtained for the two transitions are compared to previous work. ((orig.))

Princeton Plasma Physics Laboratory (PPPL) seismic hazard analysis

International Nuclear Information System (INIS)

Savy, J.

1989-01-01

New design and evaluation guidelines for department of energy facilities subjected to natural phenomena hazard, are being finalized. Although still in draft form at this time, the document describing those guidelines should be considered to be an update of previously available guidelines. The recommendations in the guidelines document mentioned above, and simply referred to as the ''guidelines'' thereafter, are based on the best information at the time of its development. In particular, the seismic hazard model for the Princeton site was based on a study performed in 1981 for Lawrence Livermore National Laboratory (LLNL), which relied heavily on the results of the NRC's Systematic Evaluation Program and was based on a methodology and data sets developed in 1977 and 1978. Considerable advances have been made in the last ten years in the domain of seismic hazard modeling. Thus, it is recommended to update the estimate of the seismic hazard at the DOE sites whenever possible. The major differences between previous estimates and the ones proposed in this study for the PPPL are in the modeling of the strong ground motion at the site, and the treatment of the total uncertainty in the estimates to include knowledge uncertainty, random uncertainty, and expert opinion diversity as well. 28 refs

Princeton Plasma Physics Laboratory (PPPL) seismic hazard analysis

Energy Technology Data Exchange (ETDEWEB)

Savy, J.

1989-10-01

New design and evaluation guidelines for department of energy facilities subjected to natural phenomena hazard, are being finalized. Although still in draft form at this time, the document describing those guidelines should be considered to be an update of previously available guidelines. The recommendations in the guidelines document mentioned above, and simply referred to as the guidelines'' thereafter, are based on the best information at the time of its development. In particular, the seismic hazard model for the Princeton site was based on a study performed in 1981 for Lawrence Livermore National Laboratory (LLNL), which relied heavily on the results of the NRC's Systematic Evaluation Program and was based on a methodology and data sets developed in 1977 and 1978. Considerable advances have been made in the last ten years in the domain of seismic hazard modeling. Thus, it is recommended to update the estimate of the seismic hazard at the DOE sites whenever possible. The major differences between previous estimates and the ones proposed in this study for the PPPL are in the modeling of the strong ground motion at the site, and the treatment of the total uncertainty in the estimates to include knowledge uncertainty, random uncertainty, and expert opinion diversity as well. 28 refs.

Gamma Ray Imaging System (GRIS) GammaCam trademark. Final report, January 3, 1994 - May 31, 1996

International Nuclear Information System (INIS)

1996-01-01

This report describes the activities undertaken during the development of the Gamma Ray Imaging System (GRIS) program now referred to as the GammaCam trademark. The purpose of this program is to develop a 2-dimensional imaging system for gamma-ray energy scenes that may be present in nuclear power plants. The report summarizes the overall accomplishments of the program and the most recent GammaCam measurements made at LANL and Estonia. The GammaCam is currently available for sale from AIL Systems as an off-the-shelf instrument

FERMI LAT DISCOVERY OF EXTENDED GAMMA-RAY EMISSIONS IN THE VICINITY OF THE HB 3 SUPERNOVA REMNANT

Energy Technology Data Exchange (ETDEWEB)

Katagiri, H.; Yoshida, K. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d’Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Grondin, M.-H.; Lemoine-Goumard, M. [Centre d’Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Hanabata, Y. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba, 277-8582 (Japan); Hewitt, J. W. [Department of Physics and Center for Space Sciences and Technology, University of Maryland Baltimore County, Baltimore, MD 21250 (United States); Kubo, H., E-mail: hideaki.katagiri.sci@vc.ibaraki.ac.jp, E-mail: 13nm169s@gmail.com [Department of Physics, Graduate School of Science, Kyoto University, Kyoto (Japan)

2016-02-20

We report the discovery of extended gamma-ray emission measured by the Large Area Telescope (LAT) onboard the Fermi Gamma-ray Space Telescope in the region of the supernova remnant (SNR) HB 3 (G132.7+1.3) and the W3 II complex adjacent to the southeast of the remnant. W3 is spatially associated with bright {sup 12}CO (J = 1–0) emission. The gamma-ray emission is spatially correlated with this gas and the SNR. We discuss the possibility that gamma rays originate in interactions between particles accelerated in the SNR and interstellar gas or radiation fields. The decay of neutral pions produced in nucleon–nucleon interactions between accelerated hadrons and interstellar gas provides a reasonable explanation for the gamma-ray emission. The emission from W3 is consistent with irradiation of the CO clouds by the cosmic rays accelerated in HB 3.

Crystal growth and thermoluminescence response of NaZr2(PO4)3 at high gamma radiation doses

International Nuclear Information System (INIS)

Ordóñez-Regil, E.; Contreras-Ramírez, A.; Fernández-Valverde, S.M.; González-Martínez, P.R.; Carrasco-Ábrego, H.

2013-01-01

Graphical abstract: -- Highlights: •NaZr 2 (PO 4 ) 3 exposed to gamma doses of 10, 30 and 50 MGy. •Gamma radiation produced growth of the crystal size of the NZP. •Morphology changes were reversible by heating. •Linear relationship between the thermoluminescence and the applied gamma dose. •This property could be useful for high-level gamma dosimetry. -- Abstract: This work describes the synthesis and characterization of NaZr 2 (PO 4 ) 3 . The stability of this material under high doses of gamma radiation was investigated in the range of 10–50 MGy. Samples of unaltered and gamma irradiated NaZr 2 (PO 4 ) 3 were characterized by X-ray diffraction, infrared spectroscopy, scanning electron microscopy, energy dispersive X-ray spectroscopy, and thermoluminescence. The results showed that while functional groups were not affected by the gamma irradiation, morphology changes were observed with increasing doses of gamma irradiation. The morphology of the non-irradiated compound is agglomerated flakes; however, irradiation at 10 MGy splits the flakes inducing the formation of well-defined cubes. Gamma irradiation induced the crystal size of the NaZr 2 (PO 4 ) 3 to grow. The heat treatment (973 K) of samples irradiated at 50 MGy resulted in the recovery of the original morphology. Furthermore, the thermoluminescence analysis of the irradiated compound is reported

A comparative study of LaBr{sub 3}(Ce{sup 3+}) and CeBr{sub 3} based gamma-ray spectrometers for planetary remote sensing applications

Energy Technology Data Exchange (ETDEWEB)

Kozyrev, A., E-mail: kozyrev@mx.iki.rssi.ru; Mitrofanov, I.; Bakhtin, B.; Fedosov, F.; Golovin, D.; Litvak, M.; Malakhov, A.; Mokrousov, M.; Nuzhdin, I.; Sanin, A.; Tretyakov, V.; Vostrukhin, A. [Space Research Institute of the Russian Academy of Sciences (IKI), 84/32 Profsoyuznaya St., Moscow 117997 (Russian Federation); Owens, A.; Benkhoff, J. [European Space Agency, ESTEC, Keplerlaan, 2200 AG Noordwijk (Netherlands); Quarati, F. [AP, RST, FAME, Delft University of Technology, Mekelweg 15, 2629 JB Delft (Netherlands); Gonitec BV, J. Bildersstraat 60, 2596 EJ Den Haag (Netherlands); Timoshenko, G.; Shvetsov, V. [Joint Institute for Nuclear Research, Joliot-Curie 6, Dubna, Moscow Region 141980 (Russian Federation); Granja, C.; Slavicek, T.; Pospisil, S. [Institute of Experimental and Applied Physics, Czech Technical University in Prague, Horska 3a/22, 12800 Prague 2 (Czech Republic)

2016-08-15

The recent availability of large volume cerium bromide crystals raises the possibility of substantially improving gamma-ray spectrometer limiting flux sensitivities over current systems based on the lanthanum tri-halides, e.g., lanthanum bromide and lanthanum chloride, especially for remote sensing, low-level counting applications or any type of measurement characterized by poor signal to noise ratios. The Russian Space Research Institute has developed and manufactured a highly sensitive gamma-ray spectrometer for remote sensing observations of the planet Mercury from the Mercury Polar Orbiter (MPO), which forms part of ESA’s BepiColombo mission. The Flight Model (FM) gamma-ray spectrometer is based on a 3-in. single crystal of LaBr{sub 3}(Ce{sup 3+}) produced in a separate crystal development programme specifically for this mission. During the spectrometers development, manufacturing, and qualification phases, large crystals of CeBr{sub 3} became available in a subsequent phase of the same crystal development programme. Consequently, the Flight Spare Model (FSM) gamma-ray spectrometer was retrofitted with a 3-in. CeBr{sub 3} crystal and qualified for space. Except for the crystals, the two systems are essentially identical. In this paper, we report on a comparative assessment of the two systems, in terms of their respective spectral properties, as well as their suitability for use in planetary mission with respect to radiation tolerance and their propensity for activation. We also contrast their performance with a Ge detector representative of that flown on MESSENGER and show that: (a) both LaBr{sub 3}(Ce{sup 3+}) and CeBr{sub 3} provide superior detection systems over HPGe in the context of minimally resourced spacecraft and (b) CeBr{sub 3} is a more attractive system than LaBr{sub 3}(Ce{sup 3+}) in terms of sensitivities at lower gamma fluxes. Based on the tests, the FM has now been replaced by the FSM on the BepiColombo spacecraft. Thus, CeBr{sub 3} now forms

The effects of gamma radiation on 2,3-diphosphoglycerate (2,3-DFG) content in healthy men's erythrocytes after submaximal physical exercise

International Nuclear Information System (INIS)

Dudek, I.; Zagorski, T.; Kedziora, J.

1987-01-01

The effects of gamma radiation and submaximal physical exercise on 2,3-DFG content in healthy men erythrocytes were studied. Twelve men aged 20-22 were examined. They were loaded by physical exrecise (at doses of 2 M/kg body weight) for 15 minutes. Erythrocytes were exposed to gamma radiation (500 Gy doses) from a 60 Co source. The concentration of 2,3-DFG in erythrocytes was estimated by Bartlett's method. Gamma radiation was found to decrese 2,3-DFG content in erythrocytes both at rest and after submaximal exercise. Furthermore, submaximal physical exercise was found to decrease 2,3-DFG content in non-irradiated erythrocytes. 20 refs., 1 tab. (author)

Subtrochanteric femoral fractures treated with the Long Gamma3® nail: A historical control case study versus Long trochanteric Gamma nail®.

Science.gov (United States)

Georgiannos, D; Lampridis, V; Bisbinas, I

2015-10-01

Gamma nail was developed for the treatment of subtrochanteric hip fractures. Despite its advantages over extramedullary devices, gamma nail has been historically related to significant complications (implant breakage, femoral fractures at the tip of the nail). There is limited data to determine if the rate of these complications was minimized by using a new design of the gamma nail. Therefore we performed a case control study between the long gamma3 nail (LG3N) and the long trochanteric gamma nail (LTGN) to assess if: (1) the complication rate in the treatment of subtrochanteric fractures using the LG3N was lower than the one using the LTGN; (2) the reoperation rate was lower after using the LG3N. The complication rate after fixation of subtrochanteric fracture of the femur is lower with LG3N than with the LTGN. This study prospectively recorded the intra- and postoperative complications of 75 patients with subtrochanteric fractures treated with the LG3N and compared them with those of a historical cohort of 83 patients treated with the LTGN. The two groups were matched regarding age, gender and fracture type. Patients with open, pathological, or impending fractures were excluded. Intraoperative complications in the LG3N group were lower (4 cases, 5.3%) compared with those in the LTGN group (9 cases, 10.8%; P=0.04). The major intraoperative complication encountered with the use of LTGN was fracture of the femur in 3 cases. We encountered in total 9 postoperative complications in LG3N (12%) and 20 in group LTGN (24%). The most frequent complication in both groups was the cut out of the lag screw (3 cases in LG3N and 7 cases in LTGN group). The overall reoperation rate was higher in LTGN group (20.4% vs 10.6%; P=0.03). As a result of the improvement of its mechanical characteristics, LG3N has proved a safe and efficient implant for the treatment of subtochanteric fractures. The new design seems superior to previous generation, giving promising outcomes, reduced

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1996

Energy Technology Data Exchange (ETDEWEB)

J.D. Levine; V.L. Finley

1998-03-01

The results of the 1996 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the US Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. During Calendar Year 1996, PPPL's Tokamak Fusion Test Reactor (TFTR) continued to conduct fusion experiments. Having set a world record on November 2, 1994, by achieving approximately 10.7 million watts of controlled fusion power during the deuterium-tritium (D-T) plasma experiments, researchers turned their attention to studying plasma science experiments, which included ''enhanced reverse shear techniques.'' Since November 1993, more than 700 tritium-fueled experiments were conducted, which generated more than 4 x 10(superscript 20) neutrons and 1.4 gigajoules of fusion energy. In 1996, the overall performance of Princeton Plasma Physics Laboratory was rated ''excellent'' by the US Department of Energy in the Laboratory Appraisal report issued in early 1997. The report cited the Laboratory's consistently excellent scientific and technological achievements and its successful management practices, which included high marks for environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey Department of Environmental Protection. PPPL monitored for the presence of nonradiological contaminants, mainly volatile organic compounds (components of degreasing solvents) and petroleum hydrocarbons (past leaks of releases of diesel fuel from underground storage tanks). Also, PPPL's radiological monitoring program characterized the ambient, background levels of tritium in the environment and

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1996

International Nuclear Information System (INIS)

J.D. Levine; V.L. Finley

1998-01-01

The results of the 1996 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the US Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. During Calendar Year 1996, PPPL's Tokamak Fusion Test Reactor (TFTR) continued to conduct fusion experiments. Having set a world record on November 2, 1994, by achieving approximately 10.7 million watts of controlled fusion power during the deuterium-tritium (D-T) plasma experiments, researchers turned their attention to studying plasma science experiments, which included ''enhanced reverse shear techniques.'' Since November 1993, more than 700 tritium-fueled experiments were conducted, which generated more than 4 x 10(superscript 20) neutrons and 1.4 gigajoules of fusion energy. In 1996, the overall performance of Princeton Plasma Physics Laboratory was rated ''excellent'' by the US Department of Energy in the Laboratory Appraisal report issued in early 1997. The report cited the Laboratory's consistently excellent scientific and technological achievements and its successful management practices, which included high marks for environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey Department of Environmental Protection. PPPL monitored for the presence of nonradiological contaminants, mainly volatile organic compounds (components of degreasing solvents) and petroleum hydrocarbons (past leaks of releases of diesel fuel from underground storage tanks). Also, PPPL's radiological monitoring program characterized the ambient, background levels of tritium in the environment and from the TFTR stack; the data are presented in this report

Sposoby i skuteczność promocji bibliograficznej bazy danych BazTech

OpenAIRE

Derfert-Wolf, Lidia; Buzdygan, Dorota

2015-01-01

[The ways and effectiveness of promotion bibliographic database BazTech] The article outlines the strategy promotion database BazTech, which indexes Polish scientific journals in the field of technical sciences. The implementation steps of key tools promotion: cycle of seminars, profile on a social networking site, movie, infographics, leaflets. Shows the target groups, the expected results and contractors. Indicated realised at the same time promotion activities, open access and increasing v...

UV and gamma ray induced thermoluminescence properties of cubic Gd2O3:Er3+ phosphor

Directory of Open Access Journals (Sweden)

Raunak Kumar Tamrakar

2014-10-01

Full Text Available This paper reports the thermoluminescence properties of Er3+ doped gadolinium oxide nanophosphor. The phosphor is prepared by high temperature solid state reaction method. The method is suitable for large scale production. Starting materials used for sample preparation were Gd2O3, Er2O3 (0.5–2.5 mol% and fixed concentration of boric acid using as a flux. The prepared samples were characterized by X-ray diffraction technique and the particle size calculated by Scherer's formula. The surface morphology of prepared phosphor is determined by scanning electron microscopic (SEM technique. Functional group analysis was done by Fourier transform infra-red spectroscopy (FTIR analysis. The elemental analysis of prepared sample was determined by energy dispersive X-ray analysis (EDX and the exact particle size of prepared phosphor for the different concentration of dopant (Er3+ was evaluated by transmission electron microscopy (TEM technique. The prepared phosphors for different concentration of Er3+ were examined by thermoluminescence (TL glow curve for UV and gamma irradiation. The UV 254 nm source was used for UV irradiation and Co60 source was used for gamma irradiation. The samples show well resolved broad peak covered the temperature range 50–250 °C and the peak temperature found at 126 °C for UV irradiation and higher temperature peak at 214 °C for gamma irradiation. The effect of heating rate on TL studies was presented for optimized sample. Here UV irradiated sample shows the formation of shallow trap (surface trapping and the gamma irradiated sample shows the formation of deep trapping. The estimation of trap formation was evaluated by knowledge of trapping parameters. The trapping parameters such as activation energy, order of kinetics and frequency factor were calculated by peak shape method. Here most of the peak shows second order of kinetics. The effect of gamma and UV exposure on TL studies was also examined and it shows linear

AspenTech shows specific tools for refiners; AspenTech deploie des outils specifiques pour les raffineurs

Energy Technology Data Exchange (ETDEWEB)

Legros, E

2003-10-01

The supplier of integrated softwares AspenTech has organized last May, the 7 in Gelsenkirchen, on the site of the Veba Oel refinery, a seminar 'refining' intended to show the specificities of its products: Hysys, Aspen Utilities, Icarus...About fifty German engineers and responsible persons coming from refining and engineering firms have participated to this studies day. (O.M.)

FY93 Princeton Plasma Physics Laboratory. Annual report, October 1, 1992--September 30, 1993

Energy Technology Data Exchange (ETDEWEB)

1995-02-01

This is the annual report from the Princeton Plasma Physics Laboratory for the period October 1, 1992 to September 30, 1993. The report describes work done on TFTR during the year, as well as preparatory to beginning of D-T operations. Design work is ongoing on the Tokamak Physics Experiment (TPX) which is to test very long pulse operations of tokamak type devices. PBX has come back on line with additional ion-Bernstein power and lower-hybrid current drive. The theoretical program is also described, as well as other small scale programs, and the growing effort in collaboration on international design projects on ITER and future collaborations at a larger scale.

FY93 Princeton Plasma Physics Laboratory. Annual report, October 1, 1992--September 30, 1993

International Nuclear Information System (INIS)

1995-01-01

This is the annual report from the Princeton Plasma Physics Laboratory for the period October 1, 1992 to September 30, 1993. The report describes work done on TFTR during the year, as well as preparatory to beginning of D-T operations. Design work is ongoing on the Tokamak Physics Experiment (TPX) which is to test very long pulse operations of tokamak type devices. PBX has come back on line with additional ion-Bernstein power and lower-hybrid current drive. The theoretical program is also described, as well as other small scale programs, and the growing effort in collaboration on international design projects on ITER and future collaborations at a larger scale

Dosimetric evaluation of lithium carbonate (Li2CO3) as a dosemeter for gamma-radiation dose measurements.

Science.gov (United States)

Popoca, R; Ureña-Núñez, F

2009-06-01

This work reports the possibility of using lithium carbonate as a dosimetric material for gamma-radiation measurements. Carboxi-radical ions, CO(2)(-) and CO(3)(-), arise from the gamma irradiation of Li(2)CO(3), and these radical ions can be quantified by electron paramagnetic resonance (EPR) spectrometry. The EPR-signal response of gamma-irradiated lithium carbonate has been investigated to determine some dosimetric characteristics such as: peak-to-peak signal intensity versus gamma dose received, zero-dose response, signal fading, signal repeatability, batch homogeneity, dose rate effect and stability at different environmental conditions. Using the conventional peak-to-peak method of stable ion radicals, it is concluded that lithium carbonate could be used as a gamma dosemeter in the range of 3-100 Gy.

Prospect, Practices and Safety for Quality Management of the Gamma Greenhouse, a Novel Facility for Chronic Gamma Radiation

International Nuclear Information System (INIS)

Azhar Mohamad; Sobri Hussein; Abdul Rahim Harun; Ahsanulkhaliqin Abdul Wahab

2012-01-01

Malaysia has a special facility for chronic irradiation, known as the Gamma Greenhouse (GGH), located at MINT-Tech Park in Jalan Dengkil, Malaysian Nuclear Agency (Nuclear Malaysia). The Gamma Greenhouse source of chronic irradiation comes from a 137 Cs double encapsulated 800 Ci Cesium-137 pencil, producing a low dose rate, which is considered to be more effective in recovering and producing useful mutants in comparison to acute irradiation at higher dose. The irradiation facility comprises an open-topped irradiation area, 30 m in diameter, protected by a partial concrete wall, with entrance maze and site topography. High safety features are in place, where the facility is protected by a sophisticated interlock system that only allows the source to be exposed when all the prerequisite safety conditions are met, and automatically returns the source to the safe storage position if any safety device is compromised. The main irradiation area is further protected by a 300 m diameter exclusion zone that is also protected by the safety interlock circuit. The facility can accommodate a wide range of plant materials such as seeds, seedlings in pots, cuttings, calluses, somatic embryos and suspension cell cultures. In practice, plant samples will be exposed to low dose gamma radiation over long periods of time (hours, weeks, months), depending on their nature and sensitivity. All procedures generate data for evaluation, which require accuracy; quality management is essential in irradiation service. The prospect of the gamma greenhouse is in research and services on induced mutation techniques for the improvement of plant varieties and microbe strains. Services are provided to academicians, planters, students and researchers working with plants and microorganisms. In addition, it is also useful in the teaching and training on breeding, nuclear and radiation technology. The activities in utilization the gamma greenhouse cover mainly Research and Development, Research

Planning, Management and Organizational Aspects of the Decommissioning of Nuclear Facilities in Bangladesh

Energy Technology Data Exchange (ETDEWEB)

Mollah, A. S.; Begum, A.; Pal, D. [Bangladesh Atomic Energy Commission Agargaon, Dhaka (Bangladesh)

2013-08-15

This report summarizes the main results obtained by the Bangladesh Atomic Energy Commission in the decommissioning of spent {sup 60}Co gamma irradiator at GammaTech Limited, Chittagong, and preparation of decommissioning plan of the 3 MW TRIGA Mark-II research reactor in Bangladesh. (author)

The revival of General Relativity at Princeton: Daring Conservatism

Directory of Open Access Journals (Sweden)

Brill Dieter

2018-01-01

Full Text Available After General Relativity was established in essentially its present form in 1915 it was celebrated as a great success of mathematical physics. But the initial hopes for this theory as a basis for all of physics began to fade in the next several decades, as General Relativity was relegated to the margins of theoretical physics. Its fate began to rise in the 1950's in a revival of interest and research that over time made gravitational physics one of the hottest research topics it is today. One center of this renaissance was Princeton, where two relative newcomers explored new and different approaches to gravitational physics. Robert Dicke showed that gravity is not as inaccessible to experiment as was thought, and John Wheeler propelled it into the mainstream by proposing highly original and imaginative consequences of Einstein's theory. We will concentrate on these ideas that, in his characteristically intriguing style, Wheeler called "Daring Conservatism" -- a term well known to his associates, but one he never mentioned in print. With the aid of unpublished manuscripts and notes we will explore Daring Conservatism's origin and motivation, its successes and failures, and the legacy it left behind.

The revival of General Relativity at Princeton: Daring Conservatism

Science.gov (United States)

Brill, Dieter; Blum, Alexander

2018-01-01

After General Relativity was established in essentially its present form in 1915 it was celebrated as a great success of mathematical physics. But the initial hopes for this theory as a basis for all of physics began to fade in the next several decades, as General Relativity was relegated to the margins of theoretical physics. Its fate began to rise in the 1950's in a revival of interest and research that over time made gravitational physics one of the hottest research topics it is today. One center of this renaissance was Princeton, where two relative newcomers explored new and different approaches to gravitational physics. Robert Dicke showed that gravity is not as inaccessible to experiment as was thought, and John Wheeler propelled it into the mainstream by proposing highly original and imaginative consequences of Einstein's theory. We will concentrate on these ideas that, in his characteristically intriguing style, Wheeler called "Daring Conservatism" - a term well known to his associates, but one he never mentioned in print. With the aid of unpublished manuscripts and notes we will explore Daring Conservatism's origin and motivation, its successes and failures, and the legacy it left behind.

Failure to synthesize the CD3-gamma chain. Consequences for T cell antigen receptor assembly, processing, and expression

DEFF Research Database (Denmark)

Geisler, C

1992-01-01

surface expression of the Ti/CD3 complex. Transfection of the wild-type CD3-gamma gene into JGN reconstituted expression of functional Ti/CD3 complexes, and analysis of T cell lines producing different amounts of CD3-gamma indicated that CD3-gamma and CD3-delta competed for the binding to CD3-epsilon.......The TCR consists of the Ti alpha beta heterodimer and the associated CD3 chains, CD3 gamma delta epsilon zeta 2 or zeta eta. The structural relationships between the subunits of the Ti/CD3 complex are still not fully understood. To explore the roles of the individual CD3 chains for the assembly......, intracellular processing, and expression of the TCR, mutants of the T cell line Jurkat were isolated. One variant, JGN, was found to produce all the Ti/CD3 components with the exception of CD3-gamma. The results indicate that: 1) the tetrameric form (Ti alpha beta-CD3 delta epsilon) of the Ti/CD3 complex...

Analysis of ({sup 7}F{sub 0}){gamma}{sub 1g}{yields}({sup 5}D{sub 2}){gamma}{sub 5g}, {gamma}{sub 3g} and ({sup 7}F{sub 0}){gamma}{sub 1g}{yields}({sup 5}L{sub 6}){gamma}{sub 1g}, a{gamma}{sub 5g} two-photon absorption spectra of Cs{sub 2}NaYF{sub 6}:Eu{sup 3+}

Energy Technology Data Exchange (ETDEWEB)

Ning Lixin; Wang Dianyuan; Xia Shangda [Structure Research Laboratory, Academica Sinica, Department of Physics, University of Science and Technology of China, Heifei, Anhui (China); Thorne, Jonathan R.G. [Inorganic Chemistry Laboratory, Department of Chemistry, University of Oxford (United Kingdom); Tanner, Peter A. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon (China)

2002-04-15

The direct calculation of transition line strengths and relative intensities is presented for two intraconfigurational two-photon absorption (TPA) transitions of Eu{sup 3+} in the cubic Cs{sub 2}NaYF{sub 6} host. Crystal field wavefunctions were utilized for the initial and final f{sup N}-electron states and various approaches were used in constructing all the 4f{sup N-1} 5d{sup 1} intermediate-state wavefunctions. The calculated relative intensities of the ({sup 7}F{sub 0}) {gamma}{sub 1g}{yields}({sup 5}D{sub 2}){gamma}{sub 5g}, {gamma}{sub 3g} TPA transitions are in reasonable agreement with experiment. The neglect of J-mixing in the initial state has only a small effect upon the calculation, whereas the neglect of spin-orbit couplings within the initial and terminal states drastically reduces the calculated transition linestrengths, but does not markedly change the intensity ratios. In the case of the ({sup 7}F{sub 0}){gamma}{sub 1g}{yields}({sup 5}L{sub 6}){gamma}{sub 1g}, a{gamma}{sub 5g} transitions, serious discrepancies between experiment and theory are found if the intermediate states are constructed from a 4f{sup 5} core comprising free ion states and the 5d{sup 1} crystal field states. Satisfactory agreement is, however, found when the 4f{sup 5} crystal field states are utilized in constructing the intermediate states. The contributions to the transition moment have been evaluated for various Hamiltonian terms and the results are discussed. (author)

T-odd correlation in the $K_{l3} \\gamma$ decay

CERN Document Server

Braguta, V V; Chalov, A E

2002-01-01

The dependence of the K/sup +/ to pi /sup 0/l/sup +/ nu /sub l/ gamma decay rate on the T-odd kinematical variable xi = q . Ýp/sub l/ * p /sub pi /¿/m/sub K//sup 3/ is investigated in the tree and one-loop approximations of the Standard Model (SM). It is shown that the partial width of the decay on the tree level is an even function of the variable, whereas the odd component is generated by the electromagnetic final-state interaction and determined by the imaginary parts of one-loop diagrams. The xi -odd components of the partial widths of the K/sup +/ to pi /sup 0/e/sup +/ nu /sub e/ gamma and K/sup +/ to pi /sup 0/ mu /sup +/ nu /sub mu / gamma decays calculated in the one-loop approximation are smaller by four orders of magnitude than the even components evaluated from the tree-level SM diagrams. (11 refs).

Prep/Tech: Volume 1, No. 1, Youth on homelessness

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-12-31

PREP/TECH is a skill development, academic enrichment program of U. of Toledo in Toledo OH and The Engineers Foundation of Ohio; it addresses the mathematics, science, language, and intellectual needs of about 100 African-American and Hispanic-American 7th, 8th, and 9th graders in Toledo. This summer, after 3 weeks of classes, the 80 students returned for a second 3 week session and were divided into two groups, one studying the growing problem of homelessness in America. This group researched and published a pamphlet on homelessness. This report is divided into: myths, causes, descriptions, and solutions. Finally, a brief account is given of the homelessness project.

Connecting Teachers and Ed-Tech Developers: Lessons from NYC's "Gap App" Program. Report

Science.gov (United States)

Villavicencio, Adriana; Siman, Nina; Lafayette, Camille; Kang, David

2016-01-01

In 2011, with support from a federal Investing in Innovation grant, the NYC Department of Education launched Innovate NYC Schools. The initiative was designed to address two, related challenges to effectively integrating education technology (ed-tech) into classrooms: First, procurement of ed-tech tools is often hampered by a disconnect between…

Is Education Facing a "Tech Bubble"?

Science.gov (United States)

Davis, Michelle R.

2013-01-01

Educational technology companies and entrepreneurs may face the risk of a "tech bubble," similar to the massive boom-and-bust that rocked the technology market in the late 1990s, according to market analysts and a recently released paper. A relatively new focus on K-12 educational technology as an investment vehicle, a surge of investors looking…

A new model on the use of ubiquitous technology (U-Tech as a learning tool

Directory of Open Access Journals (Sweden)

Muliati Sedek

2014-08-01

Full Text Available Laptops, smartphones and tablets which also known as ubiquitous technology or u-tech have been widely used by students in the university. However, study on the factors influencing it usage as not many comprehensive studies have been done related to it. A review of related literature reveals that factors, namely the Technology Competency (TC, Performance Expectancy (PE, Effort Expectancy (EE, Behavioural Intention (BI, Facilitating Conditions (FC and Social Status (SS influence its usage. Thus, the focus of this study was to confirm whether the determined factors contribute towards u-tech usage among students in the institutions of higher learning, particularly in Malaysia. This study was based on a quantitative research in which the Structural Equation Modelling using AMOS was employed. The results attained from the analysis produced a reliable model towards u-tech usage. Therefore, it can be concluded that, u-tech usage described by the five factors. This study has suggested that the university administration should play an active role in disseminating any news that is related to the usefulness of u-tech.

Analýza sortimentu firmy SkyTech Corporation s.r.o.

OpenAIRE

Dvořáková, Šárka

2017-01-01

This thesis focuses on small company SkyTech Corporation s.r.o, which distributes products from the field of cosmetic, decorative cosmetic, cosmetic accessories and make-up brushes. The first part is theoretical and serves as basis for elaboration of the practical part. Theoretical part focus on marketing mix, competition, assortment and analysis connected with them. In practical part SkyTech Corporaton s.r.o. is introduced. Than follows the evaluation of individual brands and their roles in ...

Beam-Plasma Interaction Experiments on the Princeton Advanced Test Stand

Science.gov (United States)

Stepanov, A.; Gilson, E. P.; Grisham, L.; Kaganovich, I. D.; Davidson, R. C.

2011-10-01

The Princeton Advanced Test Stand (PATS) is a compact experimental facility for studying the fundamental physics of intense beam-plasma interactions relevant to the Neutralized Drift Compression Experiment - II (NDCX-II). The PATS facility consists of a 100 keV ion beam source mounted on a six-foot-long vacuum chamber with numerous ports for diagnostic access. A 100 keV Ar+ beam is launched into a volumetric plasma, which is produced by a ferroelectric plasma source (FEPS). Beam diagnostics upstream and downstream of the FEPS allow for detailed studies of the effects that the plasma has on the beam. This setup is designed for studying the dependence of charge and current neutralization and beam emittance growth on the beam and plasma parameters. This work reports initial measurements of beam quality produced by the extraction electrodes that were recently installed on the PATS device. The transverse beam phase space is measured with double-slit emittance scanners, and the experimental results are compared to WARP simulations of the extraction system. This research is supported by the U.S. Department of Energy.

FuSuMaTech workshop

CERN Multimedia

Olofsson, Simon

2018-01-01

The goal of the FuSuMaTecH IP workshop, organised at CERN Ideaquare 19-20 April, was to educate superconductivity and magnet experts about intellectual property. About 30 participants from multiple institutes and companies worked together in this two day interactive program which was facilitated by CERN Knowledge Transfer. Great progress was made in shaping the FuSuMaTech industrial demonstrator projects as well as the R&D&I subjects.

The phosphorylation state of CD3gamma influences T cell responsiveness and controls T cell receptor cycling

DEFF Research Database (Denmark)

Dietrich, J; Bäckström, T; Lauritsen, J P

1998-01-01

The T cell receptor (TCR) is internalized following activation of protein kinase C (PKC) via a leucine (Leu)-based motif in CD3gamma. Some studies have indicated that the TCR is recycled back to the cell surface following PKC-mediated internalization. The functional state of recycled TCR and the ......The T cell receptor (TCR) is internalized following activation of protein kinase C (PKC) via a leucine (Leu)-based motif in CD3gamma. Some studies have indicated that the TCR is recycled back to the cell surface following PKC-mediated internalization. The functional state of recycled TCR...... the phosphorylation state of CD3gamma and T cell responsiveness. Based on these observations a physiological role of CD3gamma and TCR cycling is proposed....

The phosphorylation state of CD3gamma influences T cell responsiveness and controls T cell receptor cycling

DEFF Research Database (Denmark)

Dietrich, J; Backstrom, T; Lauritsen, JP

1998-01-01

The T cell receptor (TCR) is internalized following activation of protein kinase C (PKC) via a leucine (Leu)-based motif in CD3gamma. Some studies have indicated that the TCR is recycled back to the cell surface following PKC-mediated internalization. The functional state of recycled TCR...... the phosphorylation state of CD3gamma and T cell responsiveness. Based on these observations a physiological role of CD3gamma and TCR cycling is proposed....... and the mechanisms involved in the sorting events following PKC-induced internalization are not known. In this study, we demonstrated that following PKC-induced internalization, the TCR is recycled back to the cell surface in a functional state. TCR recycling was dependent on dephosphorylation of CD3gamma, probably...

Study of the $e^+ e^- \\to Z\\gamma\\gamma \\to q\\overline{q}\\gamma\\gamma$ Process at LEP

CERN Document Server

Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

2001-01-01

The process e^+e^- -> Z gamma gamma -> q q~ gamma gamma$ is studied in 0.5\\,fb-1$ of data collected with the L3 detector at centre-of-mass energies between 130.1 GeV and 201.7 GeV. Cross sections are measured and found to be consistent with the Standard Model expectations. The study of the least energetic photon constrains the quartic gauge boson couplings to -0.008 GeV-2 < a_0/\\Lambda^2 < 0.005 GeV-2 and -0.007 GeV-2 < a_c/\\Lambda^2 < 0.011 GeV-2, at 95% confidence level.

70Z/3 Cbl induces PLC gamma 1 activation in T lymphocytes via an alternate Lat- and Slp-76-independent signaling mechanism.

Science.gov (United States)

Graham, Laurie J; Verí, Maria-Concetta; DeBell, Karen E; Noviello, Cristiana; Rawat, Rashmi; Jen, Sandy; Bonvini, Ezio; Rellahan, Barbara

2003-04-24

The oncoprotein 70Z/3 Cbl signals in an autonomous fashion or through blockade of endogenous c-Cbl, a negative regulator of signaling. The mechanism of 70Z/3 Cbl-induced signaling was investigated by comparing the molecular requirements for 70Z/3 Cbl- and TCR-induced phospholipase C gamma 1 (PLC gamma 1) activation. 70Z/3 Cbl-induced PLC gamma 1 tyrosine phosphorylation required, in addition to the PLC gamma 1 N-terminal SH2 domain, the C-terminal SH2 and SH3 domains that were dispensable for TCR-induced phosphorylation. Deletion of the leucine zipper of 70Z/3 Cbl did not eliminate 70Z/3 Cbl-induced PLC gamma 1 phosphorylation, suggesting that blockage of c-Cbl via dimerization with 70Z/3 Cbl cannot fully explain 70Z/3 Cbl activating characteristics. The complete elimination of PLC gamma 1 phosphorylation required deleting the SH3 domain-binding region of 70Z/3 Cbl, consistent with 70Z/3 Cbl binding the PLC gamma 1 SH3 domain. 70Z/3 Cbl-induced PLC gamma 1 phosphorylation required Zap-70, as for the TCR, and the tyrosine kinase binding domain of 70Z/3 Cbl, which binds Zap-70, but did not require PLC gamma 1 binding to Lat, a crucial interaction in TCR-induced PLC gamma 1 phosphorylation. Furthermore, 70Z/3 Cbl-induced activation of NFAT, a PLC gamma 1/Ca(2+)-dependent transcriptional event, required Zap-70, but was independent of Slp-76, an adapter required for TCR-induced NFAT activation. These results suggest that 70Z/3 Cbl and PLC gamma 1 form a TCR-, Lat- and Slp-76-independent complex that leads to PLC gamma 1 phosphorylation and activation.

Development of source-less efficiency calibration procedure for CeBr3 based gamma spectrometry system

International Nuclear Information System (INIS)

Verma, Amit K.; Narayani, K.; Pant, Amar D.; Bhosale, Nitin; Anilkumar, S.; Palani Selvam, T.

2018-01-01

Scintillation spectrometers are widely used in detection and spectrometry of gamma photons. Sodium Iodide (NaI(Tl)) is the most commonly used scintillation detector for gamma ray spectrometry. However for portable application that require higher efficiency and better resolution Cerium Bromide (CeBr 3 ) crystals are more suitable than NaI(Tl) crystals. CeBr 3 detectors have high light output (∼ 68,000 photons/MeV), good proportionality, fast response and better energy resolution (<4% for 662 keV of 137 Cs), which makes it very promising detector for gamma ray spectrometry. In the present work, experimental and Monte Carlo based efficiencies for CeBr 3 detector for 137 Cs and 60 Co were evaluated

What Is the Tech Prep/Associate Degree Program?

Science.gov (United States)

Parnell, Dale

1993-01-01

Discusses the nature, importance, and future of the Tech Prep/Associate Degree program. Suggests that these programs must move beyond simple articulation and become aggressive in jointly examining, developing, and sustaining high quality educational programs. (JOW)

Crash-Tech 2001. Conference; Crash-Tech 2001. Tagung

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

Improved active and passive safety of motor vehicles has resulted in a very much improved accident statistics. This conference discussed further optimisations in motor car safety. The harmonisation of test specifications world-wide was gone into, with particular interest in compatibility. Safety specifications resulting from current accident research and new legislation were gone into, and the current state of measuring and technology in crash testing was outlined. [German] Aufgrund der Verbesserungen in der aktiven und passiven Sicherheit von Fahrzeugen weisen die Unfallstatistiken in vielen europaeischen Laendern eine erfreuliche Tendenz auf. Die Tagung wird sich mit den Moeglichkeiten der weiteren Optimierung der Verkehrssicherheit befassen. Die 'Crash-Tech 2001' will sich mit dem Motto 'Sind wir auf dem Weg zum World NCAP?' der Harmonisierung der Testvorschriften unter Einbeziehung der Kompatibilitaet widmen. Dazu werden Anforderungen an die Fahrzeugsicherheit diskutiert, die sich sowohl aus der aktuellen Unfallforschung als auch aus den Vorschriften ergeben. Weiterhin wird der aktuelle Stand der Mess- und Versuchstechnik im Unfallversuch vorgestellt. (orig.)

Max Tech and Beyond: Maximizing Appliance and Equipment Efficiency by Design

Energy Technology Data Exchange (ETDEWEB)

Desroches, Louis-Benoit; Garbesi, Karina

2011-07-20

three primary analyses presented in this report are: Nevertheless, it is important to analyze best-on-market products, since data on truly max tech technologies are limited. (1) an analysis of the cross-cutting strategies most promising for reducing appliance and equipment energy use in the U.S.; (2) a macro-analysis of the U.S. energy-saving potential inherent in promising ultra-efficient appliance technologies; and (3) a product-level analysis of the energy-saving potential.

BiI₃ Crystals for High Energy Resolution Gamma-Ray Spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Nino, Juan C. [Univ. of Florida, Gainesville, FL (United States); Baciak, James [Univ. of Florida, Gainesville, FL (United States); Johns, Paul [Univ. of Florida, Gainesville, FL (United States); Sulekar, Soumitra [Univ. of Florida, Gainesville, FL (United States); Totten, James [Univ. of Florida, Gainesville, FL (United States); Nimmagadda, Jyothir [Univ. of Florida, Gainesville, FL (United States)

2017-04-12

BiI₃ had been investigated for its unique properties as a layered compound semiconductor for many decades. However, despite the exceptional atomic, physical, and electronic properties of this material, good resolution gamma ray spectra had never been reported for BiI₃. The shortcomings that previously prevented BiI₃ from reaching success as a gamma ray sensor were, through this project, identified and suppressed to unlock the performance of this promising compound. Included in this work were studies on a number of methods which have, for the first time, enabled BiI₃ to exhibit spectral performance rivaling many other candidate semiconductors for room temperature gamma ray sensors. New approaches to crystal growth were explored that allow BiI₃ spectrometers to be fabricated with up to 2.2% spectral resolution at 662 keV. Fundamental studies on trap states, dopant incorporation, and polarization were performed to enhance performance of this compound. Additionally, advanced detection techniques were applied to display the capabilities of high quality BiI₃ spectrometers. Overall, through this work, BiI₃ has been revealed as a potentially transformative material for nuclear security and radiation detection sciences.

The effects of incubation on academic and non-academic high-tech start-ups: evidence from Italy

OpenAIRE

Colombo, Massimo G.; Piva, Evila; Rentocchini, Francesco

2012-01-01

This study aims at empirically investigating whether technology incubators help academic high-tech start-ups to establish collaborations with other organizations, thus increasing the competitiveness of these firms. In doing so, we take into account the specificities of academic high-tech start-ups with respect to their non-academic counterparts. We compare the effects of incubation on academic and non-academic high-tech start-ups through econometric estimates using a large sample of Italian f...

URBox : High tech energy and informal housing

NARCIS (Netherlands)

Cuperus, Y.J.; Smets, D.

2011-01-01

This paper reports on the URBox concept encompassing the high tech end of solar energy and informal low cost and affordable housing. It aims to contribute to solving the global energy crisis by building solar energy settlements in deserts where land is affordable and sunshine in abundance. First the

Princeton Plasma Physics Laboratory annual report, October 1, 1982-September 30, 1983

Energy Technology Data Exchange (ETDEWEB)

Phillips, C.A. (ed.)

1983-01-01

The Tokamak Fusion Test Reactor (TFTR) achieved first plasma at 3:05 a.m. on December 24, 1982. During the course of the year, the plasma current was raised to a maximum of 1 MA, and extensive confinement studies were carried out with ohmic-heated plasmas. The most important finding was that tokamak energy confinement time increases as the cube of the plasma size. The Princeton Large Torus (PLT) carried out a number of high-powered plasma-heating experiments in the ion cyclotron frequency range, and also demonstrated for the first time that a 100-kA tokamak discharge can be built up by means of rf-waves in the lower hybrid range, without any need for inductive current drive by the conventional tokamak transformer system. The Poloidal Divertor Experiment (PDX) demonstrated that substantial improvements in plasma confinement during intense neutral-beam heating can be obtained by means of either a magnetic divertor or a mechanical scoop limiter. The S-1 spheromak experiment has come into operation, with first plasma in January 1983, and machine completion in August. The soft X-ray laser development experiment continues to make strong progress towards the demonstration of laser amplification. Thus far, a single-pass gain of 3.5 has been achieved, using the 182 A line of CVI. Theoretical MHD-stability studies have shed new light on the nature of the energetic-ion-driven ''fishbone instability,'' and the utilization of the bean-shaping technique to reach higher beta values in the tokamak.

Princeton Plasma Physics Laboratory annual report, October 1, 1982-September 30, 1983

International Nuclear Information System (INIS)

Phillips, C.A.

1983-01-01

The Tokamak Fusion Test Reactor (TFTR) achieved first plasma at 3:05 a.m. on December 24, 1982. During the course of the year, the plasma current was raised to a maximum of 1 MA, and extensive confinement studies were carried out with ohmic-heated plasmas. The most important finding was that tokamak energy confinement time increases as the cube of the plasma size. The Princeton Large Torus (PLT) carried out a number of high-powered plasma-heating experiments in the ion cyclotron frequency range, and also demonstrated for the first time that a 100-kA tokamak discharge can be built up by means of rf-waves in the lower hybrid range, without any need for inductive current drive by the conventional tokamak transformer system. The Poloidal Divertor Experiment (PDX) demonstrated that substantial improvements in plasma confinement during intense neutral-beam heating can be obtained by means of either a magnetic divertor or a mechanical scoop limiter. The S-1 spheromak experiment has come into operation, with first plasma in January 1983, and machine completion in August. The soft X-ray laser development experiment continues to make strong progress towards the demonstration of laser amplification. Thus far, a single-pass gain of 3.5 has been achieved, using the 182 A line of CVI. Theoretical MHD-stability studies have shed new light on the nature of the energetic-ion-driven ''fishbone instability,'' and the utilization of the bean-shaping technique to reach higher beta values in the tokamak

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1997

Energy Technology Data Exchange (ETDEWEB)

Finley, V.L. and Levine, J.D.

1999-01-10

The results of the 1997 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the U.S. Department of Energy and the public with information on the level of radioactive and non-radioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. During Calendar Year 1997, PPPL's Tokamak Fusion Test Reactor (TFTR) completed fifteen years of fusion experiments begun in 1982. Over the course of three and half years of deuterium-tritium (D-T) plasma experiments, PPPL set a world record of 10.7 million watts of controlled fusion power, more than 700 tritium shots pulsed into the reactor vessel generating more than 5.6 x 10²⁰ neutron and 1.6 gigajoules of fusion energy and researchers studied plasma science experimental data, which included "enhanced reverse shear techniques." As TFTR was completing its historic operations, PPPL participated with the Oak Ridge National Laboratory, Columbia University, and the University of Washington (Seattle) in a collaboration effort to design the National Spherical Torus Experiment (NSTX). This next device, NSTX, is located in the former TFTR Hot Cell on D site, and it is designed to be a smaller and more economical torus fusion reactor. Construction of this device began in late 1997, and first plasma in scheduled for early 1999. For 1997, the U.S. Department of Energy in its Laboratory Appraisal report rated the overall performance of Princeton Plasma Physics Laboratory as "excellent." The report cited the Laboratory's consistently excellent scientific and technological achievements and its successful management practices, which included high marks for environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey

Remote handling needs of the Princeton Plasma Physics Laboratory

International Nuclear Information System (INIS)

Smiltnieks, V.

1982-07-01

This report is the result of a Task Force study commissioned by the Canadian Fusion Fuels Technology Project (CFFTP) to investigate the remote handling requirements at the Princeton Plasma Physics Laboratory (PPPL) and identify specific areas where CFFTP could offer a contractual or collaborative participation, drawing on the Canadian industrial expertise in remote handling technology. The Task Force reviewed four areas related to remote handling requirements; the TFTR facility as a whole, the service equipment required for remote maintenance, the more complex in-vessel components, and the tritium systems. Remote maintenance requirements both inside the vacuum vessel and around the periphery of the machine were identified as the principal areas where Canadian resources could effectively provide an input, initially in requirement definition, concept evaluation and feasibility design, and subsequently in detailed design and manufacture. Support requirements were identified in such areas as the mock-up facility and a variety of planning studies relating to reliability, availability, and staff training. Specific tasks are described which provide an important data base to the facility's remote handling requirements. Canadian involvement in the areas is suggested where expertise exists and support for the remote handling work is warranted. Reliability, maintenance operations, inspection strategy and decommissioning are suggested for study. Several specific components are singled out as needing development

Connecting Teachers and Ed-Tech Developers: Lessons from NYC's "Gap App" Program. Technical Appendices

Science.gov (United States)

Villavicencio, Adriana; Siman, Nina; Lafayette, Camille; Kang, David

2016-01-01

In 2011, with support from a federal Investing in Innovation grant, the NYC Department of Education launched Innovate NYC Schools. The initiative was designed to address two, related challenges to effectively integrating education technology (ed-tech) into classrooms: First, procurement of ed-tech tools is often hampered by a disconnect between…

High-tech and climate change : promoting the application of enabling and high-tech solutions to reduce GHG emissions : final report

International Nuclear Information System (INIS)

2003-03-01

This report identifies the greenhouse gas (GHG) reducing potential of the high-tech sector with particular reference to the following 5 key technology convergence groups: biotechnology and bio-products; intelligent systems; information and communications technology; advanced materials; and, nanotechnology. It was noted that Canada's efforts to reduce GHG emissions in the abatement of climate change can drive innovation, stimulate economic growth and attain international leadership in technology solutions. Although Canada's strong economic growth has resulted in the creation of more highly skilled jobs, expansion in innovation and new infrastructure, there is a challenge of preserving the environmental and social quality within communities, and ensuring that productivity within companies does not lapse. In response, the government is shaping policy responses that drive innovation, productivity and prosperity and which help Canadian companies capitalize on emerging global opportunities while minimizing environmental and social impacts. This report includes information on climate change and the Kyoto Protocol, Canada's Climate Change Action Plan and the emerging carbon marketplace. It also describes the role of technology innovation and the opportunity of convergence in spurring innovation. Several actions have been proposed to Industry Canada by different technology sectors to help climate change providers generate innovative solutions, commercialize products and expand market presence. This report includes those initiatives which further promote the convergence, growth and development of different enabling and high-tech sectors to develop climate change solutions; promote the opportunities that are emerging to apply innovative high-tech and enabling technologies to reduce GHG emissions; and help Canada meet its Kyoto commitments. 50 refs., 1 tab., 2 figs

Electron paramagnetic resonance of gamma irradiated (CH3)3NHClO4 and CH3NH3ClO4 single crystals

International Nuclear Information System (INIS)

Yavuz, Metin; Koeksal, Fevzi

1999-01-01

Gamma irradiation damage centers in (CH 3 ) 3 NHClO 4 and CH 3 NH 3 ClO 4 single crystals have been investigated at room temperature by the electron paramagnetic resonance (EPR) technique. It has been found that γ-irradiation produces the (CH 3 ) 3 N + radical in the first, and NH + 3 and ClO 3 radicals in the second compound. The EPR parameters of the observed radicals have been determined and discussed

Global Business Networks and Cooperation within Supply Chain as a Strategy of High-Tech Companies’ Growth

Directory of Open Access Journals (Sweden)

Milena Ratajczak-Mrozek

2012-01-01

Full Text Available Abstract The specificity of the operation profile of high-tech companies, including the necessity of operating at the international scale may account for the fact that these companies may find in network relationships, business networks and cooperation an essential determinant for growth and competitiveness. Foreign entities should be especially interesting business partners for high- tech companies, as they are often seen as representing more advanced knowledge, resources and experience. The aim of the article is to point out to global business networks (i.e. including both local and foreign entities, and especially to cooperation within supply chain, as an important basis for a growth strategy of a high-tech company. The article adopts assumptions of the network approach as a concept of companies cooperation. An analysis of the author’s own as well as secondary empirical research, with the focus on high- tech companies located in Poland is presented. In particular, the data from own research of 62 high-tech companies in Poland conducted in the first half of 2011 is analysed. It shows that the high-tech companies placing great importance on cooperation within supply chain demonstrate a higher growth and level of competitiveness than the companies which do not ascribe such importance (bearing in mind that supply chain forms an important part of a business network.

Drei neue gamma-Doradus-Sterne aus der ASAS-3 Datenbank

Science.gov (United States)

Bernhard, Klaus; Huemmerich, Stefan

2016-02-01

By analysis of data from the ASAS-3 archive, the stars HD 18011, NSV 16873 and NSV 3272 were identified as multiperiodic gamma Doradus variables. Essential information on these variables is presented, along with unwhitened frequency spectra and statistically significant frequencies, as derived with Period 04.

Raising Generation Tech Preparing Your Children for a Media-Fueled World

CERN Document Server

Taylor, Jim

2012-01-01

Today's children are being raised as 'digital natives' in a world dominated by popular culture and technology. TV shows, computers, video games, social networking sites, advertisements, and cell phones too often have an unnecessarily strong-and negative? influence on children.  But pulling the plug just isn't an option in a world where being connected is essential for success. In Raising Generation Tech,  noted parenting and new-media expert Dr. Jim Taylor explores how popular culture and technology shape children's lives. The essential message from Raising Generation Tech is that excessive

Cross-Section of Hadron Production in $\\gamma\\gamma$ Collisions at LEP

CERN Document Server

Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F

1997-01-01

The reaction $\\mathrm{e}^{+} \\mathrm{e}^{-} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} \\gamma ^{*} \\gamma ^{*} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} $ {\\sl hadrons} is analysed using data collected by the L3 detector during the LEP runs at $\\sqrt {s}$ = 130-140 GeV and $\\sqrt {s}$ = 161 GeV. The cross sections $\\sigma(\\mathrm{e}^{+} \\mathrm{e}^{-} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} $ {\\sl hadrons}) and $\\sigma (\\gamma\\gamma \\rightarrow $ {\\sl hadrons}) are measured in the interval 5 $\\leq W_{\\gamma\\gamma} \\leq$ 75 GeV. The energy dependence of the $\\sigma (\\gamma\\gamma \\rightarrow $ {\\sl hadrons}) cross section is consistent with the universal Regge behaviour of total hadronic cross sections. %\\end{abstract}

High Touch in a High-Tech World

Science.gov (United States)

Gibson, Cindy L.

2009-01-01

In a world of high tech and low touch, it is easy for public relations programs to stray from tried-and-true interpersonal strategies long associated with solid communication planning. New technologies allow communications professionals to quickly send e-mails and telephone calls to selected groups. Social media sites provide users immediate…

Patient Autonomy in a High-Tech Care Context - A Theoretical Framework.

Science.gov (United States)

Lindberg, Catharina; Fagerström, Cecilia; Willman, Ania

2018-06-12

To synthesise and interpret previous findings with the aim of developing a theoretical framework for patient autonomy in a high-tech care context. Putting the somewhat abstract concept of patient autonomy into practice can prove difficult since when it is highlighted in healthcare literature the patient perspective is often invisible. Autonomy presumes that a person has experience, education, self-discipline and decision-making capacity. Reference to autonomy in relation to patients in high-tech care environments could therefore be considered paradoxical, as in most cases these persons are vulnerable, with impaired physical and/or metacognitive capacity, thus making extended knowledge of patient autonomy for these persons even more important. Theory development. The basic approaches in theory development by Walker and Avant were used to create a theoretical framework through an amalgamation of the results from three qualitative studies conducted previously by the same research group. A theoretical framework - the control-partnership-transition framework - was delineated disclosing different parts co-creating the prerequisites for patient autonomy in high-tech care environments. Assumptions and propositional statements that guide theory development were also outlined, as were guiding principles for use in day-to-day nursing care. Four strategies used by patients were revealed: the strategy of control, the strategy of partnership, the strategy of trust, and the strategy of transition. An extended knowledge base, founded on theoretical reasoning about patient autonomy, could facilitate nursing care that would allow people to remain/become autonomous in the role of patient in high-tech care environments. The control-partnership-transition framework would be of help in supporting and defending patient autonomy when caring for individual patients, as it provides an understanding of the strategies employed by patients to achieve autonomy in high-tech care contexts. The

Sieciowe usługi informacyjne dla nauk technicznych : BazTech, BazTOL

OpenAIRE

Derfert-Wolf, Lidia

2007-01-01

The paper presents the current state and plans for development of the BazTech "Polish Technical Journals Contents" database. It is created by 22 academic libraries and centers for scientific information. The project is coordinated by the Cracow University of Technology. The Baz Tech database, situated at http://baztech.icm.edu.pl (ICM UW server), within the framework of the project "Virtual Scientific Library" lists over 400 journals. The paper also describes the assumptions for the creation ...

Pricing and inventory policies for Hi-tech products under replacement warranty

Science.gov (United States)

Tsao, Yu-Chung; Teng, Wei-Guang; Chen, Ruey-Shii; Chou, Wang-Ying

2014-06-01

Companies, especially in the Hi-tech (high-technology) industry (such as computer, communication and consumer electronic products), often provide a replacement warranty period for purchased items. In reality, simultaneously determining the price and inventory decisions under warranty policy is an important issue. The objective of this paper is to develop a joint pricing and inventory model for Hi-tech products under replacement warranty policy. In the first model, we consider a Hi-tech product feature in which the selling price is declining in a trend. We determine the optimal inventory level for each period and retail price for the first period while maximising the total profit. In the second model, we further determine the optimal retail price and inventory level for each period in the dynamic demand market. This study develops solution approaches to solve the problems described above. Numerical analysis discusses the influence of system parameters on the company's decisions and behaviours. The results of this study could serve as a reference for business managers or administrators.

Virginia Tech's Cook Counseling Center receives international counseling accreditation

OpenAIRE

DeLauder, Rachel

2010-01-01

The Virginia Tech Thomas E. Cook Counseling Center has been accredited by the International Association of Counseling Services, Inc., an organization of United States, Canadian, and Australian counseling agencies based in Alexandria, Va.

FinTech Market Development Perspectives

OpenAIRE

Kalmykova, Ekaterina Yurievna; Ryabova, Anna

2016-01-01

Fast development of technologies has led to emergence of the new market – FinTech – which is very attractive for investors today. By now this market has a great number of different concepts: P2P-crediting, E-wallets, Bitcoins, mPOS-acquiring, T-commerce, mobile banks, etc. Many of these tools have already heavily entered our ordinary life. People can obtain any credits through special services on the Internet from other users without participation of banks, pay by credit card using mobile dev...

International banker to speak at Virginia Tech

OpenAIRE

Ho, Sookhan

2004-01-01

International banker David Bieri will give a talk, "Why Central Banks Manage Reserves," on Monday, April 5, 11 a.m. in 1045 Pamplin Hall on the Virginia Tech campus. His talk is part of the "International Business and Culture" guest lecture series sponsored by the Pamplin College of Business. The talk is free and open to the public.

gamma-ray emission probabilities of sup 1 sup 9 sup 3 Os

CERN Document Server

Marnada, N; Ueda, N; Ikeda, K; Hayashi, N

2002-01-01

Precise measurements of disintegration rates by using a 4 pi beta-gamma coincidence apparatus have resulted in improved certainties of the principal gamma-ray emission probabilities of sup 1 sup 9 sup 3 Os. Most of the uncertainties are less than 1%, whereas the uncertainties of emission probabilities evaluated in the Nuclear Data Sheets (83 (1998) 921) are more than 6%. The precision is improved for the beta-ray branching ratio for direct transition to the ground state and the value is larger than the evaluated value by about 6%.

Practice of radiation dose control for tech-modification items in Qinshan Nuclear Power Plant

International Nuclear Information System (INIS)

Zhang Yong; Chen Zhongyu; Xu Hongming; Fan Liguang; Jiang Jianqi; Bu Weidong

2006-01-01

In order to improve the safety and reliability of nuclear power plant operation, many tech-modifications related to system or equipment have been completed since operation in Qinshan NPP. this paper introduces radiation dose control for mainly tech-modifications items related to radiation, including radiation protection optimization measures and experience in aspects of item planning, program writing, process control, etc. (authors)

Virginia Tech dining keeps customer service fresh (with Relish!)

OpenAIRE

Chadwick, Heather Riley

2005-01-01

Virginia Tech is consistently ranked among the top universities in providing its students with the very best in dining options. One important way they make that happen is keeping in touch with student preferences and needs.

BiI{sub 3} single crystal for room-temperature gamma ray detectors

Energy Technology Data Exchange (ETDEWEB)

Saito, T., E-mail: saito.tatsuya125@canon.co.jp [Frontier Research Center, Canon Inc., 3-30-2, Shimomaruko, Ohta-ku, Tokyo 146-8501 (Japan); Iwasaki, T. [Frontier Research Center, Canon Inc., 3-30-2, Shimomaruko, Ohta-ku, Tokyo 146-8501 (Japan); Kurosawa, S.; Yoshikawa, A. [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); New Industry Creation Hatchery Center (NICHe), Tohoku University, 6-6-10 Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Den, T. [Frontier Research Center, Canon Inc., 3-30-2, Shimomaruko, Ohta-ku, Tokyo 146-8501 (Japan)

2016-01-11

BiI{sub 3} single crystals were grown by the physical vapor transport method. The repeated sublimation of the starting material reduced impurities in the BiI{sub 3} single crystal to sub-ppm levels. The detector was fabricated by depositing Au electrodes on both surfaces of the 100-μm-thick BiI{sub 3} single crystal platelet. The resistivity of the BiI{sub 3} single crystal was increased by post-annealing in an iodine atmosphere (ρ=1.6×10{sup 11} Ω cm). Pulse height spectroscopy measurements showed clear peaks in the energy spectrum of alpha particles or gamma rays. It was estimated that the mobility-lifetime product was μ{sub e}τ{sub e}=3.4–8.5×10{sup −6} cm{sup 2}/V and the electron–hole pair creation energy was 5.8 eV. Our results show that BiI{sub 3} single crystals are promising candidates for detectors used in radiographic imaging or gamma ray spectroscopy.

Hydrodeoxygenation of methyl esters on sulphided NiMo/{gamma}-Al{sub 2}O{sub 3} and CoMo/{gamma}-Al{sub 2}O{sub 3} catalysts

Energy Technology Data Exchange (ETDEWEB)

Senol, O.I; Viljava, T.R.; Krause, A.O.I. [Laboratory of Industrial Chemistry, Helsinki University of Technology, P.O. Box 6100, FIN-02015 Hut (Finland)

2005-02-28

Wood-derived bio-oil contains high amounts of compounds with different oxygen-containing functional groups that must be removed to improve the fuel characteristics. Elimination of oxygen from carboxylic groups was studied with model compounds, methyl heptanoate and methyl hexanoate, on sulphided NiMo/{gamma}-Al{sub 2}O{sub 3} and CoMo/{gamma}-Al{sub 2}O{sub 3} catalysts in a flow reactor. Catalyst performances and reaction schemes were addressed. Aliphatic methyl esters produced hydrocarbons via three main paths: The first path gave alcohols followed by dehydration to hydrocarbons. Deesterification yielded an alcohol and a carboxylic acid in the second path. Carboxylic acid was further converted to hydrocarbons either directly or with an alcohol intermediate. Decarboxylation of the esters led to hydrocarbons in the third path. No oxygen-containing compounds were detected at complete conversions. However, the product distributions changed with time, even at complete conversions, indicating that both catalysts deactivated under the studied conditions.

Frequency of gamma-ray bursts greater than 3 x 10 to the -6th erg/sq cm

International Nuclear Information System (INIS)

Share, G.H.; Wood, K.; Meekins, J.; Yantis, D.J.

1982-01-01

Results are presented for gamma-ray burst observations with the Large Area Sky Survey instrument on HEAD-1. It is noted that during the time HEAD-1 was operational, the instrument detected at least 12 confirmed gamma-ray bursts with intensities greater than 3 microerg/sq cm and identified six additional unconfirmed bursts. The rates of gamma-ray bursts are estimated to be about 125 per yr for intensities greater than 3 microserg/sq cm and approximately 50 per yr for intensities preater than 10 microerg/yr. The data are shown to yield a log N - log S relation for gamma-ray bursts that is consistent with a spherical distrubution of sources within the Galaxy and having a broad range of intrinsic luminosities

Gamma-ray shielding effect of Gd3+ doped lead barium borate glasses

Science.gov (United States)

Kummathi, Harshitha; Naveen Kumar, P.; Vedavathi T., C.; Abhiram, J.; Rajaramakrishna, R.

2018-05-01

The glasses of the batch xPbO: 10BaO: (90-x)B2O3: 0.2Gd2O3 (x = 40,45,50 mol %) were prepared by melt-quench technique. The work emphasizes on gamma ray shielding effect on doped lead glasses. The role of Boron is significant as it acts as better neutron attenuator as compared with any other materials, as the thermal neutron cross-sections are high for Gadolinium, 0.2 mol% is chosen as the optimum concentration for this matrix, as higher the concentration may lead to further increase as it produces secondary γ rays due to inelastic neutron scattering. Shielding effects were studied using Sodium Iodide (NaI) - Scintillation Gamma ray spectrometer. It was found that at higher concentration of lead oxide (PbO) in the matrix, higher the attenuation which can be co-related with density. Infra-red (I.R.) spectra reveals that the conversion of Lose triangles to tight tetrahedral structure results in enhancement of shielding properties. The Differential Scanning Calorimeter (D.S.C.) study also reveals that the increase in glass forming range increases the stability which in-turn results in inter-conversion of BO3 to BO4 units such that the density of glass increases with increase in PbO content, resulting in much stable and efficient gamma ray shielding glasses.

Online Classes See Cheating Go High-Tech

Science.gov (United States)

Young, Jeffrey R.

2012-01-01

Easy A's may be even easier to score these days, with the growing popularity of online courses. Tech-savvy students are finding ways to cheat that let them ace online courses with minimal effort, in ways that are difficult to detect. The issue of online cheating may rise in prominence, as more and more institutions embrace online courses, and as…

Shaking Up Biotech/Pharma: Can Cues Be Taken from the Tech Industry?

Science.gov (United States)

Wang, C Katherine

2017-06-01

The biotech and pharma (biotech/pharma) industry is in dire need of finding ways to increase efficacy, efficiency, and affordability of its products. The information and technology industry ("tech") industry, which is an industry similarly founded on inventions and innovation, may provide some food for thought. This perspective will demonstrate the shift that biotech/pharma is already making and will propose that the industry has an opportunity to compel change by adopting some aspects of the tech industry with regards to models for technology/product development and leadership attributes.

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 2000

Energy Technology Data Exchange (ETDEWEB)

Virginia L. Finley

2002-04-22

The results of the 2000 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the U.S. Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants (if any) that are added to the environment as a result of PPPL's operations. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 2000. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 1951. The long-range goal of the U.S. Magnetic Fusion Energy Research Program is to create innovations to make fusion power a practical reality -- an alternative energy source. The year 2000 marked the second year of National Spherical Torus Experiment (NSTX) operations and Tokamak Fusion Test Reactor (TFTR) dismantlement and deconstruction activities. A collaboration among fourteen national laboratories, universities, and research institutions, the NSTX is a major element in the U.S. Fusion Energy Sciences Program. It has been designed to test the physics principles of spherical torus (ST) plasmas. The ST concept could play an important role in the development of smaller, more economical fusion power plants. With its completion within budget and ahead of its target schedule, NSTX first plasma occurred on February 12, 1999. In 2000, PPPL's radiological environmental monitoring program measured tritium in the air at on-site and off-site sampling stations. PPPL is capable of detecting small changes in the ambient levels of tritium by using highly sensitive monitors. The operation of an in-stack monitor located on D-site is a requirement of the National Emission Standard for Hazardous Air Pollutants (NESHAPs) regulations with limits set by the Environmental Protection Agency (EPA). Also included in PPPL's radiological environmental monitoring program, are precipitation, surface

Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 2000

International Nuclear Information System (INIS)

Virginia L. Finley

2002-04-01

The results of the 2000 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the U.S. Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants (if any) that are added to the environment as a result of PPPL's operations. The report also summarizes environmental initiatives, assessments, and programs that were undertaken in 2000. The Princeton Plasma Physics Laboratory has engaged in fusion energy research since 1951. The long-range goal of the U.S. Magnetic Fusion Energy Research Program is to create innovations to make fusion power a practical reality -- an alternative energy source. The year 2000 marked the second year of National Spherical Torus Experiment (NSTX) operations and Tokamak Fusion Test Reactor (TFTR) dismantlement and deconstruction activities. A collaboration among fourteen national laboratories, universities, and research institutions, the NSTX is a major element in the U.S. Fusion Energy Sciences Program. It has been designed to test the physics principles of spherical torus (ST) plasmas. The ST concept could play an important role in the development of smaller, more economical fusion power plants. With its completion within budget and ahead of its target schedule, NSTX first plasma occurred on February 12, 1999. In 2000, PPPL's radiological environmental monitoring program measured tritium in the air at on-site and off-site sampling stations. PPPL is capable of detecting small changes in the ambient levels of tritium by using highly sensitive monitors. The operation of an in-stack monitor located on D-site is a requirement of the National Emission Standard for Hazardous Air Pollutants (NESHAPs) regulations with limits set by the Environmental Protection Agency (EPA). Also included in PPPL's radiological environmental monitoring program, are precipitation, surface, ground, a nd

Autoradiographic localization of binding sites for (/sup 3/H). gamma. -aminobutyrate, (/sup 3/H) muscimol, (+) (/sup 3/H) bicuculline methiodide and (/sup 3/H) flunitrazepam in cultures of rat cerebellum and spinal cord

Energy Technology Data Exchange (ETDEWEB)

Hoesli, E; Hoesli, L [Basel Univ. (Switzerland); Moehler, H; Richards, J G [Hoffmann-La Roche (F.) and Co., Basel (Switzerland)

1980-01-01

Cultures of rat cerebellum and spinal cord were used to visualize sites for (/sup 3/H)..gamma..-aminobutyrate, (/sup 3/H)muscimol, (/sup 3/H)bicuculline methiodide and (/sup 3/H) flunitrazepam by autoradiography. In cerebellar cultures, many large neurons (presumably Purkinje cells) and interneurons were labelled. In spinal cord cultures, these compounds were mainly bound to small and medium-sized neurons, whereas the majority of large neurons were unlabelled. No binding sites for these radioligands were found on glial cells. Binding of (/sup 3/H)..gamma..-aminobutyrate, (/sup 3/H)muscimol and (/sup 3/H)bicuculline methiodide was markedly reduced or inhibited by adding unlabelled ..gamma..-aminobutyrate, muscimol and bicuculline (10/sup -3/M) respectively to the incubation medium. Addition of a thienobenzazepine markedly reduced binding with (/sup 3/H)flunitrazepam. It is concluded that tissues cultures are an excellent tool to visualize the cellular localization of binding sites for neurotransmitters and drugs using autoradiography.

Crystal growth and thermoluminescence response of NaZr{sub 2}(PO{sub 4}){sub 3} at high gamma radiation doses

Energy Technology Data Exchange (ETDEWEB)

Ordóñez-Regil, E., E-mail: eduardo.ordonez@inin.gob.mx [Depto. de Química, Gerencia de Ciencias Básicas, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico); Contreras-Ramírez, A., E-mail: aida.contreras@inin.gob.mx [Depto. de Química, Gerencia de Ciencias Básicas, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico); Depto. de Tecnología de Materiales, Gerencia de Ciencias Aplicadas, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico); Facultad de Ciencias, Universidad Autónoma del Estado de México, Unidad Académica el Cerrillo, Piedras Blancas, AP 2-139, CP 50000 Toluca Estado de México (Mexico); Fernández-Valverde, S.M., E-mail: suilma.fernandez@inin.gob.mx [Depto. de Química, Gerencia de Ciencias Básicas, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico); González-Martínez, P.R., E-mail: pedro.gonzalez@inin.gob.mx [Depto. de Física, Gerencia de Ciencias Básicas, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico); Carrasco-Ábrego, H., E-mail: hector.carrasco@inin.gob.mx [Depto. Aceleradores, Gerencia de Ciencias Ambientales, Instituto Nacional de Investigaciones Nucleares, AP 18-1027, CP 11801 México D.F. (Mexico)

2013-11-15

Graphical abstract: -- Highlights: •NaZr{sub 2}(PO{sub 4}){sub 3} exposed to gamma doses of 10, 30 and 50 MGy. •Gamma radiation produced growth of the crystal size of the NZP. •Morphology changes were reversible by heating. •Linear relationship between the thermoluminescence and the applied gamma dose. •This property could be useful for high-level gamma dosimetry. -- Abstract: This work describes the synthesis and characterization of NaZr{sub 2}(PO{sub 4}){sub 3}. The stability of this material under high doses of gamma radiation was investigated in the range of 10–50 MGy. Samples of unaltered and gamma irradiated NaZr{sub 2}(PO{sub 4}){sub 3} were characterized by X-ray diffraction, infrared spectroscopy, scanning electron microscopy, energy dispersive X-ray spectroscopy, and thermoluminescence. The results showed that while functional groups were not affected by the gamma irradiation, morphology changes were observed with increasing doses of gamma irradiation. The morphology of the non-irradiated compound is agglomerated flakes; however, irradiation at 10 MGy splits the flakes inducing the formation of well-defined cubes. Gamma irradiation induced the crystal size of the NaZr{sub 2}(PO{sub 4}){sub 3} to grow. The heat treatment (973 K) of samples irradiated at 50 MGy resulted in the recovery of the original morphology. Furthermore, the thermoluminescence analysis of the irradiated compound is reported.

A novel time dependent gamma evaluation function for dynamic 2D and 3D dose distributions

International Nuclear Information System (INIS)

Podesta, Mark; Persoon, Lucas CGG; Verhaegen, Frank

2014-01-01

Modern external beam radiotherapy requires detailed verification and quality assurance so that confidence can be placed on both the delivery of a single treatment fraction and on the consistency of delivery throughout the treatment course. To verify dose distributions, a comparison between prediction and measurement must be made. Comparisons between two dose distributions are commonly performed using a Gamma evaluation which is a calculation of two quantities on a pixel by pixel basis; the dose difference, and the distance to agreement. By providing acceptance criteria (e.g. 3%, 3 mm), the function will find the most appropriate match within its two degrees of freedom. For complex dynamic treatments such as IMRT or VMAT it is important to verify the dose delivery in a time dependent manner and so a gamma evaluation that includes a degree of freedom in the time domain via a third parameter, time to agreement, is presented here. A C++ (mex) based gamma function was created that could be run on either CPU and GPU computing platforms that would allow a degree of freedom in the time domain. Simple test cases were created in both 2D and 3D comprising of simple geometrical shapes with well-defined boundaries varying over time. Changes of varying magnitude in either space or time were introduced and repeated gamma analyses were performed varying the criteria. A clinical VMAT case was also included, artificial air bubbles of varying size were introduced to a patient geometry, along with shifts of varying magnitude in treatment time. For all test cases where errors in distance, dose or time were introduced, the time dependent gamma evaluation could accurately highlight the errors. The time dependent gamma function presented here allows time to be included as a degree of freedom in gamma evaluations. The function allows for 2D and 3D data sets which are varying over time to be compared using appropriate criteria without penalising minor offsets of subsequent radiation

Management of logistics chains of industrial enterprises in high-tech industries

Directory of Open Access Journals (Sweden)

Demchenko Alexander

2017-01-01

Full Text Available The article analyses the trends of high-tech industries development in the market globalization conditions. The economic growth of high-tech industries largely depends on technological innovations, products and equipment based on usage of the results of applied and fundamental scientific researches. It is shown that characteristics of high-tech productions influence the logistics chain structure. It justifies the importance to include partnering enterprises taking part in creation of intellectual and tangible assets in the logistic chain of the industrial enterprise. It is noted that development of production technologies contributes to formation of innovative logistic chains, which participants are enterprises cooperating for achievement of competitive power. The article offers a model of an industry logistic chain comprising the conventional logistic chain and innovative logistic chains corresponding to the industry market segments. It is proposed to use the customer value of the manufactured products as a criterion of the industrial enterprise’s logistic chains management efficiency. Implementation of the offered model of cooperation between the logistic chain participants is aimed at creation of a continuous innovations flow, reduction of technological development costs and uniting of the participants’ experience.

Challenges to achievement of metal sustainability in our high-tech society.

Science.gov (United States)

Izatt, Reed M; Izatt, Steven R; Bruening, Ronald L; Izatt, Neil E; Moyer, Bruce A

2014-04-21

Achievement of sustainability in metal life cycles from mining of virgin ore to consumer and industrial devices to end-of-life products requires greatly increased recycling rates and improved processing of metals using conventional and green chemistry technologies. Electronic and other high-tech products containing precious, toxic, and specialty metals usually have short lifetimes and low recycling rates. Products containing these metals generally are incinerated, discarded as waste in landfills, or dismantled in informal recycling using crude and environmentally irresponsible procedures. Low recycling rates of metals coupled with increasing demand for high-tech products containing them necessitate increased mining with attendant environmental, health, energy, water, and carbon-footprint consequences. In this tutorial review, challenges to achieving metal sustainability, including projected use of urban mining, in present high-tech society are presented; health, environmental, and economic incentives for various government, industry, and public stakeholders to improve metal sustainability are discussed; a case for technical improvements, including use of molecular recognition, in selective metal separation technology, especially for metal recovery from dilute feed stocks is given; and global consequences of continuing on the present path are examined.

Improved neutron-gamma discrimination for a 3He neutron detector using subspace learning methods

Science.gov (United States)

Wang, C. L.; Funk, L. L.; Riedel, R. A.; Berry, K. D.

2017-05-01

3He gas based neutron Linear-Position-Sensitive Detectors (LPSDs) have been used for many neutron scattering instruments. Traditional Pulse-height Analysis (PHA) for Neutron-Gamma Discrimination (NGD) resulted in the neutron-gamma efficiency ratio (NGD ratio) on the order of 105-106. The NGD ratios of 3He detectors need to be improved for even better scientific results from neutron scattering. Digital Signal Processing (DSP) analyses of waveforms were proposed for obtaining better NGD ratios, based on features extracted from rise-time, pulse amplitude, charge integration, a simplified Wiener filter, and the cross-correlation between individual and template waveforms of neutron and gamma events. Fisher Linear Discriminant Analysis (FLDA) and three Multivariate Analyses (MVAs) of the features were performed. The NGD ratios are improved by about 102-103 times compared with the traditional PHA method. Our results indicate the NGD capabilities of 3He tube detectors can be significantly improved with subspace-learning based methods, which may result in a reduced data-collection time and better data quality for further data reduction.

The high intensity {gamma}-ray source (HI{gamma}S) and recent results

Energy Technology Data Exchange (ETDEWEB)

Tonchev, A.P. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States)]. E-mail: tonchev@tunl.duke.edu; Boswell, M. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Howell, C.R. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Karwowski, H.J. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Kelley, J.H. [North Carolina State University and TUNL, Raleigh, NC 27695 (United States); Tornow, W. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Wu, Y.K. [Duke University and Duke Free Electron Laser Laboratory, Durham, NC 27708-0319 (United States)

2005-12-15

The high intensity {gamma}-ray source (HI{gamma}S) utilizes intra-cavity backscattering of free electron laser photons from the Duke electron storage ring to produce a unique monoenergetic beam of high-flux {gamma}-rays with high polarization and selectable energy resolution. At present, {gamma}-ray beams with energies from 2 to 58 MeV are available with intensities as high as 10{sup 5}-5 x 10{sup 6} {gamma}/s, energy spreads of 3% or better, and nearly 100% linear polarization. The quality and intensity of the {gamma}-ray beams at HI{gamma}S are responsible for the unprecedented performance of this facility in a broad range of research programs in nuclear structure, nuclear astrophysics and nuclear applications. Recent results from excitation of isomeric states in ({gamma}, n) reactions and parity assignments of dipole states determined via the ({gamma}, {gamma}') reaction are presented.

GT-SUPREEM: the Georgia Tech summer undergraduate packaging research and engineering experience for minorities

Science.gov (United States)

May, Gary S.

1996-07-01

The Georgia Tech SUmmer Undergraduate Packaging Research and Engineering Experience for Minorities (GT-SUPREEM) is an eight-week summer program designed to attract qualified minority students to pursue graduate degrees in packaging- related disciplines. The program is conducted under the auspices of the Georgia Tech Engineering Research Center in Low-Cost Electronic Packaging, which is sponsored by the National Science Foundation. In this program, nine junior and senior level undergraduate students are selected on a nationwide basis and paired with a faculty advisor to undertake research projects in the Packaging Research CEnter. The students are housed on campus and provided with a $DLR3,000 stipend and a travel allowance. At the conclusion of the program, the students present both oral and written project summaries. It is anticipated that this experience will motivate these students to become applicants for graduate study in ensuring years. This paper will provide an overview of the GT-SUPREEM program, including student research activities, success stories, lessons learned, and overall program outlook.

Is China only assembling parts and components?: the recent spurt in high tech industry

Directory of Open Access Journals (Sweden)

Marcelo José Braga Nonnenberg

2012-08-01

Full Text Available The purpose of this paper is to evaluate to which degree China is climbing up the technology ladder and increasing its domestic content in high tech industry. More specifically, we will assess whether China has increased its share in world trade of high tech goods and, at the same time, increased its domestic content, changing its role from a mere final assembler to a producer of more intense technology goods. We have built an indicator of domestic value added calculated as the difference between exports of final goods and imports of its parts and components. The main conclusion is that this measure has increased significantly since the early 1990ís, putting in evidence the profound changes that occurred in Chinaís high tech exports in the last two decades.

76 FR 68243 - Youth Leadership Program: TechGirls

Science.gov (United States)

2011-11-03

..., job shadowing, mini-internships, and/or site visits to high tech companies in the United States... Exempt From Income Tax,'' must include a copy of relevant portions of this form. (2) Those who do not... participants or partners and be able to respond to key evaluation questions, including satisfaction with the...

The CD3 gamma leucine-based receptor-sorting motif is required for efficient ligand-mediated TCR down-regulation

DEFF Research Database (Denmark)

von Essen, Marina; Menné, Charlotte; Nielsen, Bodil L

2002-01-01

. The other pathway is dependent on protein kinase C (PKC)-mediated activation of the CD3 gamma di-leucine-based receptor-sorting motif. Previous studies have failed to demonstrate a connection between ligand- and PKC-induced TCR down-regulation. Thus, although an apparent paradox, the dogma has been...... that ligand- and PKC-induced TCR down-regulations are not interrelated. By analyses of a newly developed CD3 gamma-negative T cell variant, freshly isolated and PHA-activated PBMC, and a mouse T cell line, we challenged this dogma and demonstrate in this work that PKC activation and the CD3 gamma di...

Interdisciplinarity in Tech Startups Development – Case Study of ‘Unistartapp’ Project

Directory of Open Access Journals (Sweden)

Kopera Sebastian

2018-03-01

Full Text Available Empirical data as well as scientific reports confirm that startups require diverse, in-house competencies in order to achieve market success. However, while technology-related competencies are usually brought to new tech ventures by their founders, there is a significant deficiency of market- and management-related competencies, which is reflected in the statistics of common startup failure reasons. In this context, a question arises: how interdisciplinarity of knowledge and competencies can be built into the very core of tech startups? The text addresses this question by zeroing in on the role of universities in this process. In the first part, the specificity of tech startups is analyzed. The next chapter overviews the hitherto academy-related startup education environment together with its shortcomings as far as interdisciplinarity is concerned. Finally, the case study of innovative and interdisciplinary academic ecosystem, which was built and tested within the project UniStartApp, is presented and discussed together with related lessons learned. The text is concluded with final remarks on challenges involved in embedding interdisciplinarity into startup education ecosystem.

Acoustic phonons in the hexagonal perovskite CsNiCl3 around the Gamma-point

DEFF Research Database (Denmark)

Visser, D.; Monteith, A.R.; Rønnow, H.M.

2000-01-01

The acoustic phonon dispersion curves of the hexagonal perovskite CsNiCl3 were measured at room temperature in the vicinity of the Gamma-point along the [0 0 1] and [1 1 0] directions. The derived velocity of sound values for the longitudinal and transverse acoustic phonons are compared with the ......The acoustic phonon dispersion curves of the hexagonal perovskite CsNiCl3 were measured at room temperature in the vicinity of the Gamma-point along the [0 0 1] and [1 1 0] directions. The derived velocity of sound values for the longitudinal and transverse acoustic phonons are compared...

Learning to Trust. On the Treasure Coast, Tech Prep Proves a Trove for Educators Long Divided.

Science.gov (United States)

Winterburn, Patty

1995-01-01

Based on the "High Schools That Work" model, the Quad County Tech Prep Consortium in Florida has won several awards for its comprehensive tech prep program. The partnership enables technical students from four school districts to flow smoothly into an associate degree program at Indian River Community College. (JOW)

Virginia Tech to host virtual reality, robotics, and web workshops for middle school students

OpenAIRE

Felker, Susan B.

2004-01-01

Three summer workshops on web development, virtual reality, and robotics will offer aspiring middle school web designers, writers, and computer scientists a high-tech learning adventure designed to teach skills in math, science, computers, and oral and written communication. Virginia Tech's Continuing and Professional Education and the Center for Instructional Technology Solutions in Industry and Education developed the workshops with support from Montgomery County and Salem schools. Classes ...

DNA polymerase gamma inhibition by vitamin K3 induces mitochondria-mediated cytotoxicity in human cancer cells.

Science.gov (United States)

Sasaki, Ryohei; Suzuki, Yoko; Yonezawa, Yuko; Ota, Yosuke; Okamoto, Yoshiaki; Demizu, Yusuke; Huang, Peng; Yoshida, Hiromi; Sugimura, Kazuro; Mizushina, Yoshiyuki

2008-05-01

Among the vitamin K (VK) compounds, VK3 exhibits distinct cytotoxic activity in cancer cells and is thought to affect redox cycling; however, the underlying mechanisms remain unclear. Here we demonstrate that VK3 selectively inhibits DNA polymerase (pol) gamma, the key enzyme responsible for mitochondrial DNA replication and repair. VK3 at 30 microM inhibited pol gamma by more than 80%, caused impairment of mitochondrial DNA replication and repair, and induced a significant increase in reactive oxygen species (ROS), leading to apoptosis. At a lower concentration (3 microM), VK3 did not cause a significant increase in ROS, but was able to effectively inhibit cell proliferation, which could be reversed by supplementing glycolytic substrates. The cytotoxic action of VK3 was independent of p53 tumor suppressor gene status. Interestingly, VK3 only inhibited pol gamma but did not affect other pol including human pol alpha, pol beta, pol delta, and pol epsilon. VK1 and VK2 exhibited no inhibitory effect on any of the pol tested. These data together suggest that the inhibition of pol gamma by VK3 is relatively specific, and that this compound seems to exert its anticancer activity by two possible mechanisms in a concentration-dependent manner: (1) induction of ROS-mediated cell death at high concentrations; and (2) inhibition of cell proliferation at lower concentrations likely through the suppression of mitochondrial respiratory function. These findings may explain various cytotoxic actions induced by VK3, and may pave the way for the further use of VK3.

Industrial applications of Tenova FlexyTech flame-less low NOx burners

International Nuclear Information System (INIS)

Fantuzzi, M.; Ballarino, L.

2008-01-01

Environmental emissions constraints have led manufacturers to improve their low NO x recuperative burners. The development by Tenova of the FlexyTech Flame-less burners with low NO x emissions, even below the present 'Best Available Technology' limit of 40 ppm at 3% O 2 with furnace temperature 1250 C, air preheat 450 C, is described. The results achieved during the R and D programme have been also improved in the industrial installations. Some details and performances of the recent furnaces equipped with such burners are provided. (authors)

Adsorção de xantatos sobre pirita Adsorption of xanthate on pyrite

Directory of Open Access Journals (Sweden)

Fábio Garcia Penha

2001-10-01

Full Text Available This paper presents a study of adsorption of xanthate with alkyl chain of two (C2XK, four (C4XK and eight (C8XK atoms of carbon, on pyrite from Santa Catarina, Brazil. The results showed that pyrite surface changes from hydrophilic to hydrophobic when xanthate is adsorbed increasing the contact angle to 35º for C2XK, and to 90º for C4XK and C8XK. The rate of flotation of pyrite particles after adsorption increases with the increase of the number of carbon atoms in the alkyl chain in agreement with the results of contact angle measurements.

Determinants of investment in fixed assets and in intangible assets for high-tech firms

Directory of Open Access Journals (Sweden)

Paulo Maçãs Nunes

2017-05-01

Full Text Available Based on a sample of 141 Portuguese high-tech firms for the period 2004-2012 and using GMM system (1998 and LSDVC (2005 dynamic estimators, this paper studies whether the determinants of high-tech firms’ investment in fixed assets are identical to the determinants of their investment in intangible assets. The multiple empirical evidence obtained allows us to conclude that the determinants of their investment in fixed assets are considerably different from those of their investment in intangible assets. Debt is a determinant stimulating investment in fixed assets, with age being a determinant restricting such investment. Size, age, internal finance and GDP are determinants stimulating investment in intangible assets, whereas debt and interest rates restrict such investment. These results let us make important suggestions for the owners/managers of high-tech firms, and also for policy-makers.

A normalisation for the four - detector system for gamma - gamma angular correlation studies

International Nuclear Information System (INIS)

Kiang, G.C.; Chen, C.H.; Niu, W.F.

1994-01-01

A normalisation method for the multiple - HPGe - detector system is described. The system consists of four coaxial HPGe detectors with a CAMAC event - by - event data acquisition system, enabling to measure six gamma -gamma coincidences of angles simultaneously. An application for gamma - gamma correlation studies of Kr 82 is presented and discussed. 3 figs., 6 refs. (author)

Characterizing the Performance of the Princeton Advanced Test Stand Ion Source

Science.gov (United States)

Stepanov, A.; Gilson, E. P.; Grisham, L.; Kaganovich, I.; Davidson, R. C.

2012-10-01

The Princeton Advanced Test Stand (PATS) is a compact experimental facility for studying the physics of intense beam-plasma interactions relevant to the Neutralized Drift Compression Experiment - II (NDCX-II). The PATS facility consists of a multicusp RF ion source mounted on a 2 m-long vacuum chamber with numerous ports for diagnostic access. Ar+ beams are extracted from the source plasma with three-electrode (accel-decel) extraction optics. The RF power and extraction voltage (30 - 100 kV) are pulsed to produce 100 μsec duration beams at 0.5 Hz with excellent shot-to-shot repeatability. Diagnostics include Faraday cups, a double-slit emittance scanner, and scintillator imaging. This work reports measurements of beam parameters for a range of beam energies (30 - 50 keV) and currents to characterize the behavior of the ion source and extraction optics. Emittance scanner data is used to calculate the beam trace-space distribution and corresponding transverse emittance. If the plasma density is changing during a beam pulse, time-resolved emittance scanner data has been taken to study the corresponding evolution of the beam trace-space distribution.

EVIDENCE FOR ENHANCED {sup 3}HE IN FLARE-ACCELERATED PARTICLES BASED ON NEW CALCULATIONS OF THE GAMMA-RAY LINE SPECTRUM

Energy Technology Data Exchange (ETDEWEB)

Murphy, R. J. [Code 7650, Naval Research Laboratory, Washington, DC 20375 (United States); Kozlovsky, B. [Tel Aviv University, Tel Aviv (Israel); Share, G. H., E-mail: murphy@ssd5.nrl.navy.mil, E-mail: benz@wise.tau.ac.il, E-mail: share@astro.umd.edu [University of Maryland, College Park, MD 20742 (United States)

2016-12-20

The {sup 3}He abundance in impulsive solar energetic particle (SEP) events is enhanced up to several orders of magnitude compared to its photospheric value of [{sup 3}He]/[{sup 4}He] = 1–3 × 10{sup −4}. Interplanetary magnetic field and timing observations suggest that these events are related to solar flares. Observations of {sup 3}He in flare-accelerated ions would clarify the relationship between these two phenomena. Energetic {sup 3}He interactions in the solar atmosphere produce gamma-ray nuclear-deexcitation lines, both lines that are also produced by protons and α particles and lines that are essentially unique to {sup 3}He. Gamma-ray spectroscopy can, therefore, reveal enhanced levels of accelerated {sup 3}He. In this paper, we identify all significant deexcitation lines produced by {sup 3}He interactions in the solar atmosphere. We evaluate their production cross sections and incorporate them into our nuclear deexcitation-line code. We find that enhanced {sup 3}He can affect the entire gamma-ray spectrum. We identify gamma-ray line features for which the yield ratios depend dramatically on the {sup 3}He abundance. We determine the accelerated {sup 3}He/ α ratio by comparing these ratios with flux ratios measured previously from the gamma-ray spectrum obtained by summing the 19 strongest flares observed with the Solar Maximum Mission Gamma-Ray Spectrometer. All six flux ratios investigated show enhanced {sup 3}He, confirming earlier suggestions. The {sup 3}He/ α weighted mean of these new measurements ranges from 0.05 to 0.3 (depending on the assumed accelerated α /proton ratio) and has a <1 × 10{sup −3} probability of being consistent with the photospheric value. With the improved code, we can now exploit the full potential of gamma-ray spectroscopy to establish the relationship between flare-accelerated ions and {sup 3}He-rich SEPs.

Understanding cross-national trends in high-tech renewable power equipment exports to the United States

International Nuclear Information System (INIS)

Sawhney, Aparna; Kahn, Matthew E.

2012-01-01

We track US imports of advanced technology wind and solar power-generation equipment from a panel of countries during 1989–2010, and examine the determining factors including country size, sector-specific US FDI outflow, and domestic wind and solar power generation. Differentiating between the core high-tech and the balance of system equipment, we find US imports of both categories have grown at significantly higher rate from the relatively poorer countries, and particularly China and India. Larger countries are found to be exporting significantly more, and US FDI is found to play a significant positive role in the exports of high-tech equipment for the poor countries. For the core wind and solar high-tech equipment, we find domestic renewable power generation of the exporting countries also played a significant positive role. - Highlights: ► We track US imports of advanced technology wind and solar power-generation equipment. ► US imports of both categories have grown at significantly higher rate from China and India. ► US FDI is found to play a significant positive role in the exports of high-tech equipment.

Coupling of RELAP5-3D and GAMMA codes for Nuclear Hydrogen System Analysis

International Nuclear Information System (INIS)

Jin, Hyung Gon

2007-02-01

RELAP5-3D is one of the most important system analysis codes in nuclear field, which has been developed for best-estimate transient simulation of light water reactor coolant systems during postulated accidents. The GAMMA code is a multi-dimensional multi-component mixture analysis code with the complete set of chemical reaction models which is developed for safety analysis of HTGR (High Temperature Gas Cooled Reactor) air-ingress. The two codes, RELAP5-3D and GAMMA, are coupled to be used for nuclear-hydrogen system analysis, which requires the capability of the analysis of multi-component gas mixture and two-phase flow. In order to couple the two codes, 4 steps are needed. Before coupling, the GAMMA code was transformed into DLL (dynamic link liberally) from executive type and RELAP5-3D was recompiled into Compaq Visual Fortran environments for our debugging purpose. As the second step, two programs - RELAP5-3D and GAMMA codes - must be synchronized in terms of time and time step. Based on that time coupling, the coupled code can calculate simultaneously. Time-step coupling had been accomplished successfully and it is tested by using a simple test input. As a next step, source-term coupling was done and it was also tested in two different test inputs. The fist case is a simple test condition, which has no chemical reaction. And the other test set is the chemical reaction model, including four non-condensable gas species, which are He, O2, CO, CO2. Finally, in order to analyze combined cycle system, heat-flux coupling has been made and a simple heat exchanger model was demonstrated

A compact sup 3 H(p,gamma) sup 4 He 19.8 MeV gamma-ray source for energy calibration at the Sudbury Neutrino Observatory

CERN Document Server

Poon, A W P; Waltham, C E; Browne, M C; Robertson, R G H; Kherani, N P; Mak, H B

2000-01-01

The Sudbury Neutrino Observatory (SNO) is a new 1000-t D sub 2 O Cherenkov solar neutrino detector. A high-energy gamma-ray source is needed to calibrate SNO beyond the sup 8 B solar neutrino endpoint of 15 MeV. This paper describes the design and construction of a source that generates 19.8 MeV gamma rays using the sup 3 H(p,gamma) sup 4 He reaction (''pT''), and demonstrates that the source meets all the physical, operational and lifetime requirements for calibrating SNO. An ion source was built into this unit to generate and to accelerate protons up to 30 keV, and a high-purity scandium tritide target with a scandium-tritium atomic ratio of 1 : 2.0+-0.2 was included. This pT source is the first self-contained, compact, and portable high-energy gamma-ray source (E subgamma>10 MeV). (authors)

An update on the analysis of the Princeton 19Ne beta asymmetry measurement

Science.gov (United States)

Combs, Dustin; Calaprice, Frank; Jones, Gordon; Pattie, Robert; Young, Albert

2013-10-01

We report on the progress of a new analysis of the 1994 19Ne beta asymmetry measurement conducted at Princeton University. In this experiment, a beam of 19Ne atoms were polarized with a Stern-Gerlach magnet and then entered a thin-walled mylar cell through a slit fabricated from a piece of micro channel plate. A pair of Si(Li) detectors at either end of the apparatus were aligned with the direction of spin polarization (one parallel and one anti-parallel to the spin of the 19Ne) and detected positrons from the decays. The difference in the rate in the two detectors was used to calculate the asymmetry. A new analysis procedure has been undertaken using the Monte Carlo package PENELOPE with the goal of determining the systematic uncertainty due to positrons scattering from the face of the detectors causing the incorrect reconstruction of the initial direction of the positron momentum. This was a leading cause of systematic uncertainty in the experiment in 1994.

Wastewater engineering applications of BioIronTech process based on the biogeochemical cycle of iron bioreduction and (biooxidation

Directory of Open Access Journals (Sweden)

Volodymyr Ivanov

2014-12-01

Full Text Available Bioreduction of Fe(III and biooxidation of Fe(II can be used in wastewater engineering as an innovative biotechnology BioIronTech, which is protected for commercial applications by US patent 7393452 and Singapore patent 106658 “Compositions and methods for the treatment of wastewater and other waste”. The BioIronTech process comprises the following steps: 1 anoxic bacterial reduction of Fe(III, for example in iron ore powder; 2 surface renovation of iron ore particles due to the formation of dissolved Fe2+ ions; 3 precipitation of insoluble ferrous salts of inorganic anions (phosphate or organic anions (phenols and organic acids; 4 (biooxidation of ferrous compunds with the formation of negatively, positively, or neutrally charged ferric hydroxides, which are good adsorbents of many pollutants; 5 disposal or thermal regeration of ferric (hydroxide. Different organic substances can be used as electron donors in bioreduction of Fe(III. Ferrous ions and fresh ferrous or ferric hydroxides that are produced after iron bioreduction and (biooxidation adsorb and precipitate diferent negatively charged molecules, for example chlorinated compounds of sucralose production wastewater or other halogenated organics, as well as phenols, organic acids, phosphate, and sulphide. Reject water (return liquor from the stage of sewage sludge dewatering on municipal wastewater treatment plants represents from 10 to 50% of phosphorus load when being recycled to the aeration tank. BioIronTech process can remove/recover more than 90% of phosphorous from this reject water thus replacing the conventional process of phosphate precipitation by ferric/ferrous salts, which are 20–100 times more expensive than iron ore, which is used in BioIronTech process. BioIronTech process can remarkably improve the aerobic and anaerobic treatments of municipal and industrial wastewaters, especially anaerobic digestion of lipid- and sulphate-containing food-processing wastewater. It

Gamma-ray attenuation studies of PbO-BaO-B2O3 glass system

International Nuclear Information System (INIS)

Singh, Narveer; Singh, Kanwar Jit; Singh, Kulwant; Singh, Harvinder

2006-01-01

PbO-BaO-B 2 O 3 glass system has been investigated in terms of molar mass, mass attenuation coefficient and half value layer parameters by using gamma-ray at 511,662 and 1274keV photon energies. Gamma-ray attenuation coefficients of the prepared glass samples have been compared with tabulations based upon the results of XCOM. Good agreement has been observed between experimental and theoretical tabulations. Our results have uncertainty less than 3%. Radiation shielding properties of the glass system have been compared with some standard radiation shielding concretes

Research on 3-D terrain correction methods of airborne gamma-ray spectrometry survey

International Nuclear Information System (INIS)

Liu Yanyang; Liu Qingcheng; Zhang Zhiyong

2008-01-01

The general method of height correction is not effectual in complex terrain during the process of explaining airborne gamma-ray spectrometry data, and the 2-D terrain correction method researched in recent years is just available for correction of section measured. A new method of 3-D sector terrain correction is studied. The ground radiator is divided into many small sector radiators by the method, then the irradiation rate is calculated in certain survey distance, and the total value of all small radiate sources is regarded as the irradiation rate of the ground radiator at certain point of aero- survey, and the correction coefficients of every point are calculated which then applied to correct to airborne gamma-ray spectrometry data. The method can achieve the forward calculation, inversion calculation and terrain correction for airborne gamma-ray spectrometry survey in complex topography by dividing the ground radiator into many small sectors. Other factors are considered such as the un- saturated degree of measure scope, uneven-radiator content on ground, and so on. The results of for- ward model and an example analysis show that the 3-D terrain correction method is proper and effectual. (authors)

Search for solar axion emission from $^7$Li and D(p,$\\gamma)^3$He nuclear decays with the CAST $\\gamma$-ray calorimeter

CERN Document Server

Andriamonje, S.; Autiero, D.; Barth, K.; Belov, A.; Beltran, B.; Brauninger, H.; Carmona, J.M.; Cebrian, S.; Collar, J.I.; Dafni, T.; Davenport, M.; Di Lella, L.; Eleftheriadis, C.; Englhauser, J.; Fanourakis, G.; Ferrer-Ribas, E.; Fischer, H.; Franz, J.; Friedrich, P.; Geralis, T.; Giomataris, I.; Gninenko, S.; Gomez, H.; Hasinoff, M.; Heinsius, F.H.; Hoffmann, D.H.H.; Irastorza, I.G.; Jacoby, J.; Jakovcic, K.; Kang, D.; Konigsmann, K.; Kotthaus, R.; Krcmar, M.; Kousouris, K.; Kuster, M.; Lakic, B.; Lasseur, C.; Liolios, A.; Ljubicic, A.; Lutz, G.; Luzon, G.; Miller, D.W.; Morales, J.; Ortiz, A.; Papaevangelou, T.; Placci, A.; Raffelt, G.; Riege, H.; Rodriguez, A.; Ruz, J.; Savvidis, I.; Semertzidis, Y.; Serpico, P.; Stewart, L.; Vieira, J.D.; Villar, J.; Vogel, J.; Walckiers, L.; Zioutas, K.

2010-01-01

We present the results of a search for a high-energy axion emission signal from 7Li (0.478 MeV) and D(p,gamma)3He (5.5 MeV) nuclear transitions using a low-background gamma-ray calorimeter during Phase I of the CAST experiment. These so-called "hadronic axions" could provide a solution to the long-standing strong-CP problem and can be emitted from the solar core from nuclear M1 transitions. This is the first such search for high-energy pseudoscalar bosons with couplings to nucleons conducted using a helioscope approach. No excess signal above background was found.

Decentralized Single-beacon Acoustic Navigation: Combined Communication and Navigation for Underwater Vehicles

Science.gov (United States)

2010-06-01

update equations that the update is a linear combination of the previous state estimate and the measurement: µk|k = Aµk|k−1 + Kzk (B.10) 151 APPENDIX B...LINEAR KALMAN FILTER DERIVATION where both A and K are unknown. Using equation B.4 to solve for A: 0 = E[xk − µk|k] (B.11) = E[xk −Aµk|k−1 − Kzk ] = E...k−1 − Kzk ) = cov(xk − µk|k−1 + KHµk|k−1 −KHxk −Kvk) = cov((I − KH)(xk − µk|k−1)−Kvk) = cov((I − KH)(xk − µk|k−1)) + cov(Kvk) = (I − KH)cov(xk − µk|k−1

Multi-wavelength emission from 3C 66A: clues to its redshift and gamma-ray emission location

International Nuclear Information System (INIS)

Yan Da-Hai; Fan Zhong-Hui; Zhou Yao; Dai Ben-Zhong

2013-01-01

The quasi-simultaneous multi-wavelength emission of TeV blazar 3C 66A is studied by using a one-zone multi-component leptonic jet model. It is found that the quasi-simultaneous spectral energy distribution of 3C 66A can be well reproduced; in particular, the first three months of its average Fermi-LAT spectrum can be well reproduced by the synchrotron self-Compton component plus external Compton component of the broad line region (BLR). Clues to its redshift and gamma-ray emission location are obtained. The results indicate the following. (i) On the redshift: The theoretical intrinsic TeV spectra can be predicted by extrapolating the reproduced GeV spectra. Through comparing these extrapolated TeV spectra with the corrected observed TeV spectra from extragalactic background light, it is suggested that the redshift of 3C 66A could be between 0.1 and 0.3, with the most likely value being ∼ 0.2. (ii) On the gamma-ray emission location: To well reproduce the GeV emission of 3C 66A under different assumptions on the BLR, the gamma-ray emission region is always required to be beyond the inner zone of the BLR. The BLR absorption effect on gamma-ray emission confirms this point.

A theoretical and experimental XAS study of monolayer dispersive supported CuO/{gamma}-Al{sub 2}O{sub 3} catalysts

Energy Technology Data Exchange (ETDEWEB)

Chen Dongliang [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); Wu Ziyu [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China)]. E-mail: wuzy@ihep.ac.cn

2006-11-15

The local structures of supported CuO/{gamma}-Al{sub 2}O{sub 3} monolayer dispersive catalysts with different CuO loadings have been investigated by EXAFS and multiple scattering XANES simulations. The EXAFS results show that the first nearest neighbors around the Cu atoms in the CuO/{gamma}-Al{sub 2}O{sub 3} catalysts are similar to that of the polycrystalline CuO powder, which is independent of the CuO loadings. Moreover, the Cu K-XANES FEFF8 calculations for CuO reveal that the monolayer-dispersed CuO species are of small distorted (CuO{sub 4}) {sub m} {sup n+} clusters, which is mainly composed of a distorted CuO{sub 6} octahedron incorporated in the surface octahedral vacant sites of the {gamma}-Al{sub 2}O{sub 3} support. We consider that the CuO species for the CuO/{gamma}-Al{sub 2}O{sub 3} catalysts with loadings of 0.4 and 0.8 mmol/100 m{sup 2} are distorted (CuO{sub 4}) {sub m} {sup n+} clusters composed mainly of a distorted CuO{sub 6} octahedron incorporated in the surface octahedral vacant sites of the {gamma}-Al{sub 2}O{sub 3} support after calcinations at high temperature in air for a few hours. On the contrary, for the CuO/{gamma}-Al{sub 2}O{sub 3} with loading of 1.2 mmol/100 m{sup 2}, the local structure of Cu atoms in CuO/{gamma}-Al{sub 2}O{sub 3} is similar to that of polycrystalline CuO powder.

A Professional Mode of the Transformation of Sci-tech Achievements in Scientific Research Institutions of Tianjin City

Directory of Open Access Journals (Sweden)

Qiang Fu

2014-02-01

Full Text Available There are too many scientific research institutions in Tianjin, and the scientific research activities are very active. The transformation of Sci-tech achievements is badly in need of a set of suitable and standardized mode, and how to establish this kind of mode is an important problem faced by researchers of Tianjin Sci-tech development. Based on analyzing the situation in Tianjin research activities, the paper proposes a way to solving this problem--the professional mode of the transformation of Sci-tech achievements, illustrates the connotation of the professional mode, and describes the implement environment and the specific operation progress. According to the characteristics of factors in Tianjin, such as society, government, market, industrial technology and so on, the paper designs the professional mode of the transformation of Sci-tech achievements, which is suitable for the characteristics of Tianjin, and which plays an important role in promoting the development of the productive force in science and technology of Tianjin.

The impact of FinTech start-ups on incumbent retail banks' share prices

OpenAIRE

Li, Yinqiao; Spigt, Renée; Swinkels, Laurens

2017-01-01

Background: This study aims to clarify the role of FinTech digital banking start-ups in the financial industry. We examine the impact of the funding of such start-ups on the stock returns of 47 incumbent US retail banks for 2010 to 2016. Methods: To capture the importance of FinTech start-ups, we use data on both the dollar-volume of funding and number of deals. We relate these to the stock returns with panel data regression methods. Results: Our results indicate a positive relationship exist...

Virginia Tech team qualifies as DARPA Urban Challenge semi-finalist

OpenAIRE

Crumbley, Liz

2007-01-01

"VictorTango," a team of Virginia Tech engineering and geography students, will travel to Victorville, Calif., for the national qualifying rounds of the Urban Challenge autonomous vehicle competition, sponsored by the Defense Advanced Research Projects Agency (DARPA).

Cleanroom energy benchmarking in high-tech and biotech industries

International Nuclear Information System (INIS)

Tschudi, William; Benschine, Kathleen; Fok, Stephen; Rumsey, Peter

2001-01-01

Cleanrooms, critical to a wide range of industries, universities, and government facilities, are extremely energy intensive. Consequently, energy represents a significant operating cost for these facilities. Improving energy efficiency in cleanrooms will yield dramatic productivity improvement. But more importantly to the industries which rely on cleanrooms, base load reduction will also improve reliability. The number of cleanrooms in the US is growing and the cleanroom environmental systems' energy use is increasing due to increases in total square footage and trends toward more energy intensive, higher cleanliness applications. In California, many industries important to the State's economy utilize cleanrooms. In California these industries utilize over 150 cleanrooms with a total of 4.2 million sq. ft. (McIlvaine). Energy intensive high tech buildings offer an attractive incentive for large base load energy reduction. Opportunities for energy efficiency improvement exist in virtually all operating cleanrooms as well as in new designs. To understand the opportunities and their potential impact, Pacific Gas and Electric Company sponsored a project to benchmark energy use in cleanrooms in the electronics (high-tech) and biotechnology industries. Both of these industries are heavily dependent intensive cleanroom environments for research and manufacturing. In California these two industries account for approximately 3.6 million sq. ft. of cleanroom (McIlvaine, 1996) and 4349 GWh/yr. (Sartor et al. 1999). Little comparative energy information on cleanroom environmental systems was previously available. Benchmarking energy use allows direct comparisons leading to identification of best practices, efficiency innovations, and highlighting previously masked design or operational problems

Muzzle Flash Onset: An Algebraic Criterion and Further Validation of the Muzzle Exhaust Flow Field Model

Science.gov (United States)

1983-03-01

Tic, equals to (NI/ Nic ) where Nic , defined as the net chemical production rate of i-th species, is in general the algebraic sum of terms which are...detailed analysis has shown that in preignition regions the chemical rates which make a significant contribution to any of the Nic are such that at least...Elkton Division Lab., Inc. ATTN. R. Biddle ATTN: M. Summeitield Tech Lib. 1041 US Hlighway One North P. 0. Box 241 Princeton, NJ 08540 Elkton, MD

The CXC chemokines gamma interferon (IFN-gamma)-inducible protein 10 and monokine induced by IFN-gamma are released during severe melioidosis

NARCIS (Netherlands)

Lauw, F. N.; Simpson, A. J.; Prins, J. M.; van Deventer, S. J.; Chaowagul, W.; White, N. J.; van der Poll, T.

2000-01-01

Gamma interferon (IFN-gamma)-inducible protein 10 (IP-10) and monokine induced by IFN-gamma (Mig) are related CXC chemokines which bind to the CXCR3 receptor and specifically target activated T lymphocytes and natural killer (NK) cells. The production of IP-10 and Mig by various cell types in vitro

Perceptions of Diversity Training Needs in High Tech Business.

Science.gov (United States)

Lieberman, Devorah A.; Gurtov, Ellene

A study questioned 12 human resource personnel, corporation managers, and diversity trainers about their perceptions of diversity training needs in Pacific Northwest high tech organizations. The overarching research questions for the study were as follows: (1) What are the most frequently reported diversity training needs among human resource…

Spatial distribution of {gamma} emissivity and fast ions during ({sup 3}He)D ICRF heating experiments on JET

Energy Technology Data Exchange (ETDEWEB)

Start, D F.H. [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Righi, E [Imperial Coll. of Science and Technology, London (United Kingdom); Warrick, C [UKAEA Culham Lab., Abingdon (United Kingdom)

1994-07-01

A model is presented that can simulate the {gamma} emissivity in the poloidal cross-section during ({sup 3}He)D ICRF heated discharges in JET plasmas, by merging information obtained from the fast ion distribution and from nuclear reactions producing the observed {gamma} emissivity (production of {gamma} photons during {sup 3}He-{sup 9}Be reactions). This technique can play an important role in the identification of plasma instabilities that affect the redistribution of the fast ions in the plasma, like the TAE modes and the ripple in the tokamak magnetic field. 9 refs., 4 figs., 1 tab.

Discovery of Pulsations from the Pulsar J0205 6449 in SNR 3C 58 with the Fermi Gamma-Ray Space Telescope

Energy Technology Data Exchange (ETDEWEB)

Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, Roger D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bouvier, A.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /NASA, Goddard /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Manchester U. /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..

2011-12-01

We report the discovery of {gamma}-ray pulsations ({ge}0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the {gamma}-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold {gamma}-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 {+-} 0.01 {+-} 0.01 cycles which are aligned with the X-ray peaks. The first {gamma}-ray peak trails the radio pulse by 0.08 {+-} 0.01 {+-} 0.01, while its amplitude decreases with increasing energy as for the other {gamma}-ray pulsars. Spectral analysis of the pulsed {gamma}-ray emission suggests a simple power law of index -2.1 {+-} 0.1 {+-} 0.2 with an exponential cutoff at 3.0{sub -0.7}{sup +1.1} {+-} 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral {gamma}-ray photon flux above 0.1 GeV is (13.7 {+-} 1.4 {+-} 3.0) x 10{sup -8} cm{sup -2} s{sup -1}, which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10{sup 34} erg s{sup -1} and an efficiency {eta} of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10{sup -8} cm{sup -2} s{sup -1} for off-pulse emission from the object.

Forming system of strategic innovation management at high-tech engineering enterprises

Science.gov (United States)

Ergunova, O. T.; Lizunkov, V. G.; Malushko, E. Yu; Marchuk, V. I.; Ignatenko, A. Yu

2017-02-01

The article considers the processes of forming the strategic system of innovative activity management at the enterprises of a high-tech mechanical engineering complex (MEC) that are traditionally decisive in shaping the economic base of Russia. The authors proposed a method of designing a strategic system of innovative activity management at the MEC’s enterprises of the region which is based on the consideration of means and opportunities of the enterprise to implement intellectual activity. The proposed methodology and the empirical results constituted a ground for developing a system of strategic innovation management when performing the state-guaranteed order at the hi-tech MEC enterprises. Its implementation will help to reduce the level of uncertainty throughout the entire life cycle of an innovative activity product.

Former Virginia Tech Aerospace and Ocean Engineering Department Head Dies

OpenAIRE

Gilbert, Karen

2003-01-01

James B. Eades, Jr., retired aerospace research scientist from Bluefield, W. Wa., and former professor and department head of aerospace and ocean engineering at Virginia Tech, died Dec. 14 at Veteran's Hospital in Washington, D.C. He was 80.

Internationalisation of high-tech start-ups and fast growth-evidence for UK and Germany

OpenAIRE

Bürgel, Oliver; Fier, Andreas; Licht, Georg; Murray, Gordon

2000-01-01

For firms acting in technological niches the expansion into foreign markets can be a way to increase sales and to thus to recover initial sunk costs over a shorter time frame. Our research, based on survey data for nearly 600 British and German high-tech start-ups, examines whether internationalisation leads to faster growth among high-tech start-ups. Results show that firms with international sales have higher sales growth than firms that sell only domestically. We find that technological so...

Overview of the program on soft x-ray lasers and their applications at Princeton

International Nuclear Information System (INIS)

Suckewer, S.; Ilcisin, K.; Princeton Univ., NJ

1991-05-01

In the last several years, rapid progress in the development of soft x-ray lasers (SXL) has been observed at a number of laboratories worldwide. Although SXLs are very ''young'' devices they have already been used for microscopy and holography, and new ideas emerging for broader application of SXLs to microscopy, holography and lithography. This paper describes the work at Princeton University on the development of a soft x-ray imaging transmission microscopy using a SXL as a radiation source and work on the development of a novel soft x-ray reflection microscope and its application to biological cell studies and lithography. Progress in the development of a photopumped VUV laser (60 nm), and programs for the development of a small scale SXL and for the application of a powerful subpicosecond KrF laser system are also discussed. 35 refs., 9 figs., 1 tab

Dynamic gamma knife radiosurgery

International Nuclear Information System (INIS)

Luan Shuang; Swanson, Nathan; Chen Zhe; Ma Lijun

2009-01-01

Gamma knife has been the treatment of choice for various brain tumors and functional disorders. Current gamma knife radiosurgery is planned in a 'ball-packing' approach and delivered in a 'step-and-shoot' manner, i.e. it aims to 'pack' the different sized spherical high-dose volumes (called 'shots') into a tumor volume. We have developed a dynamic scheme for gamma knife radiosurgery based on the concept of 'dose-painting' to take advantage of the new robotic patient positioning system on the latest Gamma Knife C(TM) and Perfexion(TM) units. In our scheme, the spherical high dose volume created by the gamma knife unit will be viewed as a 3D spherical 'paintbrush', and treatment planning reduces to finding the best route of this 'paintbrush' to 'paint' a 3D tumor volume. Under our dose-painting concept, gamma knife radiosurgery becomes dynamic, where the patient moves continuously under the robotic positioning system. We have implemented a fully automatic dynamic gamma knife radiosurgery treatment planning system, where the inverse planning problem is solved as a traveling salesman problem combined with constrained least-square optimizations. We have also carried out experimental studies of dynamic gamma knife radiosurgery and showed the following. (1) Dynamic gamma knife radiosurgery is ideally suited for fully automatic inverse planning, where high quality radiosurgery plans can be obtained in minutes of computation. (2) Dynamic radiosurgery plans are more conformal than step-and-shoot plans and can maintain a steep dose gradient (around 13% per mm) between the target tumor volume and the surrounding critical structures. (3) It is possible to prescribe multiple isodose lines with dynamic gamma knife radiosurgery, so that the treatment can cover the periphery of the target volume while escalating the dose for high tumor burden regions. (4) With dynamic gamma knife radiosurgery, one can obtain a family of plans representing a tradeoff between the delivery time and

Spatial Planning and High-tech Development A comparative study of Eindhoven city-region, the Netherlands and Hsinchu City-region, Taiwan

Directory of Open Access Journals (Sweden)

Wei-Ju Huang

2013-08-01

Full Text Available High-tech development—which lies at the very heart of the processes of economic growth—has been recognised by many developed and developing countries as a strategic instrument to enhance and sustain their competitiveness in the global economic network. Although the concept of high-tech development differs between countries, many share the underlying assumption that the core of high-tech development is to create a sound environment where innovation thrives. This ideology implies a definite spatial dimension. As a result, various spatial strategies have been formulated and implemented to support high-tech development. This has had intentional and unintentional effects on the economy, society and space. Numerous studies have been devoted to exploring, analysing and theorising this global phenomenon. However, there has been less attention given to the role spatial planning may play in the process of high-tech development and to the factors that shape the spatial planning approaches to high-tech development in a particular place. The major objectives of this research are to advance the knowledge of the role of spatial planning in the process of high-tech development, and to establish an analytical framework that helps reveal the major institutional factors that shape spatial planning mechanisms for dealing with the spatial issues of high-tech development in different places. This contributes to the field of high-tech spatial policies transfer and lesson-drawing. In order to explore the major factors that shape the practices of spatial planning in hightech development, a comparative approach is applied in this research. The Eindhoven city-region in the Netherlands and the Hsinchu city-region in Taiwan are selected as case study areas. Both city-regions can be recognised as success stories of high-tech development not only on a national scale but also on a global scale, despite the fact that they apply different approaches. In the Eindhoven city

Ten Niche Strategies To Commercialize New High-Tech Products

NARCIS (Netherlands)

Ortt, J.R.; Langley, D.J.; Pals, N.

2013-01-01

There are serious gaps in the scientific literature relating to niche strategies as a means for commercializing new high-tech products. In particular, there is no clarity about what types of niche strategies can be distinguished, or how a niche strategy can be selected to suit a certain ituation. In

Learning-based Nonlinear Model Predictive Control to Improve Vision-based Mobile Robot Path Tracking

Science.gov (United States)

2015-07-01

corresponding cost function to be J(u) = ( xd − x)TQx ( xd − x) + uTRu, (20) where Qx ∈ RKnx×Knx is positive semi-definite, R and u are as in (3), xd is a...sequence of desired states, xd = ( xd ,k+1, . . . , xd ,k+K), x is a sequence of predicted states, x = (xk+1, . . . ,xk+K), and K is the given prediction...vact,k−1+b, ωact,k−1+b), based ωk θk vk xd ,i−1 xd ,i xd ,i+1 xk yk Figure 5: Definition of the robot velocities, vk and ωk, and three pose variables

The $e^+ e^- \\to Z\\gamma\\gamma \\to q\\overline{q}\\gamma\\gamma$ Reaction at LEP and Constraints on Anomalous Quartic Gauge Boson Couplings

CERN Document Server

Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, Michael; Doria, A; Dova, M T; Duchesneau, D; Echenard, B; Eline, A; El-Mamouni, H; Engler, A; Eppling, F J; Ewers, A; Extermann, Pierre; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hakobyan, R S; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Latt, J; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Palomares, C; Pandoulas, D; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R P; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wallraff, W; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

2002-01-01

The cross section of the process e^+ e^- -> Z \\gamma\\gamma -> qq~ \\gamma \\gamma is measured with 215 pb^-1 of data collected with the L3 detector during the final LEP run at centre-of-mass energies around 205 GeV and 207 GeV. No deviation from the Standard Model expectation is observed. The full data sample of 713 pb^-1, collected above the Z resonance, is used to constrain the coefficients of anomalous quartic gauge boson couplings to: -0.02 GeV^-2 < a_0/\\Lambda^2 < 0.03 GeV^-2 and -0.07 GeV^-2 < a_c/\\Lambda^2 < 0.05 GeV^-2, at 95% confidence level.

Cleanup of metals and hydrocarbons contaminated soils using the ChemTech process

International Nuclear Information System (INIS)

Stephenson, R.; Yan, V.; Lim, S.

1997-01-01

The ChemTech soil treatment process, an on-site ex-situ system, comprised of a three-phase fluidized bed to scour, emulsify and chemically leach soil contaminants into a process water, was described. The cleaned soils are then removed from the process circuit by means of a hydrodynamic classifier. At this point they are suitable for return to the excavation site. The process was demonstrated on a pilot scale in January 1997 by Klohn-Crippen Consultants at a demonstration program of emerging and innovative technologies sponsored by the Bay Area Defence Conversion Action Team (BADCAT), to assist with the remediation of twelve closing military bases in the San Francisco area. The ChemTest demonstration involved the removal of copper, chromium, lead and zinc from the Hunter Point Naval Reserve, plus treatability tests on a number of other contaminated soil samples. The ChemTech process was selected by federal and state regulatory agencies from 21 proposed technologies on the basis of performance, effectiveness, low cost, and absence of secondary environmental impacts. This paper provides details of the demonstration program, addresses the applicability of the technology to other sites, and provides cost estimates of unit cleanup costs. 3 refs., 4 tabs., 4 figs

Bixin regulates mRNA expression involved in adipogenesis and enhances insulin sensitivity in 3T3-L1 adipocytes through PPAR{gamma} activation

Energy Technology Data Exchange (ETDEWEB)

Takahashi, Nobuyuki; Goto, Tsuyoshi; Taimatsu, Aki; Egawa, Kahori; Katoh, Sota; Kusudo, Tatsuya; Sakamoto, Tomoya; Ohyane, Chie; Lee, Joo-Young; Kim, Young-il; Uemura, Taku; Hirai, Shizuka [Laboratory of Molecular Function of Food, Division of Food Science and Biotechnology, Graduate School of Agriculture, Kyoto University, Uji 611-0011 (Japan); Kawada, Teruo, E-mail: fat@kais.kyoto-u.ac.jp [Laboratory of Molecular Function of Food, Division of Food Science and Biotechnology, Graduate School of Agriculture, Kyoto University, Uji 611-0011 (Japan)

2009-12-25

Insulin resistance is partly due to suppression of insulin-induced glucose uptake into adipocytes. The uptake is dependent on adipocyte differentiation, which is controlled at mRNA transcription level. The peroxisome proliferator-activated receptor (PPAR), a ligand-regulated nuclear receptor, is involved in the differentiation. Many food-derived compounds serve as ligands to activate or inactivate PPAR. In this study, we demonstrated that bixin and norbixin (annatto extracts) activate PPAR{gamma} by luciferase reporter assay using GAL4-PPAR chimera proteins. To examine the effects of bixin on adipocytes, 3T3-L1 adipocytes were treated with bixin or norbixin. The treatment induced mRNA expression of PPAR{gamma} target genes such as adipocyte-specific fatty acid-binding protein (aP2), lipoprotein lipase (LPL), and adiponectin in differentiated 3T3-L1 adipocytes and enhanced insulin-dependent glucose uptake. The observations indicate that bixin acts as an agonist of PPAR{gamma} and enhances insulin sensitivity in 3T3-L1 adipocytes, suggesting that bixin is a valuable food-derived compound as a PPAR ligand to regulate lipid metabolism and to ameliorate metabolic syndrome.

High-tech processing of secondary resources of winemaking

Directory of Open Access Journals (Sweden)

G. Kasyanov

2017-04-01

Full Text Available The information about problems and prospects of development of food production processes based on high-tech and knowledge-intensive technical solutions is presented. To accomplish these objectives the problems of rational growing of grapes, intensive methods of production of conventional and concentrated grape juice, application of CO2ditartration for the removal of wine stone were solved.White and red table grapes, grape pomace, grape seed oil, protein and CO2-meal are the objects of the research. To evaluate the quality of raw materials, intermediate and finished products such devices as gas-liquid and thin-layer chromatography, and spectrophotometer were used. Obtaining of grape juice of white and red grapes with content of tartaric acid salts less than 1 %, food drying products and products of processing of grape pomace are the intermediate results of the research. Grape juice in flexible packages of «Pure-Pak» and «Doy-pack» types, CO2-extracts of seeds and skins of grapes and protein CO2-meal are the final objects of the research. Performed research allows us to make conclusions about expediency of high-tech methods of processing of raw materials for obtaining food products.

Design and performance of the Georgia Tech Aquatic Center photovoltaic system. Final report

Energy Technology Data Exchange (ETDEWEB)

Rohatgi, A.; Begovic, M.; Long, R.; Ropp, M.; Pregelj, A.

1996-12-31

A building-integrated DC PV array has been constructed on the Georgia Tech campus. The array is mounted on the roof of the Georgia Tech Aquatic Center (GTAC), site of the aquatic events during the 1996 Paralympic and Olympic Games in Atlanta. At the time of its construction, it was the world`s largest roof-mounted photovoltaic array, comprised of 2,856 modules and rates at 342 kW. This section describes the electrical and physical layout of the PV system, and the associated data acquisition system (DAS) which monitors the performance of the system and collects measurements of several important meteorological parameters.

gamma-linolenic acid does not augment long-chain polyunsaturated fatty acid omega-3 status

NARCIS (Netherlands)

Brouwer, DAJ; Hettema, Y; van Doormaal, JJ; Muskiet, FAJ

Augmentation of long chain polyunsaturated omega 3 fatty acid (LCPUFA omega 3) status can be reached by consumption of fish oil or by improvement of the conversion of a-linolenic acid (ALA) to LCPUFA omega 3. Since gamma-linolenic acid (GLA) might activate the rate-limiting Delta-6 desaturation, we

Virginia Tech's College Of Natural Resources Dedicates Cheatham Hall Expansion

OpenAIRE

Davis, Lynn

2003-01-01

Thanks to funding by private donors, Alyce Cheatham and her family of Portland, Oregon, Virginia Tech's College of Natural Resources will dedicate a much-needed, three-story addition to its current Cheatham Hall on Wednesday, March 19, at 2:30 p.m.

Job Future's Bright for the Chefs of Muskingum Tech.

Science.gov (United States)

Hoffman, Carl

1993-01-01

A two-year culinary arts program at Muskingum College (Zanesville, Ohio) prepares students for jobs in an emerging service-based economy. Students receive intensive classroom instruction and hands-on learning in a high-tech kitchen. Twenty-five full-time and 12 part-time students are completing their first year in the program. (LP)

Change at a Large Urban District: Developing and Operationalizing an Ed Tech Standards and Support System at Chicago Public Schools

OpenAIRE

Sayeed, Dilara Alim

2015-01-01

Chicago Public Schools (CPS) aims to effectively and efficiently leverage Education Technology (referred to as Ed Tech) to serve as a powerful resource for strong instruction. The term Ed Tech at CPS refers to digital instructional products and programs, used by students or educators, for teaching and learning. Examples of Ed Tech include literacy programs such as Achieve3000, websites or platforms such as Khan Academy or eSpark, along with a myriad other technological inventions that are rap...

{gamma} activity and heating of rods in EL2 and EL3; Activitiy {gamma} et echauffement des barres de EL2 et EL3

Energy Technology Data Exchange (ETDEWEB)

Lalere, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1959-07-01

A method is described for calculating the {gamma} activity of uranium rods, given the mean flux in which they are irradiated, the time they remain in the pile and the duration of deactivation. This calculation leads to numerical formulae which may be applied to the rods of the two reactors. It allows the saturation activities to be foreseen both for EL2 and for EL3, taking into recount the minimum times necessary for extraction. Measurements have been carried out, and the results are in good agreement with those foreseen by calculation. In the last section this method is used to calculate the heating of the irradiated rods. (author) [French] Une methode est indiquee ici, qui permet de calculer l'activite {gamma} des barres d'uranium connaissant le flux moyen dans lequel elles ont ete irradiees, leur temps de sejour en pile et la duree de la desactivation. Ce calcul conduit a des formules numeriques que l'on peut appliquer aux barres des deux reacteurs. Il permet de prevoir les activites atteintes a saturation, tant a EL2 qu'a EL3, compte tenu des temps minima necessaires a l'extraction. Des mesures ont ete faites: les resultats sont en bon accord avec les previsions du calcul. Enfin, en derniere partie, cette methode est utilisee pour calculer l'echauffement des barres irradiees. (auteur)

The Effects of Partnership Management on Supply Chain Cooperative Performance: A Case Study of High-Tech Industry

Science.gov (United States)

Wu, Mei-Ying; Chang, Yun-Ju; Weng, Yung-Chien

2009-08-01

With the structural change of global supply chains, the relationship between manufacturers and suppliers has transformed into a long-term partnership. Thus, this study aims to explore the partnership between manufacturers and suppliers in Taiwan's high-tech industry. Four constructs, including partner characteristic, partnership quality, partnership closeness, and cooperative performance, induced from previous literatures are used to construct the research framework and hypotheses. A questionnaire survey is then performed on executives and staffs involved in the high-tech industry. The proposed framework and hypotheses are empirically validated through confirmatory factory analysis and structural equation modeling. It is expected that the research findings can serve as a reference for Taiwan's high-tech industry on building partnerships.

Measurements of $Z\\gamma$ and $Z\\gamma\\gamma$ Production in pp Collisions at 8 TeV with the ATLAS Detector

CERN Document Server

Soldatov, Evgeny; The ATLAS collaboration

2016-01-01

The production of Z bosons with one or two isolated high energy photons is studied using pp collisions at 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 $fb^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic (ee, $\\mu\\mu$, $\

Growth and characterization of ceria thin films and Ce-doped {gamma}-Al{sub 2}O{sub 3} nanowires using sol-gel techniques

Energy Technology Data Exchange (ETDEWEB)

Gravani, S; Polychronopoulou, K; Doumanidis, C C; Rebholz, C [Mechanical and Manufacturing Engineering Department, Engineering School, University of Cyprus, 1678, Nicosia (Cyprus); Stolojan, V; Hinder, S J; Baker, M A [Faculty of Engineering and Physical Sciences, University of Surrey, Guildford GU2 7XH (United Kingdom); Cui, Q; Gu, Z [Department of Chemical Engineering and CHN/NCOE Nanomanufacturing Center, University of Massachusetts Lowell, Lowell, MA 01854 (United States); Gibson, P N, E-mail: M.Baker@surrey.ac.uk [Institute for Health and Consumer Protection, Joint Research Centre of the European Commission, 21027 Ispra (Italy)

2010-11-19

{gamma}-Al{sub 2}O{sub 3} is a well known catalyst support. The addition of Ce to {gamma}-Al{sub 2}O{sub 3} is known to beneficially retard the phase transformation of {gamma}-Al{sub 2}O{sub 3} to {alpha}-Al{sub 2}O{sub 3} and stabilize the {gamma}-pore structure. In this work, Ce-doped {gamma}-Al{sub 2}O{sub 3} nanowires have been prepared by a novel method employing an anodic aluminium oxide (AAO) template in a 0.01 M cerium nitrate solution, assisted by urea hydrolysis. Calcination at 500 deg. C for 6 h resulted in the crystallization of the Ce-doped AlOOH gel to form Ce-doped {gamma}-Al{sub 2}O{sub 3} nanowires. Ce{sup 3+} ions within the nanowires were present at a concentration of < 1 at.%. On the template surface, a nanocrystalline CeO{sub 2} thin film was deposited with a cubic fluorite structure and a crystallite size of 6-7 nm. Characterization of the nanowires and thin films was performed using scanning electron microscopy, transmission electron microscopy, electron energy loss spectroscopy, x-ray photoelectron spectroscopy and x-ray diffraction. The nanowire formation mechanism and urea hydrolysis kinetics are discussed in terms of the pH evolution during the reaction. The Ce-doped {gamma}-Al{sub 2}O{sub 3} nanowires are likely to find useful applications in catalysis and this novel method can be exploited further for doping alumina nanowires with other rare earth elements.

Hippocampal deletion of BDNF gene attenuates gamma oscillations in area CA1 by up-regulating 5-HT3 receptor.

Directory of Open Access Journals (Sweden)

Ying Huang

2011-01-01

Full Text Available Pyramidal neurons in the hippocampal area CA3 express high levels of BDNF, but how this BDNF contributes to oscillatory properties of hippocampus is unknown.Here we examined carbachol-induced gamma oscillations in hippocampal slices lacking BDNF gene in the area CA3. The power of oscillations was reduced in the hippocampal area CA1, which coincided with increases in the expression and activity of 5-HT3 receptor. Pharmacological block of this receptor partially restored power of gamma oscillations in slices from KO mice, but had no effect in slices from WT mice.These data suggest that BDNF facilitates gamma oscillations in the hippocampus by attenuating signaling through 5-HT3 receptor. Thus, BDNF modulates hippocampal oscillations through serotonergic system.

Finite Element-Galerkin Approximation of the Eigenvalues of Eigenvectors of Selfadjoint Problems

Science.gov (United States)

1988-07-01

l’ "k, + 1. Combining (3.20), (3.22), and the fact that I-Eh(Ak ) and Ph are orthogonal projections we have I(I-Eh(Xk,)) PhUB 5 Si (I-Eh(xk)) PhT(Ph-I...Its adjoint are equal. (3.23) implies Hf(I-Eh(1kI )Ph)u{1B - P(IPh)UIBI 5 I(I-Eh(Ak )) PhuB -< d i ii ( Ph- I )T II H B_--H,3 1(P h- I ) u liB , and

Thermoluminescence of LaAlO3 crystals doped with Eu and Ce - Dy ions exposed to ultraviolet and gamma radiation

International Nuclear Information System (INIS)

Oliveira, Vitor H.; Faria, Luiz O.; Silva, Edna S.

2011-01-01

Due to environmental problems such as degradation of the ozone layer and control of radiation levels in units of radiation, new dosimetric materials with high sensitivity for ultraviolet (UV) and gamma radiation are of great interest for applications in environmental dosimetry. In this context, this paper presents the results of a systematic investigation of the thermoluminescent (TL) response of LaAlO 3 crystals doped with different concentrations of trivalent optically active ions exposed to UV and gamma radiation doses. The work has been performed under a direct cooperation between the Institute of Inorganic Chemistry in Moscow (IGIC), responsible for crystal growth, and the Center for Development of Nuclear Technology (CDTN), responsible for the study of its luminescent properties. In this context, samples doped with 1% of Eu 3+ , 1% Ce 3+ , 5% of Ce 3+ and also co-doped with 5% Ce 3+ and 1% Dy 3+ were grown under hydrothermal conditions. The investigation was divided into two fronts, one for gamma radiation and the other for UV radiation. In the investigation with gamma radiation the best TL response has been obtained from LaAlO 3 :Eu. This crystal has shown good sensitivity and excellent linearity between TL output and the delivered gamma doses ranging from 0.1 to 10.0 mGy. In addition, its TL curve is quite similar to the Al 2 O 3 :C, a commercial TL phosphor with high sensitivity to gamma radiation. In the investigation with UV radiation the best response has been achieved for co-doped LaAlO 3 :Ce,Dy. They have excellent sensitivity and good linearity for spectral irradiances ranging from 0.042 to 1.2 mJ.cm -2 . (author)

77 FR 5291 - Thermo Tech Technologies Inc., T.V.G. Technologies Ltd., and Visual Frontier, Inc.; Order of...

Science.gov (United States)

2012-02-02

... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Thermo Tech Technologies Inc., T.V.G. Technologies Ltd., and Visual Frontier, Inc.; Order of Suspension of Trading January 31, 2012. It appears to... concerning the securities of Thermo Tech Technologies Inc. because it has not filed any periodic reports...

Kalam's visit to cement Indo-Swiss ties in high tech area

CERN Multimedia

Sumir, Paul

2005-01-01

Seeking to boost Indo-Swiss cooperation in high tech areas, President APJ Abdul Kalam arrived in Geneva on a four-day visit to Switzerland aimed at firming up plans for future cooperation with the CERN

Knowledge virtualization and local connectedness among smart high-tech companies

NARCIS (Netherlands)

Van Geenhuizen, M.S.; Nijkamp, P.

2011-01-01

Smart high-tech companies are characterized by knowledge intensity and open innovation. Even when these companies emerge in spatial clusters or dense urban places, they may utilize knowledge networks on a global scale. However, there is not much insight into the factors that shape knowledge

Introducing the Clean-Tech Adoption Model: A California Case Study

NARCIS (Netherlands)

Bijlveld, P.C. (Paul); Riezebos, P. (Peter); Wierstra, E. (Erik)

2012-01-01

Abstract. The Clean-Tech Adoption Model (C-TAM) explains the adoption process of clean technology. Based on the Unified Theory of Acceptance and Usage of Technology (UTAUT) combined with qualitative research and empirical data gathering, the model predicts adoption based on the perceived quality,

Sample dependent response of a LaCl{sub 3}:Ce detector in prompt gamma neutron activation analysis of bulk hydrocarbon samples

Energy Technology Data Exchange (ETDEWEB)

Naqvi, A.A., E-mail: aanaqvi@kfupm.edu.sa [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia); Al-Matouq, Faris A.; Khiari, F.Z. [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia); Isab, A.A. [Department of Chemistry, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia); Khateeb-ur-Rehman,; Raashid, M. [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia)

2013-08-11

The response of a LaCl{sub 3}:Ce detector has been found to depend upon the hydrogen content of bulk samples in prompt gamma analysis using 14 MeV neutron inelastic scattering. The moderation of 14 MeV neutrons from hydrogen in the bulk sample produces thermal neutrons around the sample which ultimately excite chlorine capture gamma rays in the LaCl{sub 3}:Ce detector material. Interference of 6.11 MeV chlorine gamma rays from the detector itself with 6.13 MeV oxygen gamma rays from the bulk samples makes the intensity of the 6.13 MeV oxygen gamma ray peak relatively insensitive to variations in oxygen concentration. The strong dependence of the 1.95 MeV doublet chlorine gamma ray yield on hydrogen content of the bulk samples confirms fast neutron moderation from hydrogen in the bulk samples as a major source of production of thermal neutrons and chlorine gamma rays in the LaCl{sub 3}:Ce detector material. Despite their poor oxygen detection capabilities, these detectors have nonetheless excellent detection capabilities for hydrogen and carbon in benzene, butyl alcohol, propanol, propanic acid, and formic acid bulk samples using 14 MeV neutron inelastic scattering.

The Prompt Gamma-Ray, Prompt Electron and Prompt X-Ray Spectra Associated with Fission Fragments of Specific Mass; Spectres de Rayons Gamma Instantanes, d'Electrons Instantanes et de Rayons X Instantanes Associes a des Fragments de Fission de Masse Donnee; 041c 0413 041d 041e 0414 ; Espectros de Rayos Gamma. Electrones y Rayos X Inmediatos, Vinculados a Fragmentos de Fision de Masa Determinada

Energy Technology Data Exchange (ETDEWEB)

Bowman, H. R.; Thompson, S. G.; Watson, R. L.; Kapoor, S. S.; Rasmussen, J. O. [Lawrence Radiation Laboratory, University of California, Berkeley, CA (United States)

1965-07-15

. Les energies des rayons gamma, des electrons instantanes et des rayons X instantanes ainsi que les energies des deux fragments de fission ont ete mesurees au moyen de detecteurs a semi-conducteurs a fort pouvoir de resolution. Les masses des fragments ont ete obtenues a partir de leurs energies, et les charges des noyaux ont ete calculees par mesure des energies des rayons X K associees a differentes masses. La grandeur et le signe du deplacement Doppler dans l'energie des rayons gamma ont permis d'atuibuer les raies gamma a des membres isoles de paires de fragments. Le deplacement Doppler permet aussi de determiner independamment la vitesse du fragment et, partant, la masse du fragment apres l'emission de neutrons. Les resultats des mesures des rayons X confirment l'impression que la majorite des rayons X instantanes emis au cours de la fission spontanee de {sup 252}Cf sont dus a une conversion interne pendant la desexcitation d'etats collectifs de faible energie des fragments de fission primaires. En dehors des resultats particuliers decrits ci-dessus, les auteurs estiment que la consequence la plus importante de leurs recherches a ete de demontrer la possibilite d'etudier les proprietes des differents fragments de fission, identifies par leur rayonnement propre - au lieu d'etudier les proprietes d'un fragment de fission moyen, de masse et de charge moyennes. Les auteurs etudient les consequences de ce perfectionnement de la methode utilisee pour etudier les fragments de fission. (author) [Spanish] En coincidencia con fragmentos en movimiento provenientes de la fision del {sup 252}Cf, los autores observaron rayos gamma, electrones de conversion y rayos X-K inmediatos. En algunos casos, pudieron identificar las masas y Las cargas de los nucleos que emiten los rayos gamma y los electrones de conversion. Las energias de los rayos gamma, de los electrones y de los rayos X inmediatos, asi como tambien las energias de los dos fragmentos de fision, se midieron con

Batteryless {gamma}-Ray Dosimeter; Dosimetre de rayons {gamma}, sans batteries; {gamma}-dozimetr bez batarei; Dosimetro a rayos {gamma} sin bateria

Energy Technology Data Exchange (ETDEWEB)

Gross, Bernhard [National Institute of Technology, Rio de Janeiro (Brazil)

1960-06-15

The Compton current produced by X-rays and {gamma}-rays in the 0.3 to 3 MeV range is proportional to the radiant energy flux. Therefore the intensity of the current can be used as a measure of radiation dose. The present paper describes a radiation receiver and electrical measuring system suitable for Compton current measurements and results obtained with this device under irradiation from a 2000 curie Co{sup 60} source. (author) [French] Le courant de Compton produit par des rayons X et {gamma} dans le domaine d'energies compris entre 0,3 et 3 MeV est proportionnel au flux d'energie rayonnante. C'est pourquoi l'intensite du courant peut servir de mesure de la dose de rayonnements. Le memoire decrit un ensemble, appareil recepteur de rayonnements et appareil de mesure electrique, permettant de mesurer le courant de Compton et il expose les resultats obtenus, au moyen de ce dispositif, sous irradiation par une source de Co{sup 60} de 2000 curies. (author) [Spanish] La corriente de Compton producida por rayos X y rayos {gamma} de energia comprendida entre 0,3 y 3 MeV es proporcional al flujo de energia radiante. Por consiguiente, la intensidad de la corriente puede servir para medir la dosis de radiacion. En este trabajo se describen un receptor de radiaciones y un sistema de medicion electrica apropiados para determinar la intensidad de la corriente de Compton, asi como los resultados obtenidos mediante este dis- positivo cuando se irradia con una fuente de Co{sup 60} de 2000 curies. (author) [Russian] Komptonovskij potok, obrazuemyj rentgenovskim i luchami i {gamma}-luchami v predelakh ot 0,3 do 3 mehv, proportsionale n potoku luchistoj ehnergii. Poehtomu intensivnost' potoka mozhet byt' ispol'zovana dlya izmereniya dozy radiatsii. V nastoyashchem dokumente opisyvayutsya radiatsionny j priemnik i ehlektricheskaya izmeritel'naya sistema, prigodnye dlya izmerenij s pomoshch'yu komptonovskog o potoka, i rezul'taty, poluchennye s pomoshch'yu ehtogo ustrojstva v khode

ZnO-PbO-B2O3 glasses as gamma-ray shielding materials

DEFF Research Database (Denmark)

Singh, H.; Singh, K.; Gerward, Leif

2003-01-01

Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO.2xPbO.(1-3x)B2O3 (x = 0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared wi...... with theoretical data. The specific volume of the glasses has been derived from density measurements and studied as a function of composition. It is pointed out that these glasses have potential applications in radiation shielding.......Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO.2xPbO.(1-3x)B2O3 (x = 0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared...

Effect of gamma irradiation on rat thymus arginine-rich H3 histone in vitro

International Nuclear Information System (INIS)

Patil, M.S.; Narasimhan, Saroja; Sreenivasan, A.

1977-01-01

Physicochemical properties of rat thymus H3 histone have been studied following gamma radiation (25-90 krad) in 0.2 N HCl. Polyacrylamide gel electrophoretic pattern (PGE) of H3 histone indicated that aggregates were formed in the histone fraction following gamma irradiation. The PGE pattern of the irradiated-histone fraction remained unaltered even after it was treated with 8.0 M urea to eliminate noncovalent bonding. On the other hand, the irradiated sample treated with β-mercaptoethanol exhibited the PGE pattern which was essentially similar to that of unirradiated sample. These results indicate that the aggregates seen in the PGE pattern of irradiated-H3 histone may be formed through interpolypeptide chain disulphide linkeges rather than by noncovalent bonding. This contention is also supported by the fact that irradiated-H3 histone exhibited hyperchromic shift at 240-250 nm region as well as increased disulphide content. Other results revealed that DNA-dependent RNA synthesis in vitro was inhibited to a greater extent by irradiated-H3 histone than by unirradiated-H3 histone. (author)

Dynamic gamma knife radiosurgery

Energy Technology Data Exchange (ETDEWEB)

Luan Shuang; Swanson, Nathan; Chen Zhe [Department of Computer Science, University of New Mexico, Albuquerque, NM 87131 (United States); Ma Lijun [Department of Radiation Oncology, University of California San Francisco, San Francisco, CA 94143 (United States)], E-mail: sluan@cs.unm.edu, E-mail: nate@cs.unm.edu, E-mail: zchen@cs.unm.edu, E-mail: lijunma@radonc.ucsf.edu

2009-03-21

Gamma knife has been the treatment of choice for various brain tumors and functional disorders. Current gamma knife radiosurgery is planned in a 'ball-packing' approach and delivered in a 'step-and-shoot' manner, i.e. it aims to 'pack' the different sized spherical high-dose volumes (called 'shots') into a tumor volume. We have developed a dynamic scheme for gamma knife radiosurgery based on the concept of 'dose-painting' to take advantage of the new robotic patient positioning system on the latest Gamma Knife C(TM) and Perfexion(TM) units. In our scheme, the spherical high dose volume created by the gamma knife unit will be viewed as a 3D spherical 'paintbrush', and treatment planning reduces to finding the best route of this 'paintbrush' to 'paint' a 3D tumor volume. Under our dose-painting concept, gamma knife radiosurgery becomes dynamic, where the patient moves continuously under the robotic positioning system. We have implemented a fully automatic dynamic gamma knife radiosurgery treatment planning system, where the inverse planning problem is solved as a traveling salesman problem combined with constrained least-square optimizations. We have also carried out experimental studies of dynamic gamma knife radiosurgery and showed the following. (1) Dynamic gamma knife radiosurgery is ideally suited for fully automatic inverse planning, where high quality radiosurgery plans can be obtained in minutes of computation. (2) Dynamic radiosurgery plans are more conformal than step-and-shoot plans and can maintain a steep dose gradient (around 13% per mm) between the target tumor volume and the surrounding critical structures. (3) It is possible to prescribe multiple isodose lines with dynamic gamma knife radiosurgery, so that the treatment can cover the periphery of the target volume while escalating the dose for high tumor burden regions. (4) With dynamic gamma knife radiosurgery, one can

Study of apoptosis and Caspase-3, Fas expression in rat glioma after treatment with gamma knife

International Nuclear Information System (INIS)

Zhao Qingqiu; Zhao Wenqing; Yue Xiangyong; Du Yali; Dong Liying; Zhou Lixia

2003-01-01

Objective: To investigate the apoptosis and Caspase-3, Fas expression in rat glioma after treatment with gamma knife. Methods: Setting up C6 glioma model with 60 rats, which were divided into a treatment group ( n= 30) and a control group (n=30). On the 14 th day after planting glioma cells, rats of the treatment group were subjected to gamma knife irradiation. At the 12 th hr, 24 th hr, 48 th hr, 7 th day, 14 th day, 21 st day, flow cytometry was performed to estimate the glioma cells' apoptosis and the expression of Caspase-3 and Fas. The relation between apoptosis and the two kinds of proteins was analysed. Results: Compared with the control group, the apoptosis rate of the glioma cells in the treatment group increased obviously (P th hr reached its peak, then decreased gradually. The expression of Caspase-3 and Fas was positively correlated with apoptosis (r 1 =0.928, r 2 =0.916). Conclusion: The apoptosis of the tumor cells is a kind of effect of gamma knife treatment. Caspase-3 and Fas gene may take part in the regulation of apoptosis

Gamma-induced defect production in ZrO2-Y2O3 crystals with different defectiveness

International Nuclear Information System (INIS)

Ashurov, M.Kh.; Amonov, M.Z.; Rakov, A.F.

2002-01-01

Full text: The defectiveness degree of ZrO 2 -Y 2 O 3 crystals depends on stabilizer concentration. The work is aimed at study gamma-induced defect production in crystals with different concentration of stabilizer and defects generated by neutron irradiation. Absorption spectra were measured with Specord M-40. It was found, that after gamma-irradiation of as-grown crystals up to some dose the intensity of absorption band at 420 nm reaches the maximum level of saturation. The dose of saturation depends of the concentration of stabilizer. It means that gamma-radiation does not produce any additional defects of structure. The oxygen vacancies existing in as-grown crystals are filled by the radiation induced electrons. Since the number of oxygen vacancies depends on the stabilizer concentration, then all these vacancies can be occupied by electrons at different gamma-doses. In crystals pre-irradiated with different neutron fluences followed by gamma-irradiation, the intensity of absorption bands at 420 and 530 nm increases in two stages. The gamma-dose of the second stage beginning decreases as the neutron fluence grows. The first stage of the absorption increase is due to developing of vacancies existing in as-grown crystals. The second stage is caused by generation of additional vacancies as the result of non-radiative exciton decay near the existing structure damages. The decrease of the gamma-dose, when the second stage of vacancy accumulation begins, results from the neutron induced structure damage degree

CHARCOAL PACKED FURNACE FOR LOW-TECH CHARRING OF BONE

DEFF Research Database (Denmark)

Jacobsen, P.; Dahi, Elian

1997-01-01

A low-tech furnace for charring of raw bone using char coal is developed and tested. The furnace consists of a standard oil drum, fitted with simple materials as available in every market in small towns in developing counties. 80 kg of raw bone and 6 kg of charcoal are used for production of 50 kg...

Fruit extracts of Momordica charantia potentiate glucose uptake and up-regulate Glut-4, PPAR gamma and PI3K.

Science.gov (United States)

Kumar, Ramadhar; Balaji, S; Uma, T S; Sehgal, P K

2009-12-10

Momordica charantia fruit is a widely used traditional medicinal herb as, anti-diabetic, anti-HIV, anti-ulcer, anti-inflammatory, anti-leukemic, anti-microbial, and anti-tumor. The present study is undertaken to investigate the possible mode of action of fruit extracts derived from Momordica charantia (MC) and study its pharmacological effects for controlling diabetic mellitus. Effects of aqueous and chloroform extracts of Momordica charantia fruit on glucose uptake and up-regulation of glucose transporter (Glut-4), peroxisome proliferator activator receptor gamma (PPAR gamma) and phosphatidylinositol-3 kinase (PI3K), were investigated to show its efficacy as a hypoglycaemic agent. Dose dependent glucose uptake assay was performed on L6 myotubes using 2-deoxy-D-[1-(3)H] glucose. Up-regulatory effects of the extracts on the mRNA expression level of Glut-4, PPAR gamma and PI3K have been studied. The association of Momordica charantia with the aqueous and chloroform extracts of Momordica charantia fruit at 6 microg/ml has shown significant up-regulatory effect, respectively, by 3.6-, 2.8- and 3.8-fold on the battery of targets Glut-4, PPAR gamma and PI3K involved in glucose transport. The up-regulation of glucose uptake was comparable with insulin and rosiglitazone which was approximately 2-fold over the control. Moreover, the inhibitory effect of the cyclohexamide on Momordica charantia fruit extract mediated glucose uptake suggested the requirement of new protein synthesis for the enhanced glucose uptake. This study demonstrated the significance of Glut-4, PPAR gamma and PI3K up-regulation by Momordica charantia in augmenting the glucose uptake and homeostasis.

Development of a data capture tool for researching tech entrepreneurship

DEFF Research Database (Denmark)

Andersen, Jakob Axel Bejbro; Howard, Thomas J.; McAloone, Tim C.

2014-01-01

. This paper elucidates the requirements for such tools by drawing on knowledge of the entrepreneurial phenomenon and by building on the existing research tools used in design research. On this basis, the development of a capture method for tech startup processes is described and its potential discussed....

PROCESS MANAGEMENT IN HIGH TECH NEW ZEALAND FIRMS

OpenAIRE

LINCOLN WOOD; QIANG LU

2008-01-01

There are three distinct functions in the product realization chain — product design, process design, and process execution; thus there are two interfaces (product design — process design; process design — process execution) rather than one (product-manufacturing). Case studies of four organizations manufacturing high-tech products in New Zealand are explored to study the organization of process design functions and success strategies. Similarities in structuring, relationships between functi...

Ih tunes theta/gamma oscillations and cross-frequency coupling in an in silico CA3 model.

Directory of Open Access Journals (Sweden)

Samuel A Neymotin

Full Text Available Ih channels are uniquely positioned to act as neuromodulatory control points for tuning hippocampal theta (4-12 Hz and gamma (25 Hz oscillations, oscillations which are thought to have importance for organization of information flow. contributes to neuronal membrane resonance and resting membrane potential, and is modulated by second messengers. We investigated oscillatory control using a multiscale computer model of hippocampal CA3, where each cell class (pyramidal, basket, and oriens-lacunosum moleculare cells, contained type-appropriate isoforms of . Our model demonstrated that modulation of pyramidal and basket allows tuning theta and gamma oscillation frequency and amplitude. Pyramidal also controlled cross-frequency coupling (CFC and allowed shifting gamma generation towards particular phases of the theta cycle, effected via 's ability to set pyramidal excitability. Our model predicts that in vivo neuromodulatory control of allows flexibly controlling CFC and the timing of gamma discharges at particular theta phases.

Characterization of thermoluminescent response of Al2O3:Tm/Teflon for gamma rays dosimetry

International Nuclear Information System (INIS)

Carvalho Junior, Alvaro B. de; Barros, Vinicius S.M. de; Elihimas, Diego Rafael M.; Khoury, Helen J.; Azevedo, Walter M. de

2011-01-01

In this work, α-Al 2 O 3 doped with Tm 3+ was prepared by combustion synthesis techniques for thermoluminescent (TL) ionizing radiation dosimetry applications. After this, Al 2 O 3 :Tm (0.1%) pellets were manufactured from a 2:1 homogeneous mixture of Al 2 O 3 :Tm (0.1%) and powdered Teflon (PTFE). Ten pellets were used to characterize the dosimetric properties. The dosimetric characterization was performed by analyses of the reproducibility, sensitivity of the TL response vs. dose between 1 and 10 Gy to 60 Co source and fading. The results showed a glow curve with a peak near to 225 deg C, a linear TL response with the gamma radiation dose in the range investigated and a reproducibility < 10%. These results indicate a potential use of these pellets for gamma radiation dosimetry. (author)

SURGICAL TREATMENT OF TROCHANTERIC FRACTURES BY GAMMA3 NAIL

Directory of Open Access Journals (Sweden)

Aleksandar Vukićević

2010-09-01

Full Text Available Fractures of the greater trochanter rank amongst severe injuries of bone tissue. They occur most frequently in patients over 65 years of age, nearly all of whom are diagnosed with osteoporosis. Non-surgical treatment does not prove to be satisfactory and results in high mortality rate. Surgical treatment is a method of fracture treatment of the trochanteric region, which enables early activation and thus prevents numerous complications in bedridden patients. Gamma3 nails are one of the most state-of-the-art implants for trochanteric fracture fixation. The implant is easy to embed, which does not require a large surgical team. This implant embedding requires the least invasive surgery and complications are rare.This paper describes 47 patients who received surgical treatment and is focused on the first nine months of 2009. The patients were treated at the Orthopaedics Ward of Health Centre Valjevo. They were in their seventies, average age: 72.21 years, with female sex prevailing (63.82%. The outcome was as follows: excellent in 65.96%, good in 17.02% and satisfactory in 4.25% of patients. Surface infections occurred in 6.38% of patients. One implant broke.We had one death outcome in the early post-surgical treatment.Surgical treatment of trochanteric fractures by Gamma3 implants proved very effective as it resulted in few complications and numerous excellent functional and anatomic outcomes. Thus we recommend it as an option when decision on treatment of this type of fractures is made.

A network analysis using metadata to investigate innovation in clean-tech – Implications for energy policy

International Nuclear Information System (INIS)

Marra, Alessandro; Antonelli, Paola; Dell’Anna, Luca; Pozzi, Cesare

2015-01-01

Clean-technology (clean-tech) is a large and increasing sector. Research and development (R&D) is the lifeline of the industry and innovation is fostered by a plethora of high-tech start-ups and small and medium-sized enterprises (SMEs). Any empirical-based attempt to detect the pattern of technological innovation in the industry is challenging. This paper proposes an investigation of innovation in clean-tech using metadata provided by CrunchBase. Metadata reveal information on markets, products, services and technologies driving innovation in the clean-tech industry worldwide and for San Francisco, the leader in clean-tech innovation with more than two hundred specialised companies. A network analysis using metadata is the employed methodology and the main metrics of the resulting networks are discussed from an economic point of view. The purpose of the paper is to understand specifically specializations and technological complementarities underlying innovative companies, detect emerging industrial clusters at the global and local/metropolitan level and, finally, suggest a way to realize whether observed start-ups, SMEs and clusters follow a technological path of complementary innovation and market opportunity or, instead, present a risk of lock-in. The discussion of the results of the network analysis shows interesting implications for energy policy, particularly useful from an operational point of view. - Highlights: • Metadata provide information on companies' products and technologies. • A network analysis enables detection of specializations and complementarities. • An investigation of the network allows to identify emerging industrial clusters. • Metrics help to appreciate complementary innovation and market opportunity. • Results of the network analysis show interesting policy implications.

Violence-prevention summit at Virginia Tech tackles bullying, gender-based violence, more

OpenAIRE

Elliott, Jean

2010-01-01

Bullying in schools, aggression in the workplace, violence against women -- all are complex problems. On Nov. 12 and 13, Virginia Tech hosts a gathering to make recommendations about violence prevention.

Consequences of the factorization hypothesis in nucleon-nucleon, $\\gamma p and \\gamma \\gamma$ scattering

CERN Document Server

Block, Martin M

2002-01-01

Using an eikonal structure for the scattering amplitude, factorization theorems for nucleon-nucleon, gamma p and gamma gamma scattering at high energies have been derived, using only some very general assumptions. Using a QCD-inspired eikonal analysis of nucleon-nucleon scattering, we present here experimental confirmation for factorization of cross sections, nuclear slope parameters B and rho -values (ratio of real to imaginary portion of forward scattering amplitudes), showing that: 1) the three factorization theorems of Block and Kaidalov [2000] hold, 2) the additive quark model holds to approximately=1%, and 3) vector dominance holds to better than approximately=4%. Predictions for the total cross section, elastic cross section and other forward scattering parameters at the LHC (14 TeV) are given. (12 refs).

Radiation curing of {gamma}-Al{sub 2}O{sub 3} filled epoxy resin

Energy Technology Data Exchange (ETDEWEB)

Kang, Phil Hyun; Kim, Dong Jin; Nho, Young Chang [KAERI, Taejon (Korea, Republic of)

2003-10-01

Epoxy resins are widely utilized as high performance thermosetting resins for many industrial applications but characterized by a relatively low toughness. Recently, the incorporation with rigid inorganic was suggested to improve the mechanical properties of epoxy resins. In the present work, an attempt has been taken to disperse nano-sized {gamma}- Al{sub 2}O{sub 3} particles into diglycidyl ether of bisphenol-A (DGEBA) epoxy resins for improvement of the mechanical properties. These hybrid epoxy-alumina composites were prepared using by the {gamma}-ray curing technique that was conducted with 100kGy under nitrogen at room temperature. The composites were characterized by determining gel content, UTM (Instron model 4443), SEM, FT-IR studies.

The relationship between gamma frequency and running speed differs for slow and fast gamma rhythms in freely behaving rats

Science.gov (United States)

Zheng, Chenguang; Bieri, Kevin Wood; Trettel, Sean Gregory; Colgin, Laura Lee

2015-01-01

In hippocampal area CA1 of rats, the frequency of gamma activity has been shown to increase with running speed (Ahmed and Mehta, 2012). This finding suggests that different gamma frequencies simply allow for different timings of transitions across cell assemblies at varying running speeds, rather than serving unique functions. However, accumulating evidence supports the conclusion that slow (~25–55 Hz) and fast (~60–100 Hz) gamma are distinct network states with different functions. If slow and fast gamma constitute distinct network states, then it is possible that slow and fast gamma frequencies are differentially affected by running speed. In this study, we tested this hypothesis and found that slow and fast gamma frequencies change differently as a function of running speed in hippocampal areas CA1 and CA3, and in the superficial layers of the medial entorhinal cortex (MEC). Fast gamma frequencies increased with increasing running speed in all three areas. Slow gamma frequencies changed significantly less across different speeds. Furthermore, at high running speeds, CA3 firing rates were low, and MEC firing rates were high, suggesting that CA1 transitions from CA3 inputs to MEC inputs as running speed increases. These results support the hypothesis that slow and fast gamma reflect functionally distinct states in the hippocampal network, with fast gamma driven by MEC at high running speeds and slow gamma driven by CA3 at low running speeds. PMID:25601003

MULTI-WAVELENGTH OBSERVATIONS OF THE FLARING GAMMA-RAY BLAZAR 3C 66A IN 2008 OCTOBER

International Nuclear Information System (INIS)

Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Borgland, A. W.; Bouvier, A.; Buehler, R.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Buson, S.; Bonamente, E.; Brigida, M.; Bruel, P.

2011-01-01

The BL Lacertae object 3C 66A was detected in a flaring state by the Fermi Large Area Telescope (LAT) and VERITAS in 2008 October. In addition to these gamma-ray observations, F-GAMMA, GASP-WEBT, PAIRITEL, MDM, ATOM, Swift, and Chandra provided radio to X-ray coverage. The available light curves show variability and, in particular, correlated flares are observed in the optical and Fermi-LAT gamma-ray band. The resulting spectral energy distribution can be well fitted using standard leptonic models with and without an external radiation field for inverse Compton scattering. It is found, however, that only the model with an external radiation field can accommodate the intra-night variability observed at optical wavelengths.

TechTracS: NASA's commercial technology management system

Science.gov (United States)

Barquinero, Kevin; Cannon, Douglas

1996-03-01

The Commercial Technology Mission is a primary NASA mission, comparable in importance to those in aeronautics and space. This paper will discuss TechTracS, NASA Commercial Technology Management System that has been put into place in FY 1995 to implement this mission. This system is designed to identify and capture the NASA technologies which have commercial potential into an off-the-shelf database application, and then track the technologies' progress in realizing the commercial potential through collaborations with industry. The management system consists of four stages. The first is to develop an inventory database of the agency's entire technology portfolio and assess it for relevance to the commercial marketplace. Those technologies that are identified as having commercial potential will then be actively marketed to appropriate industries—this is the second stage. The third stage is when a NASA-industry partnership is entered into for the purposes of commercializing the technology. The final stage is to track the technology's success or failure in the marketplace. The collection of this information in TechTracS enables metrics evaluation and can accelerate the establishment on direct contacts between and NASA technologist and an industry technologist. This connection is the beginning of the technology commercialization process.

Determination of gamma production from (n, gamma) reactions

International Nuclear Information System (INIS)

Kostal, M.

2007-06-01

Calculation of gamma production by interaction of neutrons with materials requires a reasonable accuracy of the nuclear libraries, i. e. effective cross sections, nuclear levels and probabilities of transitions between them. Accurate data enable accurate calculations to be performed, e.g. for PGNAA. First, gamma production in a thick 56 Fe target was examined. Appreciable discrepancies were found among the nuclear libraries available. Additional calculations were performed and compared with the observed data. The fluence of photons observed behind a thick iron target was investigated, the target being irradiated with neutrons from the front side. The results were evaluated for the various nuclear libraries. It is concluded that the libraries ENDF/B VI.2., i.e. data embedded in the MCNPX code, are sufficient for a number of applications. However, their accuracy is insufficient for prompt gamma neutron activation analysis. This is also true of data from the libraries JEFF 3.1. a JENDL 3.3, so that other libraries will have to be used for PGNAA. Specifically for 56 Fe, the data from the libraries ENDF/B VII.0 seem to be usable. (P.A.)

INNOVATIVE MODELS OF EDUCATION AND TRAINING OF SKILLED PERSONNEL FOR HIGH TECH INDUSTRIES IN UKRAINE

Directory of Open Access Journals (Sweden)

M.Shyshkina

2013-03-01

Full Text Available The problems of development of innovative learning environment of continuous education and training of skilled personnel for high-tech industry are described. Aspects of organization of ICT based learning environment of vocational and technical school on the basis of cloud computing and outsourcing are revealed. The three-stage conceptual model for perspective education and training of workers for high-tech industries is proposed. The model of cloud-based solution for design of learning environment for vocational education and training of skilled workers is introduced.

Registered particles onboard identification in the various apertures of GAMMA-400 space gamma-telescope

Science.gov (United States)

Arkhangelskaja, Irene

2016-07-01

GAMMA-400 (Gamma Astronomical Multifunctional Modular Apparatus) will be the gamma-telescope onboard international satellite gamma-observatory designed for particle registration in the wide energy band. Its parameters are optimized for detection of gamma-quanta with the energy ˜ 100 GeV in the main aperture. The main scientific goals of GAMMA-400 are to investigate fluxes of γ-rays and the electron-positron cosmic ray component possibly generated by dark matter particles decay or annihilation and to search for and study in detail discrete γ-ray sources, to investigate the energy spectra of Galactic and extragalactic diffuse γ-rays, and to study γ-ray bursts and γ-emission from the active Sun. This article presents analysis of detected events identification procedures and energy resolution in three apertures provide particles registration both from upper and lateral directions based on GAMMA-400 modeling due special designed software. Time and segmentation methods are used to reject backsplash (backscattering particles created when high energy γ-rays interact with the calorimeter's matter and move in the opposite direction) in the main aperture while only energy deposition analysis allows to reject this effect in the additional and lateral ones. The main aperture provides the best angular (all strip layers information analysis) and energy (energy deposition in the all detectors studying) resolution in the energy range 0.1 - 3 × 10^{3} GeV. The energy resolution in this band is 1%. Triggers in the main aperture will be formed using information about particle direction provided by time of flight system and presence of charged particle or backsplash signal formed according to analysis of energy deposition in combination of all two-layers anticoincidence systems individual detectors. In the additional aperture gamma-telescope allows to register events in the energy band 10 × 10^{-3} - 3 × 10^{3} GeV. The additional aperture energy resolution provides due to

Leveraging DMO's Hi-Tech Simulation Against the F-16 Flying Training Gap

National Research Council Canada - National Science Library

McGrath, Shaun R

2005-01-01

.... The purpose of this research is to examine leveraging hi-tech simulation assets against the every growing gap in training caused by a systematic reduction in the average fighter pilot's flying hours...

Gamma-Ray imaging for nuclear security and safety: Towards 3-D gamma-ray vision

Science.gov (United States)

Vetter, Kai; Barnowksi, Ross; Haefner, Andrew; Joshi, Tenzing H. Y.; Pavlovsky, Ryan; Quiter, Brian J.

2018-01-01

The development of portable gamma-ray imaging instruments in combination with the recent advances in sensor and related computer vision technologies enable unprecedented capabilities in the detection, localization, and mapping of radiological and nuclear materials in complex environments relevant for nuclear security and safety. Though multi-modal imaging has been established in medicine and biomedical imaging for some time, the potential of multi-modal data fusion for radiological localization and mapping problems in complex indoor and outdoor environments remains to be explored in detail. In contrast to the well-defined settings in medical or biological imaging associated with small field-of-view and well-constrained extension of the radiation field, in many radiological search and mapping scenarios, the radiation fields are not constrained and objects and sources are not necessarily known prior to the measurement. The ability to fuse radiological with contextual or scene data in three dimensions, in analog to radiological and functional imaging with anatomical fusion in medicine, provides new capabilities enhancing image clarity, context, quantitative estimates, and visualization of the data products. We have developed new means to register and fuse gamma-ray imaging with contextual data from portable or moving platforms. These developments enhance detection and mapping capabilities as well as provide unprecedented visualization of complex radiation fields, moving us one step closer to the realization of gamma-ray vision in three dimensions.

Virginia Tech recognizes National Farm Safety and Health Week

OpenAIRE

Sutphin, Michael D.

2006-01-01

Virginia Tech's College of Agriculture and Life Sciences and Virginia Cooperative Extension are observing National Farm Safety and Health Week, Sept. 18-22. This week commemorates the hard work, diligence, and sacrifices of our nation's farmers and ranchers and dovetails the announcement of an $800,000 grant to improve the lives of Virginia's farmers, their families, and those who live in rural communities.

Virginia Tech Wildlife Professor Helping To Save Florida Panther

OpenAIRE

Davis, Lynn

2003-01-01

With few Florida panthers now in existence, Mike Vaughan, Virginia Tech professor of wildlife and sciences in the College of Natural Resources, has been appointed to serve on the Florida Panther Scientific Review Team (SRT). Vaughan and other SRT members have made several trips to Naples, Fla., to interview state and federal biologists directly involved with the recovery of the Florida panther.

W kierunku bazy pełnotekstowej - inicjatywy BazTech

OpenAIRE

Derfert-Wolf, Lidia

2009-01-01

The paper presents the BazTech’s initiatives which lead to transforming the database from a bibliographic one into a full-text one. It points out the co-operation between ICM UW and journal publishers in the field of gaining full-text articles. It also discusses the formal procedures of the co-operation and the rules of proceeding within Konsorcjum BazTech.

Interorganizational imitation and acquisitions of high-tech ventures

OpenAIRE

Ozmel, Umit; Reuer, J. J.; Wu, Cheng-Wei

2017-01-01

Research summary: This article shows that there is a positive association between the changes in the number of prior acquisitions or the changes in the prominence of prior acquirers within the focal venture's subfield and the venture's likelihood to be acquired. Results are in line with the existence of frequency- and trait-based imitation in acquisitions targeting tech ventures. More importantly, these positive associations are more pronounced when (a) exogenous technological uncertainty wit...

Orientace na konkurenci u hi-tech podniků

OpenAIRE

Kaňovská, Lucie; Tomášková, Eva

2012-01-01

Purpose: The purpose of this paper is to examine the connection between market orientation and mainly competitor orientation and business performance at the hi-tech companies in the Czech Republic. Design/methodology/approach: The paper involves the New Method for measuring of market orientation. Data are collected through the survey and were used for the data analysis. Findings: The paper involves new aspects for perceiving competitor orientation, as a part of market orientation, and busines...

$\\gamma$-$\\gamma$ and $\\gamma$-p events at high energies

CERN Document Server

Schuler, Gerhard A.; Gerhard A Schuler; Torbjorn Sjostrand

1994-01-01

A real photon has a complicated nature, whereby it may remain unresolved or fluctuate into a vector meson or a perturbative q-qbar pair. Based on this picture, we previously presented a model for gamma-p events that is based on the presence of three main event classes: direct, VMD and anomalous. In gamma-gamma events, a natural generalization gives three-by-three combinations of the nature of the two incoming photons, and thus six distinct event classes. The properties of these classes are constrained by the choices already made, in the gamma-p model, of cut-off procedures and other aspects. It is therefore possible to predict the energy-dependence of the cross section for each of the six components separately. The total cross section thus obtained is in good agreement with data, and also gives support to the idea that a simple factorized ansatz with a pomeron and a reggeon term can be a good approximation. Event properties undergo a logical evolution from p-p to gamma-p to gamma-gamma events, with larger cha...

Thermoluminescence of LaAlO{sub 3} crystals doped with Eu and Ce - Dy ions exposed to ultraviolet and gamma radiation

Energy Technology Data Exchange (ETDEWEB)

Oliveira, Vitor H.; Faria, Luiz O., E-mail: farialo@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Silva, Edna S. [Universidade Federal de Minas Gerais (DEN/UFMG), Belo Horizonte, MG (Brazil). Dept. de Energia Nuclear; Khaidukov, Nicholas M. [Kurnakov Institute of General and Inorganic Chemistry, IGIC, Moscow (Russian Federation)

2011-07-01

Due to environmental problems such as degradation of the ozone layer and control of radiation levels in units of radiation, new dosimetric materials with high sensitivity for ultraviolet (UV) and gamma radiation are of great interest for applications in environmental dosimetry. In this context, this paper presents the results of a systematic investigation of the thermoluminescent (TL) response of LaAlO{sub 3} crystals doped with different concentrations of trivalent optically active ions exposed to UV and gamma radiation doses. The work has been performed under a direct cooperation between the Institute of Inorganic Chemistry in Moscow (IGIC), responsible for crystal growth, and the Center for Development of Nuclear Technology (CDTN), responsible for the study of its luminescent properties. In this context, samples doped with 1% of Eu{sup 3+}, 1% Ce{sup 3+}, 5% of Ce{sup 3+} and also co-doped with 5% Ce{sup 3+} and 1% Dy{sup 3+} were grown under hydrothermal conditions. The investigation was divided into two fronts, one for gamma radiation and the other for UV radiation. In the investigation with gamma radiation the best TL response has been obtained from LaAlO{sub 3}:Eu. This crystal has shown good sensitivity and excellent linearity between TL output and the delivered gamma doses ranging from 0.1 to 10.0 mGy. In addition, its TL curve is quite similar to the Al{sub 2}O{sub 3}:C, a commercial TL phosphor with high sensitivity to gamma radiation. In the investigation with UV radiation the best response has been achieved for co-doped LaAlO{sub 3}:Ce,Dy. They have excellent sensitivity and good linearity for spectral irradiances ranging from 0.042 to 1.2 mJ.cm{sup -2}. (author)

Tech Team: Student Technology Assistants in the Elementary & Middle School.

Science.gov (United States)

Peto, Erica; Onishi, Esther; Irish, Barbara

A step-by-step manual of worksheets, templates, forms and examples, this comprehensive handbook is designed for librarians, classroom teachers, and technology specialists who are interested in training students to be technology aides. The "Tech Team" program not only systematically outlines how one organizes and manages a support program, but…

Increased quercetin formation by combination treatment of gamma ray and H2O2 from cyanidin-3-O-xylosylrutinoside

International Nuclear Information System (INIS)

Lee, Seung Sik; Lee, Eun Mi; Hong, Sung Hyun; Chung, Byung Yeoup; Yoo, Sang Ho; Cho, Jae Young; Lee, In Chul

2011-01-01

The cyanidin-3-O-xylosylrutinoside (cya-3-O-xylrut) is one of the most abundant anthocyanin, which is responsible for the red, purple, and blue colors of most fruits and vegetable, in the fruit of Schisandra chinensis Baillon and raspberries. Especially the cya-3- O-xylrut is a major anthocyanin accounting for about 94% in the fruits of S. chinensis, which is a unique source of highly pure cya-3-O-xylrut, and exhibits high antioxidant activity. Previously, we reported that the red color of the S. chinensis fruit extract dramatically disappeared in a dose-dependent manner of gamma irradiation. The color of S. chinensis was effectively removed at 2 kGy of gamma irradiation, even at 1 kGy resulted in a 50% reduction. Interestingly, the destruction of cya-3-O-xylrut by gamma irradiation led to generate flavonoids such as quercetin and unknown compounds. Quercetin, a typical flavonoltype flavonoid, is one of the most prominent dietary antioxidants. It is ubiquitously present in fruits and vegetables. Quercetin exhibits various biological activities such as anti-oxidative, anti-inflammatory, anti-allergic, vasodilating, and anti-cancer effects. In the present study our purpose is to develop a promising tool for bio-conversion of organic compounds by combination treatment of H 2 O 2 and gamma ray

Comparative study of gamma ray shielding and some properties of PbO–SiO2–Al2O3 and Bi2O3–SiO2–Al2O3 glass systems

International Nuclear Information System (INIS)

Singh, K.J.; Kaur, Sandeep; Kaundal, R.S.

2014-01-01

Gamma-ray shielding properties have been estimated in terms of mass attenuation coefficient, half value layer and mean free path values, whereas, structural studies have been performed in terms of density, optical band gap, glass transition temperature and longitudinal ultrasonic velocity parameters. X-ray diffraction, UV–visible, DSC and ultrasonic techniques have been used to explore the structural properties of PbO–SiO 2 –Al 2 O 3 and Bi 2 O 3 –SiO 2 –Al 2 O 3 glass systems. - Highlights: • Bi 2 O 3 –SiO 2 –Al 2 O 3 and PbO–SiO 2 –Al 2 O 3 glasses can replace conventional concretes as gamma-ray shielding materials. • Gamma-ray shielding properties improve with the addition of heavy metals. • Rigidity deteriorates with the increase in the content of heavy metals. • Bi 2 O 3 –SiO 2 –Al 2 O 3 glass system is better than PbO–SiO 2 –Al 2 O 3 glass system in terms of gamma-ray shielding as well as structural properties

Multiwavelength Study of Gamma-Ray Bright Blazars

Science.gov (United States)

Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.

2011-01-01

We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

Precise measurement of {gamma}(K{yields}e {nu}({gamma}))/{gamma}(K{yields}{mu} {nu}({gamma})) and study of K{yields}e {nu} {gamma}

Energy Technology Data Exchange (ETDEWEB)

Ambrosino, F.; Massarotti, P.; Meola, S.; Napolitano, M. [Dipartimento di Scienze Fisiche dell' Universita ' ' Federico II' ' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bloise, C.; Bossi, F.; Capon, G.; Capussela, T.; Ciambrone, P.; De Lucia, E.; De Simone, P.; Dreucci, M.; Felici, G.; Gatti, C.; Giovannella, S.; Jacewicz, M.; Lanfranchi, G.; Miscetti, S.; Moulson, M.; Murtas, F.; Palutan, M.; Santangelo, P.; Sciascia, B.; Sibidanov, A.; Spadaro, T.; Venanzoni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' ' Tor Vergata' ' , Rome (Italy); INFN Sezione di Roma Tor Vergata, Rome (Italy); Beltrame, P.; Denig, A.; Mueller, S. [Johannes Gutenberg-Universitaet, Institut fuer Kernphysik, Mainz (Germany); Bini, C.; De Santis, A.; De Zorzi, G.; Di Domenico, A.; Fiore, S.; Franzini, P.; Gauzzi, P. [Dipartimento di Fisica dell' Universita ' ' La Sapienza' ' , Rome (Italy); INFN Sezione di Roma, Rome (Italy); Bocchetta, S.; Ceradini, F.; Di Micco, B.; Nguyen, F. [Dipartimento di Fisica dell' Universita ' ' Roma Tre' ' , Rome (Italy); INFN Sezione di Roma Tre, Rome (Italy); Branchini, P.; Graziani, E.; Passeri, A.; Tortora, L. [INFN Sezione di Roma Tre, Rome (Italy); Capriotti, D. [Dipartimento di Fisica dell' Universita ' ' Roma Tre' ' , Rome (Italy); Di Donato, C. [INFN Sezione di Napoli, Napoli (Italy); Kulikov, V. [Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Lee-Franzini, J. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); State University of New York, Physics Department, Stony Brook (United States); Martini, M.; Patera, V.; Versaci, R. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Dipartimento di Energetica dell' Universita ' ' La Sapienza' ' , Rome (Italy); Valente, P. [INFN Sezione di Roma, Rome (Italy)

2009-12-15

We present a precise measurement of the ratio R{sub K}={gamma}(K{yields}e{nu}({gamma}))/{gamma}(K{yields}{mu}{nu}({gamma})) and a study of the radiative process K{yields}e{nu}{gamma}, performed with the KLOE detector. The results are based on data collected at the Frascati e{sup +}e{sup -} collider DA {phi}NE for an integrated luminosity of 2.2 fb{sup -1}. We find R{sub K}=(2.493{+-}0.025{sub stat}{+-}0.019{sub syst}) x 10{sup -5}, in agreement with the Standard Model expectation. This result is used to improve constraints on parameters of the Minimal Supersymmetric Standard Model with lepton flavor violation. We also measured the differential decay rate d {gamma}(K{yields}e{nu}{gamma})/dE{sub {gamma}} for photon energies 10gamma}}<250 MeV. Results are compared with predictions from theory. (orig.)

Definition of a shortcut methodology for assessing flood-related Na-Tech risk

Directory of Open Access Journals (Sweden)

E. Marzo

2012-11-01

Full Text Available In this paper a qualitative methodology for the initial assessment of flood-related Na-Tech risk was developed as a screening tool to identify which situations require a much more expensive quantitative risk analysis (QRA. Through the definition of some suitable key hazard indicators (KHIs, the proposed methodology allows the identification of the Na-Tech risk level associated with a given situation; the analytical hierarchy process (AHP was used as a multi-criteria decision tool for the evaluation of such qualitative KHIs. The developed methodology was validated through two case studies by comparing the predicted risk levels with the results of much more detailed QRAs previously presented in literature and then applied to the real flood happened at Spolana a.s., Neratovice, Czech Republic in August 2002.

Effects of job-related stress and burnout on asthenopia among high-tech workers.

Science.gov (United States)

Ostrovsky, Anat; Ribak, Joseph; Pereg, Avihu; Gaton, Dan

2012-01-01

Eye- and vision-related symptoms are the most frequent health problems among computer users. The findings of eye strain, tired eyes, eye irritation, burning sensation, redness, blurred vision and double vision, when appearing together, have recently been termed 'computer vision syndrome', or asthenopia. To examine the frequency and intensity of asthenopia among individuals employed in research and development departments of high-tech firms and the effects of job stress and burnout on ocular complaints, this study included 106 subjects, 42 high-tech workers (study group) and 64 bank employees (control group). All participants completed self-report questionnaires covering demographics, asthenopia, satisfaction with work environmental conditions, job-related stress and burnout. There was a significant between-group difference in the intensity of asthenopia, but not in its frequency. Burnout appeared to be a significant contributing factor to the intensity and frequency of asthenopia. This study shows that burnout is a significant factor in asthenopic complaints in high-tech workers. This manuscript analyses the effects of psychological environmental factors, such as job stress and burnout, on ocular complaints at the workplace of computer users. The findings may have an ergonomic impact on how to improve health, safety and comfort of the working environment among computer users, for better perception of the job environment, efficacy and production.

Using digital tech to improve life for refugees | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

2016-12-20

Dec 20, 2016 ... Using digital tech to improve life for refugees ... and netbooks - can help to close the access and quality-of-service gaps for Palestinians ... individuals to enjoy more accessible and better quality health care on a continuous basis. ... health challenges by bringing life-saving information to those most in need.

Measurements of $Z\\gamma$ and $Z\\gamma\\gamma$ production in $pp$ collisions at $\\sqrt{s}=$ 8 TeV with the ATLAS detector

CERN Document Server

Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Abeloos, Baptiste; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abraham, Nicola; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allen, Benjamin William; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Armitage, Lewis James; Arnaez, Olivier; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Artz, Sebastian; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Augsten, Kamil; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Balunas, William Keaton; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barranco Navarro, Laura; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Bechtle, Philip; Beck, Hans~Peter; Becker, Kathrin; Becker, Maurice; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bedognetti, Matteo; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, Andrew Stuart; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Belyaev, Nikita; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez, Jose; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Berlendis, Simon; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertram, Iain Alexander; Bertsche, Carolyn; Bertsche, David; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bielski, Rafal; Biesuz, Nicolo Vladi; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biondi, Silvia; Bjergaard, David Martin; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Blunier, Sylvain; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Boerner, Daniela; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Bortfeldt, Jonathan; Bortoletto, Daniela; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Bossio Sola, Jonathan David; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Boutle, Sarah Kate; Boveia, Antonio; Boyd, James; Boyko, Igor; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Broughton, James; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Brunt, Benjamin; Bruschi, Marco; Bruscino, Nello; Bryant, Patrick; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Budagov, Ioulian; Buehrer, Felix; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burgard, Carsten Daniel; Burghgrave, Blake; Burka, Klaudia; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calace, Noemi; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Calvet, Thomas Philippe; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminal Armadans, Roger; Camincher, Clement; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Carbone, Ryne Michael; Cardarelli, Roberto; Cardillo, Fabio; Carli, Ina; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Casper, David William; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavallaro, Emanuele; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerda Alberich, Leonor; Cerio, Benjamin; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Stephen Kam-wah; Chan, Yat Long; Chang, Philip; Chapman, John Derek; Charlton, Dave; Chatterjee, Avishek; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Che, Siinn; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Shenjian; Chen, Shion; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Huajie; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiarelli, Giorgio; Chiodini, Gabriele; Chisholm, Andrew; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chomont, Arthur Rene; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Cirotto, Francesco; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Michael; Clark, Philip James; Clarke, Robert; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Colasurdo, Luca; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crawley, Samuel Joseph; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cúth, Jakub; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Dann, Nicholas Stuart; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Benedetti, Abraham; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Denysiuk, Denys; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Dette, Karola; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Clemente, William Kennedy; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Du, Yanyan; Duarte-Campderros, Jorge; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dutta, Baishali; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellajosyula, Venugopal; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Ennis, Joseph Stanford; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Federica; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farina, Christian; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fawcett, William James; Fayard, Louis; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Flaschel, Nils; Fleck, Ivor; Fleischmann, Philipp; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Forcolin, Giulio Tiziano; Formica, Andrea; Forti, Alessandra; Foster, Andrew Geoffrey; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; Fressard-Batraneanu, Silvia; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fusayasu, Takahiro; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gach, Grzegorz; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Louis Guillaume; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gascon Bravo, Alberto; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Gecse, Zoltan; Gee, Norman; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Geng, Cong; Gentile, Simonetta; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghasemi, Sara; Ghazlane, Hamid; Ghneimat, Mazuza; Giacobbe, Benedetto; Giagu, Stefano; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gignac, Matthew; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuli, Francesco; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gongadze, Alexi; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goudet, Christophe Raymond; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Graber, Lars; Grabowska-Bold, Iwona; Gradin, Per Olov Joakim; Grafström, Per; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Grefe, Christian; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Grevtsov, Kirill; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Groh, Sabrina; Grohs, Johannes Philipp; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guan, Wen; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Guo, Yicheng; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Hadef, Asma; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Haney, Bijan; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Jochen Jens; Heinrich, Lukas; Heinz, Christian; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Henkelmann, Steffen; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooberman, Benjamin Henry; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huo, Peng; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Introzzi, Gianluca; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ito, Fumiaki; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jain, Vivek; Jakobi, Katharina Bianca; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanneau, Fabien; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Hai; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Johansson, Per; Johns, Kenneth; Johnson, William Joseph; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Sarah; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Jovicevic, Jelena; Ju, Xiangyang; Juste Rozas, Aurelio; Köhler, Markus Konrad; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kaluza, Adam; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneti, Steven; Kanjir, Luka; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kaplan, Laser Seymour; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karentzos, Efstathios; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kasahara, Kota; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Kato, Chikuma; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Kentaro, Kawade; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kido, Shogo; Kim, Hee Yeun; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Knapik, Joanna; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Koi, Tatsumi; Kolanoski, Hermann; Kolb, Mathis; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewska, Anna Bozena; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuechler, Jan Thomas; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kukla, Romain; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurova, Anastasia; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lammers, Sabine; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Lazzaroni, Massimo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; Le Quilleuc, Eloi; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Lerner, Giuseppe; Leroy, Claude; Lesage, Arthur; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Qi; Li, Shu; Li, Xingguo; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Lindquist, Brian Edward; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Hongbin; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanlin; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loew, Kevin Michael; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Longo, Luigi; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lopez Solis, Alvaro; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Haonan; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luedtke, Christian; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Lyubushkin, Vladimir; Ma, Hong; Ma, Lian Liang; Ma, Yanhui; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Maček, Boštjan; Machado Miguens, Joana; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeda, Junpei; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Maneira, José; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Manzoni, Stefano; Mapelli, Livio; Marceca, Gino; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mc Fadden, Neil Christopher; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McClymont, Laurie; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer Zu Theenhausen, Hanno; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mistry, Khilesh; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Monden, Ryutaro; Mondragon, Matthew Craig; Mönig, Klaus; Monk, James; Monnier, Emmanuel; Montalbano, Alyssa; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Mori, Daniel; Mori, Tatsuya; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munoz Sanchez, Francisca Javiela; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Muškinja, Miha; Myagkov, Alexey; Myska, Miroslav; Nachman, Benjamin Philip; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagano, Kunihiro; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Narrias Villar, Daniel Isaac; Naryshkin, Iouri; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Norjoharuddeen, Nurfikri; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nurse, Emily; Nuti, Francesco; O'grady, Fionnbarr; O'Neil, Dugan; O'Rourke, Abigail Alexandra; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Oleiro Seabra, Luis Filipe; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onogi, Kouta; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Adam Jackson; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pascuzzi, Vincent; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Penc, Ondrej; Peng, Cong; Peng, Haiping; Penwell, John; Peralva, Bernardo; Perego, Marta Maria; Perepelitsa, Dennis; Perez Codina, Estel; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petroff, Pierre; Petrolo, Emilio; Petrov, Mariyan; Petrucci, Fabrizio; Pettersson, Nora Emilia; Peyaud, Alan; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pilcher, James; Pilkington, Andrew; Pin, Arnaud Willy J; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pires, Sylvestre; Pirumov, Hayk; Pitt, Michael; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pozo Astigarraga, Mikel Eukeni; Pralavorio, Pascal; Pranko, Aliaksandr; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Puddu, Daniele; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Raine, John Andrew; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Ratti, Maria Giulia; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reichert, Joseph; Reisin, Hernan; Rembser, Christoph; Ren, Huan; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rifki, Othmane; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Rizzi, Chiara; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodina, Yulia; Rodriguez Perez, Andrea; Rodriguez Rodriguez, Daniel; Roe, Shaun; Rogan, Christopher Sean; Røhne, Ole; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Jonatan; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryu, Soo; Ryzhov, Andrey; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saha, Puja; Sahinsoy, Merve; Saimpert, Matthias; Saito, Tomoyuki; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Salazar Loyola, Javier Esteban; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sammel, Dirk; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmieden, Kristof; Schmitt, Christian; Schmitt, Stefan; Schmitz, Simon; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shaikh, Nabila Wahab; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidebo, Per Edvin; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simon, Manuel; Sinervo, Pekka; Sinev, Nikolai; Sioli, Maximiliano; Siragusa, Giovanni; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Slovak, Radim; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Sokhrannyi, Grygorii; Solans Sanchez, Carlos; Solar, Michael; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Son, Hyungsuk; Song, Hong Ye; Sood, Alexander; Sopczak, Andre; Sopko, Vit; Sorin, Veronica; Sosa, David; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spangenberg, Martin; Spanò, Francesco; Sperlich, Dennis; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; St Denis, Richard Dante; Stabile, Alberto; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Giordon; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Stärz, Steffen; Staszewski, Rafal; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Suchek, Stanislav; Sugaya, Yorihito; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Svatos, Michal; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tapia Araya, Sebastian; Tapprogge, Stefan; Tarem, Shlomit; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Aaron; Taylor, Geoffrey; Taylor, Pierre Thor Elliot; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira-Dias, Pedro; Temming, Kim Katrin; Temple, Darren; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tisserant, Sylvain; Todome, Kazuki; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Baojia(Tony); Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Trofymov, Artur; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tseng, Jeffrey; Tsiareshka, Pavel; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsui, Ka Ming; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turgeman, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tyndel, Mike; Ucchielli, Giulia; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valdes Santurio, Eduardo; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vasquez, Jared Gregory; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigani, Luigi; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vittori, Camilla; Vivarelli, Iacopo; Vlachos, Sotirios; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wallangen, Veronica; Wang, Chao; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Tingting; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Washbrook, Andrew; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Whallon, Nikola Lazar; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilk, Fabian; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winston, Oliver James; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamaguchi, Daiki; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yang, Zongchang; Yao, Weiming; Yap, Yee Chinn; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yuen, Stephanie P; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zakharchuk, Nataliia; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zeng, Jian Cong; Zeng, Qi; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Guangyi; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Rui; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Mingliang; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz

2016-06-02

The production of $Z$ bosons with one or two isolated high-energy photons is studied using $pp$ collisions at $\\sqrt{s}$ = 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 fb$^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic ($e^{+}e^{-}$, $\\mu^{+}\\mu^{-}$, $\

Study on 3D gamma-ray imaging for medical diagnosis with coded aperture

International Nuclear Information System (INIS)

Horiki, Kazunari; Shimazoe, Kenji; Ohno, Masashi; Takahashi, Hiroyuki; Kobashi, Keiji; Moro, Eiji

2014-01-01

The conventional methods for medical imaging have several disadvantages such as restriction on the energy and detection efficiency. Coded aperture imaging can be used for medical imagings without restriction on the energy, which makes it possible to use multiple tracers in diagnosis. The detection efficiency of Coded aperture imaging is ten times better than that of the pinhole collimator. First, simulations of the coded aperture imaging have been done to confirm M-array's effectiveness. Second, two experiments have been done with low-energy gamma-ray (122 keV( 57 Co)) and with high-energy gamma-ray (662 keV( 137 Cs)). In both cases reconstructed image was successfully acquired. The measured spatial resolution in the experiment using 57 Co is 4.3 mm (FWHM). (author)

A Comparison of the Market Orientation Model in Czech and German High‑Tech Companies

Directory of Open Access Journals (Sweden)

Patrik Jangl

2016-01-01

Full Text Available A Market orientation belongs to the permanent factors of success and even in the periods of economic instability it helps to keep a company in a good condition. This article aims to compare the Czech and German model of market‑orientation of high‑tech companies in the manufacturing industry. the overall index of market orientation in the Czech Republic and Germany is almost identical. Subsequently, invariance was tested using the method of Multigroup Confirmatory Factor Analysis. a comparison of absolute terms of the models shows that significant difference among the coefficients exists in the item regarding obtaining information about competitors – i.e. competitor intelligence generation. the research did not demonstrate statistically significant differences between the models. All criteria consistently confirm configural, metric and partial scalar invariance. the only rejected equivalence is scalar invariance. In this study, therefore, no significant differences were demonstrated between the models of market‑orientation of Czech and German high‑tech companies. There are other studies that deal with the measurement invariance models of market‑oriented high‑tech companies. Using Czech and German data, this work has helped to clarify that the two versions of the measuring instruments (English and Czech are indeed equivalent to each other. Based on the research findings, academics and managers are recommend the use both measuring scales indiscriminately as valid tools for determining the index of market orientation in high‑tech firms in the manufacturing industry. For now, there is no similar or comparable research in the Czech Republic or Germany. For this reason, it seems appropriate to replicate this research in the future, including discussions with authors who deal with the issue of market orientation.

Safety assessment document (SAD) for the Princeton Beta Experiment Modification (PBX-M)

International Nuclear Information System (INIS)

Stencel, J.R.; Parsells, R.F.

1988-04-01

The Princeton Beta Experiment-Modification (PBX-M) is an experimental device of the tokamak type. A tokamak is characterized by a strong toroidal magnetic field composed of an externally driven component parallel to the torus centerline modified by the field produced by a transformer-driven current (OH) in the confined plasma. A second magnetic field parallel to the major toroidal axis is added to provide radial equilibrium for the plasma. As an advanced tokamak, PBX-M will have additional magnetic fields to reshape the plasma cross section from a circle into a kidney bean shape; it will also be equipped with 6MW or more of auxiliary heating power provided by four neutral beam injectors, with RF systems, and with an extensive set of diagnostics. Potential hazards associated with PBX-M, which are analyzed in this report, result from energy stored in the magnetic fields, high voltages necessary for the operation of some of the equipment and diagnostics, neutron radiation when the neutral beams are run with deuterium and x-rays, especially those emitted as a result of plasma-wall interaction. This report satisfies the requirements set forth in the PPPL Health and Safety Directives, specifically HSD-5003, and in DOE Order 5481.1B and its Chicago operations supplement (DOE86, DOE82)

Virginia Tech Wildlife Student Studies Cheetah Home Ranges

OpenAIRE

Davis, Lynn

2003-01-01

The cheetah may be the world's fastest land animal, accelerating to high speeds in just a few steps, but within recent years the cheetahs of South Africa are battling the race for survival. To find remedies for this problem Peter Laver, a graduate student in fisheries and wildlife sciences in the College of Natural Resources at Virginia Tech, is expanding current research on home ranges of the cheetah population located in the Serengeti National Park in Tanzania, Africa.

Knowledge Organisations and High-Tech Regional Innovation Systems in Developing Countries: Evidence from Argentina

Directory of Open Access Journals (Sweden)

Carolina Pasciaroni

2016-06-01

Full Text Available In the globally and knowledge based economy, the universities and other knowledge organisations are valued for their ability to contribute to the regional innovation processes. This is particularly relevant for the developing countries in South America since their R&D spending is highly concentrated on the public knowledge infrastructure. However, there are few studies examining the role of knowledge organizations at regional level in Latin America. The proposed study aims to analyse the role played by knowledge organisations in the formation of a high-tech Regional Innovation Systems in Argentina. This country has a number of attractive features relative to the positive evolution of its R&D spending and the recent implementation of a policy that promotes cooperation between firms and knowledge organisations among high-tech sectors. As evidenced in developed regions, the organisations under study play a key role in the promotion of a high-tech Regional Innovation Systems. However, this prominent role is not based on those local factors identified in the literature, such as organisational and institutional local assets, but on national science and technology policies and individual initiatives conducted by the faculties involved.

Spatial Planning and High-tech Development : A comparative study of Eindhoven city-region, the Netherlands and Hsinchu City-region, Taiwan

NARCIS (Netherlands)

Huang, W.J.

2013-01-01

High-tech development—which lies at the very heart of the processes of economic growth—has been recognised by many developed and developing countries as a strategic instrument to enhance and sustain their competitiveness in the global economic network. Although the concept of high-tech development

Investigation of LaBr3:Ce probe for gamma-ray spectroscopy and dosimetry

Science.gov (United States)

Maghraby, Ahmed M.; Alzimami, K. S.; Alkhorayef, M. A.; Alsafi, K. G.; Ma, A.; Alfuraih, A. A.; Alghamdi, A. A.; Spyrou, N. M.

2014-02-01

The main thrust of this work is the investigation of performance of relatively new commercial LaBr3:Ce probe (Inspector 1000™ with LaBr3:Ce crystal) for gamma-ray spectroscopy and dosimetry measurements in comparison to LaCl3:Ce and NaI:Tl scintillators. The crystals were irradiated by a wide range of energies (57Co, 22Na, 18F, 137Cs and 60Co). The study involved recording of detected spectra and measurement of energy resolution, photopeak efficiency, internal radioactivity measurements as well as dose rate. The Monte Carlo package, Geant4 Application for Tomographic Emission (GATE) was used to validate the experiments. Overall results showed very good agreement between the measurements and the simulations. The LaBr3:Ce crystal has excellent energy resolution, energy resolutions of (3.37±0.05)% and (2.98±0.07)% for a 137Cs 662 keV and a 60Co 1332 keV gamma-ray point sources respectively, were recorded. The disadvantage of the lanthanum halide scintillators is their internal radioactivity. Inspector 1000™ with LaBr3:Ce scintillator has shown an accurate and quick dose measurements at Positron Emission Tomography (PET) Units which allows accurate assessment of the radiation dose received by staff members compared to the use of electronic personal dosimeters (EPD).

High-Tech Betrayal: Working and Organizing on the Shop Floor.

Science.gov (United States)

Devinatz, Victor G.

This book, which is based on a 7-month ethnographic study of working conditions and employment practices at a biomedical electronics factory, examines the impact that high tech has had on the relationship between management and workers in the manufacturing industry. The following are among the topics discussed in the book's 10 chapters: (1) the…

New Tech, New Ties:

DEFF Research Database (Denmark)

Ling, Richard

regardless of where they are. But when we are engaged in these intimate conversations with absent friends, what happens to our relationship with the people who are actually in the same room with us? In New Tech, New Ties, Rich Ling examines how the mobile telephone affects both kinds of interactions......The message of this book is simple: the mobile phone strengthens social bonds among family and friends. With a traditional land-line telephone, we place calls to a location and ask hopefully if someone is "there"; with a mobile phone, we have instant and perpetual access to friends and family......—those mediated by mobile communication and those that are face to face. Ling finds that through the use of various social rituals the mobile telephone strengthens social ties within the circle of friends and family—sometimes at the expense of interaction with those who are physically present—and creates what he...

Mechatronics education at Virginia Tech

Science.gov (United States)

Bay, John S.; Saunders, William R.; Reinholtz, Charles F.; Pickett, Peter; Johnston, Lee

1998-12-01

The advent of more complex mechatronic systems in industry has introduced new opportunities for entry-level and practicing engineers. Today, a select group of engineers are reaching out to be more knowledgeable in a wide variety of technical areas, both mechanical and electrical. A new curriculum in mechatronics developed at Virginia Tech is starting to bring students from both the mechanical and electrical engineering departments together, providing them wit an integrated perspective on electromechanical technologies and design. The course is cross-listed and team-taught by faculty from both departments. Students from different majors are grouped together throughout the course, each group containing at least one mechanical and one electrical engineering student. This gives group members the ability to learn from one another while working on labs and projects.

Radiative decay of the eta-, eta'-mesons in the nonlocal quark model. [eta(eta'). --> gamma gamma. ; eta. -->. pi. /sup +/. pi. /sup -/. gamma. ; eta. -->. pi. /sup 0/2. gamma. ; eta'. -->. rho/sup 0/. gamma. ; eta'. -->. omega gamma. ;. pi. /sup 0/. -->. gamma. e/sup +/e/sup -/; eta(eta'). -->. gamma mu. /sup +/. mu. /sup -/

Energy Technology Data Exchange (ETDEWEB)

Efimov, G V; Ivanov, M A; Nogovitsyn, E A [Joint Inst. for Nuclear Research, Dubna (USSR)

1981-07-01

P..--> gamma gamma.. (P=..pi../sup 0/, eta, eta'), eta..--> pi../sup +/..pi../sup -/..gamma.., eta..--> pi../sup 0/..gamma gamma.., eta/sup 1/..-->..V..gamma.. (V=rho/sup 0/, ..omega..), p..--> gamma..l/sup +/l/sup -/ (p=..pi../sup 0/, eta, eta') radiation decays are studied for testing the applicability of the non-local quark model for description of the experimental data. The Feynman diagrams of these decays are presented, values of the widths of the Veta..--> gamma gamma.., eta..--> pi../sup +/..pi../sup -/..gamma.., eta..--> pi../sup 0/..gamma gamma.., eta'..--> gamma gamma.., eta'..-->..rho/sup 0/..gamma.., eta'..--> omega gamma.. decays are calculated and given in the form of a table. Calculations are carried out for two values of the eta eta'-crossing angle: THETA=-11 deg and -18 deg. Values of invariant amplitudes of these decays are determined for ..pi../sup 0/..--> gamma..e/sup +/e/sup -/, eta..--> gamma mu../sup +/..mu../sup -/, eta'..--> gamma mu../sup +/..mu../sup -/ decays at THETA=-11 deg and -18 deg. The best agreement with the experimental data is noted to take place at THETA=-11 deg, the determined width of the eta..--> pi../sup 0/..gamma gamma.. decays is underestimated as compared with the experimental one.

Improvement of tribological properties of magnetic tape by silica coating onto the Co-{gamma}-Fe{sub 2}O{sub 3} fine particles; Kobaruto hichakugata {gamma}-Fe{sub 2}O{sub 3} jisei biryushi no shisshiki shirika hyomen shori ni yoru jikitepu no suberi tokusei no kaizen

Energy Technology Data Exchange (ETDEWEB)

Hayashi, Kazuyuki; Iwasaki, Keisuke; Tanaka, Yasuyuki; Morii, Hiroko [Toda Kogyo Corporation, Hiroshima (Japan). R and D Center

1999-01-10

In order to improve the tribological properties of magnetic tape with Co-{gamma}-Fe{sub 2}O{sub 3} fine particles against a magnetic head, the silica coating onto the surface of Co-{gamma}-Fe{sub 2}O{sub 3} particles in aqueous slurry is investigated experimentally, and the kinetic friction coefficient of magnetic tapes prepared using the coated particles is measured. By this silica coating, the amount of myristic acid absorbed on the Co-{gamma}-Fe{sub 2}O{sub 3} particles tends to decrease and the kinetic friction coefficient of the magnetic tapes can be reduced from 0.4 to 0.2 because of the increase of the effective amount of myristic acid working as the lubricant when the magnetic tape is moving. Since the magnetic properties and the dispersibility of Co-{gamma}-Fe{sub 2}O{sub 3} pigment in the magnetic lacquer are not degraded by the silica coating, this coating method is expected to result in magnetic recording media with both good magnetic and low friction properties. (author)

Effect of molybdenum on gamma ray shielding and structural properties of PbO-B2O3 glasses

Science.gov (United States)

Dogra, Mridula; Singh, K. J.; Kaur, Kulwinder

2018-04-01

The present study is aimed at developing new shielding materials for gamma ray shielding applications. Transparent glasses of the composition xMoO3-0.7PbO-(0.3-x)B2O3 where x= 0.03 to 0. 06 (mole fraction) have been prepared by using melt-quenchingtechnique. Gamma ray shielding properties have been evaluated in terms of mass attenuation coefficient and half value layer parameter at photon energies 662 and 1173 keV. These shielding parameters are also compared with standard shielding material`concretes'. It has been found that prepared glass system shows better shielding properties than barite and ordinary concretes proving the possibility of its usage as an alternate to conventional concrete for gamma ray shielding applications. The density, molar volume, X-Ray Diffraction, Fourier Transform InfraRed and Raman studies have been performed to study the structural properties of the glass system. It has been analyzed from FTIR and Raman studies that bridging oxygens increase with the decrease of MoO3 content in the glass composition.

PREFACE: Modern Technologies in Industrial Engineering (ModTech2015)

Science.gov (United States)

Oanta, E.; Comaneci, R.; Carausu, C.; Placzek, M.; Cohal, V.; Topala, P.; Nedelcu, D.

2015-11-01

The dominant feature of the current stage of society development is the update, refinement and innovation of the technological processes and products whose ultimate goal is to satisfy the market requirements. New and modern technologies should be considered in terms of their applicability in industry while the materials can lead to an increase in the quality of the end products. Replacing the existing technologies with innovative and eco-efficient technologies can contribute to an added value increase in the production of new materials. Materials are one of the most dynamic and prospective fields, with applications in all other fields. The development of new advanced materials and technologies shall contribute to the procurement of a wide range of reliable products, with competitive prices and worldwide performance, high sensitivity and functionality, user-friendly and reduced energy consumption, for different industrial applications. Research in the field of advanced/intelligent materials supposes a fundamental, experimental, laboratory and technological research and its approach has to be linked to the application. This involves, even for the niche fields, complex projects which result in scientific issues in top journals, patents and functional models. The third edition of ModTech International Conference was held in Mamaia, Romania, between June 17-20, with the Professional Association in Modern Manufacturing Technologies, ModTech, as main organizer, and the Constanta Maritime University, Constanta, Romania, Silesian University of Technology, Gliwice, Poland, the Technical University of Chisinau, Republic of Moldova and the Donetsk National Technical University, Donetsk, Ukraine as co-organizers. The ModTech2015 International Conference brought together representatives of technology and materials manufacturers, various universities, professional associations and research institutes that exchanged the latest knowledge on the conference topics. This edition was

The content and role of formal contracts in high-tech alliances

NARCIS (Netherlands)

de Jong, Gjalt; Woolthuis, Rosalinde Ja Klein

2009-01-01

In this study we investigate the governance structure of innovation processes in high-tech alliances, focusing on the content and role of formal contracts. The design of a formal agreement is one of the most important strategic decisions for alliance partners. Drawing upon transaction cost arguments

Silicon Valley: Planet Startup : Disruptive Innovation, Passionate Entrepreneurship & High-tech Startups

NARCIS (Netherlands)

dr. A. Maas; Dr. P. Ester

2016-01-01

For decades now, Silicon Valley has been the home of the future. It's the birthplace of the world's most successful high-tech companies-including Apple, Yahoo, Google, Facebook, Twitter, and many more. So what's the secret? What is it about Silicon Valley that fosters entrepreneurship and

The Gamma Gap and All-Cause Mortality.

Directory of Open Access Journals (Sweden)

Stephen P Juraschek

Full Text Available The difference between total serum protein and albumin, i.e. the gamma gap, is a frequently used clinical screening measure for both latent infection and malignancy. However, there are no studies defining a positive gamma gap. Further, whether it is an independent risk factor of mortality is unknown.This study examined the association between gamma gap, all-cause mortality, and specific causes of death (cardiovascular, cancer, pulmonary, or other in 12,260 participants of the National Health and Nutrition Examination Survey (NHANES from 1999-2004. Participants had a comprehensive metabolic panel measured, which was linked with vital status data from the National Death Index. Cause of death was based on ICD10 codes from death certificates. Analyses were performed with Cox proportional hazards models adjusted for mortality risk factors. The mean (SE age was 46 (0.3 years and the mean gamma gap was 3.0 (0.01 g/dl. The population was 52% women and 10% black. During a median follow-up period of 4.8 years (IQR: 3.3 to 6.2 years, there were 723 deaths. The unadjusted 5-year cumulative incidences across quartiles of the gamma gap (1.7-2.7, 2.8-3.0, 3.1-3.2, and 3.3-7.9 g/dl were 5.7%, 4.2%, 5.5%, and 7.8%. After adjustment for risk factors, participants with a gamma gap of ≥3.1 g/dl had a 30% higher risk of death compared to participants with a gamma gap <3.1 g/dl (HR: 1.30; 95%CI: 1.08, 1.55; P = 0.006. Gamma gap (per 1.0 g/dl was most strongly associated with death from pulmonary causes (HR 2.22; 95%CI: 1.19, 4.17; P = 0.01.The gamma gap is an independent risk factor for all-cause mortality at values as low as 3.1 g/dl (in contrast to the traditional definition of 4.0 g/dl, and is strongly associated with death from pulmonary causes. Future studies should examine the biologic pathways underlying these associations.

A novel ex-vivo porcine renal xenotransplantation model using a pulsatile machine preservation system.

Science.gov (United States)

Guarrera, James V; Stone, Jonathan; Tulipan, Jacob; Jhang, Jeffrey; Arrington, Ben; Boykin, Jason; Markowitz, Glen; Ratner, Lloyd E

2011-01-01

Animal models to investigate pathophysiology and xenotransplantation require complex techniques and significant animal utilization. The aim of the study was to develop a reliable ex-vivo technique to test xenotransplant interventions. Miniature Swine being utilized for a nonsurvival study acted as donor animals. Kidneys were flushed and rapidly explanted and chilled to 4°C. Kidneys were assigned to be the control (CK) (n=3) and the mate were used as a Xenograft Kidneys (XK) (n=3). Kidneys were perfused on separate Waters RM 3 perfusion devices. Perfusion temperature was 35-37°C and pressure was 100-110/60-70 mmHg at 60 pulses per minute. CKs were reperfused with autologous blood collected at the time of organ procurement. XKs were reperfused using freshly donated whole human blood. Physical characteristics, urine output were recorded. Core needle biopsies were obtained and examined by a blinded pathologist for evidence of antibody mediated rejection. XK kidneys demonstrated homogenous reperfusion which rapidly became patchy at 5-7 minutes. XK kidneys had become complete black and thrombosed by 60-70 minutes. XK biopsies demonstrated peritubular capillaritis. CK kidneys demonstrated homogenous reperfusion and urine production. H&E stain of CKs only demonstrated nonspecific inflammation. Our ex-vivo porcine xenotransplant model shows early promise as a tool for studying Xeno- associated hyperacute rejection. This technique saves resources and animal utilization.

Virginia Tech to offer M.A. in education with reading specialist endorsement

OpenAIRE

Crichton, Juliet B.

2004-01-01

Virginia Tech's Department of Teaching and Learning in the College of Liberal Arts and Human Sciences again will offer its 39-credit Master of Arts in education program, "Reading Specialization Endorsement (PK-12)" to Virginia educators this fall.

High-pressure {sup 3}He-Xe gas scintillators for simultaneous detection of neutrons and gamma rays over a large energy range

Energy Technology Data Exchange (ETDEWEB)

Tornow, W., E-mail: tornow@tunl.duke.edu [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Esterline, J.H. [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Leckey, C.A. [Department of Physics, The College of William and Mary, Williamsburg, VA 23187 (United States); Weisel, G.J. [Department of Physics, Penn State Altoona, Altoona, PA 16601 (United States)

2011-08-11

We report on features of high-pressure {sup 3}He-Xe gas scintillators which have not been sufficiently addressed in the past. Such gas scintillators can be used not only for the efficient detection of low-energy neutrons but at the same time for the detection and identification of {gamma}-rays as well. Furthermore, {sup 3}He-Xe gas scintillators are also very convenient detectors for fast neutrons in the 1-10 MeV energy range and for high-energy {gamma}-rays in the 7-15 MeV energy range. Due to their linear pulse-height response and self calibration via the {sup 3}He(n,p){sup 3}H reaction, neutron and {gamma}-ray energies can easily be determined in this high-energy regime.

Technical note: A 3D-printed phantom for routine accuracy check of Gamma Knife Icon HDMM system.

Science.gov (United States)

Wu, Chuan; Radevic, Marlyn B; Glass, Jennifer S; Skubic, Stan E

2018-05-23

To report a novel 3D-printed device ("SH phantom") that is designed for routine accuracy check of the Gamma Knife Icon High Definition Motion Management (HDMM) system. SH phantom was designed using tinkerCAD software and printed on a commercial 3D printer. We evaluated the SH phantom on our Gamma Knife Icon unit regarding its usability and accuracy for routine HDMM QA. Single-axis and multiple-axis measurements validated the SH phantom design and implementation. An HDMM QA accuracy of 0.22 mm or better along single axis was found using SH phantom. The SH phantom proved to be a quick and simple tool to use to perform the HDMM system QA. The SH phantom was tested successfully and adopted by us as part of monthly QA for the Gamma Knife Icon. © 2018 The Authors. Journal of Applied Clinical Medical Physics published by Wiley Periodicals, Inc. on behalf of American Association of Physicists in Medicine.

Using a Mixed Model to Evaluate Job Satisfaction in High-Tech Industries.

Directory of Open Access Journals (Sweden)

Sang-Bing Tsai

Full Text Available R&D professionals are the impetus behind technological innovation, and their competitiveness and capability drive the growth of a company. However, high-tech industries have a chronic shortage of such indispensable professionals. Accordingly, reducing R&D personnel turnover has become a major human resource management challenge facing innovative companies. This study combined importance-performance analysis (IPA with the decision-making trial and evaluation laboratory (DEMATEL method to propose an IPA-DEMATEL model. Establishing this model involved three steps. First, an IPA was conducted to measure the importance of and satisfaction gained from job satisfaction criteria. Second, the DEMATEL method was used to determine the causal relationships of and interactive influence among the criteria. Third, a criteria model was constructed to evaluate job satisfaction of high-tech R&D personnel. On the basis of the findings, managerial suggestions are proposed.

Stakeholder engagement in patient-centered outcomes research: high-touch or high-tech?

Science.gov (United States)

Lavallee, Danielle C; Wicks, Paul; Alfonso Cristancho, Rafael; Mullins, C Daniel

2014-06-01

Patient and stakeholder engagement enhances the meaningfulness of patient-centered outcomes research. Continuous engagement of diverse patients helps to achieve representativeness and to avoid tokenism, but is perceived as challenging due to resource and time constraints. The widespread availability of the internet, mobile phones, and electronic devices makes 'high-tech' solutions appealing, but such approaches may trade-off larger sample sizes for shallower engagement and/or skewed perspectives if most participants reflect users of technology. More traditional 'high-touch' solutions such as in-person interviews, focus groups, and town hall meetings can provide qualitative and sociological context and potentially more in-depth insights from small numbers of patients, but such approaches are also prone to selection bias as well. We compare and contrast high-tech and high-touch approaches to engaging stakeholders and suggest hybrid processes.

Using a Mixed Model to Evaluate Job Satisfaction in High-Tech Industries.

Science.gov (United States)

Tsai, Sang-Bing; Huang, Chih-Yao; Wang, Cheng-Kuang; Chen, Quan; Pan, Jingzhou; Wang, Ge; Wang, Jingan; Chin, Ta-Chia; Chang, Li-Chung

2016-01-01

R&D professionals are the impetus behind technological innovation, and their competitiveness and capability drive the growth of a company. However, high-tech industries have a chronic shortage of such indispensable professionals. Accordingly, reducing R&D personnel turnover has become a major human resource management challenge facing innovative companies. This study combined importance-performance analysis (IPA) with the decision-making trial and evaluation laboratory (DEMATEL) method to propose an IPA-DEMATEL model. Establishing this model involved three steps. First, an IPA was conducted to measure the importance of and satisfaction gained from job satisfaction criteria. Second, the DEMATEL method was used to determine the causal relationships of and interactive influence among the criteria. Third, a criteria model was constructed to evaluate job satisfaction of high-tech R&D personnel. On the basis of the findings, managerial suggestions are proposed.

Resistance to {gamma} irradiation of LaBr{sub 3}:Ce and LaCl{sub 3}:Ce single crystals

Energy Technology Data Exchange (ETDEWEB)

Normand, S. [CEA-Recherche Technologique, DETECS/SSTM CE Saclay F-91191 Gif Sur Yvette Cedex (France)]. E-mail: stephane.normand@cea.fr; Iltis, A. [Saint-Gobain Crystals, 104 Route de Larchant, 77140 St Pierre les Nemours (France); Bernard, F. [Saint-Gobain Crystals, 104 Route de Larchant, 77140 St Pierre les Nemours (France); Domenech, T. [CEA-Recherche Technologique, DETECS/SSTM CE Saclay F-91191 Gif Sur Yvette Cedex (France); Delacour, P. [CEA-Recherche Technologique, DETECS/SSTM CE Saclay F-91191 Gif Sur Yvette Cedex (France)

2007-03-11

LaBr{sub 3}:Ce (Brillance 380) and LaCl{sub 3}:Ce (Brillance 350) both exhibit a very good energy resolution and energy linearity response. They are also more sensitive to {gamma}-rays than NaI(Tl) detectors, due to their higher density. The aim of this work is to determine the behaviour of those new single crystals in comparison with NaI(Tl) under severe {gamma}-ray irradiation. Therefore we have irradiated three 25 by 25 mm cylinder crystals encapsulated in air-tight aluminium housing with {sup 60}Co beam. Crystals were tested as stand-alone material not to test the impact of radiation to our photomultiplier tube (PMT). Only encapsulated crystals (alone, without PMTs) were irradiated during several periods to achieve the final 3.4 kGy integrated dose. Intermediate measurements of {sup 137}Cs spectrum were done in order to evaluate the impact of the dose on the studied crystal performances. The radiation hardness of LaBr{sub 3}:Ce and LaCl{sub 3}:Ce was then compared to NaI(Tl). We show in this paper that up to 3.4 kGy no permanent modification of the energy resolution nor colour change is observed for LaBr{sub 3}:Ce and LaCl{sub 3}:Ce crystals. The light output also seems quite stable. This is in stark contrast with the behaviour of NaI:Tl which exhibits continuously decreasing light output, colour change and worsening of energy resolution for doses above 5 Gy.

Areas V1 and V2 show microsaccade-related 3-4-Hz covariation in gamma power and frequency.

Science.gov (United States)

Lowet, E; Roberts, M J; Bosman, C A; Fries, P; De Weerd, P

2016-05-01

Neuronal gamma-band synchronization (25-80 Hz) in visual cortex appears sustained and stable during prolonged visual stimulation when investigated with conventional averages across trials. However, recent studies in macaque visual cortex have used single-trial analyses to show that both power and frequency of gamma oscillations exhibit substantial moment-by-moment variation. This has raised the question of whether these apparently random variations might limit the functional role of gamma-band synchronization for neural processing. Here, we studied the moment-by-moment variation in gamma oscillation power and frequency, as well as inter-areal gamma synchronization, by simultaneously recording local field potentials in V1 and V2 of two macaque monkeys. We additionally analyzed electrocorticographic V1 data from a third monkey. Our analyses confirm that gamma-band synchronization is not stationary and sustained but undergoes moment-by-moment variations in power and frequency. However, those variations are neither random and nor a possible obstacle to neural communication. Instead, the gamma power and frequency variations are highly structured, shared between areas and shaped by a microsaccade-related 3-4-Hz theta rhythm. Our findings provide experimental support for the suggestion that cross-frequency coupling might structure and facilitate the information flow between brain regions. © 2015 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

3D gamma-ray imaging systems in nuclear medicine and collimator purposes

International Nuclear Information System (INIS)

Strocovsky, S.G.; Otero, D.

2013-01-01

Single photon gamma-ray imaging systems, currently used in Nuclear Medicine, are fundamentally based on the Gamma Camera (CG) and their associated SPECT technique. The modern CG presents no essential changes in the method used to form the image compared to the camera designed by H. O. Anger (Pat US 3.011.057, 1961).The current CG, as well as the proposed by Anger, uses a collimator for the formation of images. However, this element imposes a severe limit on the maximum attainable spatial resolution and dramatically decreases the sensitivity of the whole system. As a result, CG images are, generally, low quality with high Poisson noise. On the other hand, Strocovsky, S. and D. Otero, have presented the principles of a new technique, called Full Aperture Imaging (FAI) based on a novel coded imaging technique and differential detection. FAI does not use a collimator and outperforms the CG, in sensitivity and spatial resolution. In addition, FAI allows to register 3D information in a single acquisition, while SPECT requires sequential acquisition of images for the same purpose. In this paper, a review of the gamma-ray imaging systems developed to the present is made. Several types of SPECT systems, coded imaging systems, diffractive lenses, Compton camera, multiple no-planar detectors/collimators modules and the new FAI system are included. The role of collimators in the formation of CG images is critically examined and compared to the method used in FAI. Simulated Monte Carlo Images that allow to compare CG versus FAI in identical conditions are shown. We propose a novel use of collimators in FAI, for reduction of the field of view, with 100% collection efficiency. FAI is based on data-intensive computing and in proven conventional planar detectors of CG technology, so FAI surpasses the other described systems in the combination of sensitivity, spatial resolution, 3D information acquisition, and simplicity of design. (author)

Enhancing Science Literacy and Art History Engagement at Princeton Through Collaboration Between the University Art Museum and the Council on Science and Technology

Science.gov (United States)

Riihimaki, C. A.; White, V. M.

2016-12-01

The importance of innovative science education for social science and humanities students is often under-appreciated by science departments, because these students typically do not take science courses beyond general education requirements, nor do they contribute to faculty research programs. However, these students are vitally important in society—for example as business leaders or consultants, and especially as voters. In these roles, they will be confronted with decisions related to science in their professional and personal lives. The Council on Science and Technology at Princeton University aims to fill this education gap by developing and supporting innovative programs that bring science to cross-disciplinary audiences. One of our most fruitful collaborations has been with the Princeton University Art Museum, which has an encyclopedic collection of over 92,000 works of art, ranging from antiquity to the contemporary. Our work includes 1) bringing introductory environmental science courses to the Museum to explore how original works of art of different ages can serve as paleo-environmental proxies, thereby providing a means for discussing broader concepts in development of proxies and validation of reconstructions; 2) sponsoring a panel aimed at the general public and composed of science faculty and art historians who discussed the scientific and art historical contexts behind Albert Bierstadt's Mount Adams, Washington, 1875 (oil on canvas, gift of Mrs. Jacob N. Beam, accession number y1940-430), including the landscape's subjects, materials, technique, and style; and 3) collaborating on an installation of photographs relevant to a freshman GIS course, with an essay about the artwork written by the students. This first-hand study of works of art encourages critical thinking and an empathetic approach to different historical periods and cultures, as well as to the environment. Our collaboration additionally provides an opportunity to engage more students in

The Gamma Gap and All-Cause Mortality

Science.gov (United States)

Juraschek, Stephen P.; Moliterno, Alison R.; Checkley, William; Miller, Edgar R.

2015-01-01

Background The difference between total serum protein and albumin, i.e. the gamma gap, is a frequently used clinical screening measure for both latent infection and malignancy. However, there are no studies defining a positive gamma gap. Further, whether it is an independent risk factor of mortality is unknown. Methods and Findings This study examined the association between gamma gap, all-cause mortality, and specific causes of death (cardiovascular, cancer, pulmonary, or other) in 12,260 participants of the National Health and Nutrition Examination Survey (NHANES) from 1999–2004. Participants had a comprehensive metabolic panel measured, which was linked with vital status data from the National Death Index. Cause of death was based on ICD10 codes from death certificates. Analyses were performed with Cox proportional hazards models adjusted for mortality risk factors. The mean (SE) age was 46 (0.3) years and the mean gamma gap was 3.0 (0.01) g/dl. The population was 52% women and 10% black. During a median follow-up period of 4.8 years (IQR: 3.3 to 6.2 years), there were 723 deaths. The unadjusted 5-year cumulative incidences across quartiles of the gamma gap (1.7–2.7, 2.8–3.0, 3.1–3.2, and 3.3–7.9 g/dl) were 5.7%, 4.2%, 5.5%, and 7.8%. After adjustment for risk factors, participants with a gamma gap of ≥3.1 g/dl had a 30% higher risk of death compared to participants with a gamma gap gap (per 1.0 g/dl) was most strongly associated with death from pulmonary causes (HR 2.22; 95%CI: 1.19, 4.17; P = 0.01). Conclusions The gamma gap is an independent risk factor for all-cause mortality at values as low as 3.1 g/dl (in contrast to the traditional definition of 4.0 g/dl), and is strongly associated with death from pulmonary causes. Future studies should examine the biologic pathways underlying these associations. PMID:26629820

The Virginia Tech Shootings: Implications for Crisis Communication in Educational Settings

Science.gov (United States)

Barker, Gina G.; Yoder, Mollie E.

2012-01-01

By examining Virginia Tech's crisis communication during and after the shootings on April 16, 2007, valuable insights were gained that may be applied to current crisis communication models. This article addresses the unique characteristics of educational institutions and the need for comprehensive emergency communication strategies and on-site…

Ocean FEST and TECH: Inspiring Hawaii's Students to Pursue Ocean, Earth and Environmental Science Careers

Science.gov (United States)

Bruno, B. C.; Wren, J. L.; Ayau, J. F.

2013-12-01

Ocean TECH (Technology Expands Career Horizons) is a new initiative funded by NSF/GeoEd to stimulate interest in ocean, earth and environmental science careers - and the college majors that lead to such careers - among Hawaii's underrepresented students in grades 6-14. The Ocean TECH project features hands-on ocean science and technology and interactions with career professionals. Ocean TECH builds upon Ocean FEST (Families Exploring Science Together), a previous NSF/OEDG project aimed at teaching fun hands-on science in culturally and locally relevant ways to Hawaii's elementary school students and their families. Ocean FEST was rigorously evaluated (including cognitive pre-testing developed in partnership with external evaluators) and shown to be successful both in teaching science content and changing attitudes toward ocean, earth and environmental science careers. Over the course of the four-year grant, Ocean FEST reached 20,99 students and adults, including 636 classroom teachers and other volunteers who assisted with program delivery, most of whom were from underrepresented groups. For more info on Ocean FEST: http://oceanfest.soest.hawaii.edu/ Ocean TECH events have various formats, but common themes include: (1) Using technology as a hook to engage students in ocean, earth and environmental science. (2) Bringing middle school through community college students to college campuses, where they engage in hands-on science activities and learn about college majors. (3) Drawing direct links between the students' hands-on science activities and the research currently occurring at the UH Manoa's School of Ocean and Earth Science and Technology (SOEST), such as C-MORE and HOT research. (4) Respecting and valuing students' local knowledge and experiences. (5) Explicitly showing, through concrete examples, how becoming an ocean, earth or environmental scientist addresses would beneit Hawaii (6) Having graduate students from diverse backgrounds serve as instructors and

Overactivation of phospholipase C-gamma1 renders platelet-derived growth factor beta-receptor-expressing cells independent of the phosphatidylinositol 3-kinase pathway for chemotaxis

DEFF Research Database (Denmark)

Rönnstrand, L; Siegbahn, A; Rorsman, C

1999-01-01

., Siegbahn, A. , Rorsman, C., Engström, U., Wernstedt, C., Heldin, C.-H., and Rönnstrand, L. (1996) EMBO J. 15, 5299-5313). Here we show that the increased chemotaxis correlates with increased activation of phospholipase C-gamma1 (PLC-gamma1), measured as inositol-1,4, 5-trisphosphate release. By two......-dimensional phosphopeptide mapping, the increase in phosphorylation of PLC-gamma1 was shown not to be selective for any site, rather a general increase in phosphorylation of PLC-gamma1 was seen. Specific inhibitors of protein kinase C, bisindolylmaleimide (GF109203X), and phosphatidylinositol 3-kinase (PI3-kinase), LY294002......, did not affect the activation of PLC-gamma1. To assess whether increased activation of PLC-gamma1 is the cause of the hyperchemotactic behavior of the Y934F mutant cell line, we constructed cell lines expressing either wild-type or a catalytically compromised version of PLC-gamma1 under a tetracycline...

Concerning Support for SME’s as Suppliers of Public Health Tech Innovation

DEFF Research Database (Denmark)

Rolfstam, Max

be ameliorated by developing public procurement of innovation policies specifically targeting SME promotion. Research limitations/implications The analysis of the literature remains on aggregate levels. The included firms worked with health tech innovation. Originality/value Unlike many studies and policy...

Best new product development and management practices in Korean high-tech industry

NARCIS (Netherlands)

Song, X.M.; Noh, J.

2006-01-01

This paper investigates critical factors affecting the likelihood of new product success and effective new product development (NPD) models for Korean high-tech firms. Empirical results suggest that successful projects differ from unsuccessful projects in project environment, skills and resources,

GRAP, Gamma-Ray Level-Scheme Assignment

International Nuclear Information System (INIS)

Franklyn, C.B.

2002-01-01

1 - Description of program or function: An interactive program for allocating gamma-rays to an energy level scheme. Procedure allows for searching for new candidate levels of the form: 1) L1 + G(A) + G(B) = L2; 2) G(A) + G(B) = G(C); 3) G(A) + G(B) = C (C is a user defined number); 4) L1 + G(A) + G(B) + G(C) = L2. Procedure indicates intensity balance of feed and decay of each energy level. Provides for optimization of a level energy (and associated error). Overall procedure allows for pre-defining of certain gamma-rays as belonging to particular regions of the level scheme, for example, high energy transition levels, or due to beta- decay. 2 - Method of solution: Search for cases in which the energy difference between two energy levels is equal to a gamma-ray energy within user-defined limits. 3 - Restrictions on the complexity of the problem: Maximum number of gamma-rays: 999; Maximum gamma ray energy: 32000 units; Minimum gamma ray energy: 10 units; Maximum gamma-ray intensity: 32000 units; Minimum gamma-ray intensity: 0.001 units; Maximum number of levels: 255; Maximum level energy: 32000 units; Minimum level energy: 10 units; Maximum error on energy, intensity: 32 units; Minimum error on energy, intensity: 0.001 units; Maximum number of combinations: 6400 (ca); Maximum number of gamma-ray types : 127

Beta and Gamma Gradients

DEFF Research Database (Denmark)

Løvborg, Leif; Gaffney, C. F.; Clark, P. A.

1985-01-01

Experimental and/or theoretical estimates are presented concerning, (i) attenuation within the sample of beta and gamma radiation from the soil, (ii) the gamma dose within the sample due to its own radioactivity, and (iii) the soil gamma dose in the proximity of boundaries between regions...... of differing radioactivity. It is confirmed that removal of the outer 2 mm of sample is adequate to remove influence from soil beta dose and estimates are made of the error introduced by non-removal. Other evaluations include variation of the soil gamma dose near the ground surface and it appears...... that the present practice of avoiding samples above a depth of 0.3 m may be over-cautious...

Updates from the AmeriFlux Management Project Tech Team

Science.gov (United States)

Biraud, S.; Chan, S.; Dengel, S.; Polonik, P.; Hanson, C. V.; Billesbach, D. P.; Torn, M. S.

2017-12-01

The goal of AmeriFlux is to develop a network of long-term flux sites for quantifying and understanding the role of the terrestrial biosphere in global climate and environmental change. The AmeriFlux Management Program (AMP) Tech Team at LBNL strengthens the AmeriFlux Network by (1) standardizing operational practices, (2) developing calibration and maintenance routines, and (3) setting clear data quality goals. In this poster we will present results and recent progress in three areas: IRGA intercomparison experiment in cooperation with UC Davis, and main manufacturers of sensors used in the AmeriFlux network (LI-COR, Picarro, and Campbell Scientific). Gill sonic anemometers characterization in collaboration with John Frank and Bill Massman (US Forest Service) following the discovery of a significant firmware problem in commonly used Gill Sonic anemometer, Unmanned aerial systems (UAS), and sensors systematically used at AmeriFlux sites to improve site characterization.

Thermal enhancement cartridge heater modified (TECH Mod) tritium hydride bed development, Part 1 - Design and fabrication

Energy Technology Data Exchange (ETDEWEB)

Klein, J.E.; Estochen, E.G. [Savannah River National Laboratory, Aiken, SC (United States)

2015-03-15

The Savannah River Site (SRS) tritium facilities have used first generation (Gen1) LaNi{sub 4.25}Al{sub 0.75} (LANA0.75) metal hydride storage beds for tritium absorption, storage, and desorption. The Gen1 design utilizes hot and cold nitrogen supplies to thermally cycle these beds. Second and third generation (Gen2 and Gen3) storage bed designs include heat conducting foam and divider plates to spatially fix the hydride within the bed. For thermal cycling, the Gen2 and Gen3 beds utilize internal electric heaters and glovebox atmosphere flow over the bed inside the bed external jacket for cooling. The currently installed Gen1 beds require replacement due to tritium aging effects on the LANA0.75 material, and cannot be replaced with Gen2 or Gen3 beds due to different designs of these beds. At the end of service life, Gen1 bed desorption efficiencies are limited by the upper temperature of hot nitrogen supply. To increase end-of-life desorption efficiency, the Gen1 bed design was modified, and a Thermal Enhancement Cartridge Heater Modified (TECH Mod) bed was developed. Internal electric cartridge heaters in the new design to improve end-of-life desorption, and also permit in-bed tritium accountability (IBA) calibration measurements to be made without the use of process tritium. Additional enhancements implemented into the TECH Mod design are also discussed. (authors)

{gamma}-Fe phase plasma-induced on the surface of thin S3A alloy ribbons

Energy Technology Data Exchange (ETDEWEB)

Cabral-Prieto, A., E-mail: agustin.cabral@inin.gob.mx; Garcia-Sosa, I., E-mail: irma.garcia@inin.gob.mx [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica (Mexico); Nava, N., E-mail: tnava@imp.mx [Instituto Mexicano del Petroleo, Eje Central Lazaro Cardenas (Mexico); Camps, E., E-mail: enrique.camps@inin.gob.mx; Escobar, Luis, E-mail: luis.escobar@inin.gov.mx [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica (Mexico); Lopez-Castanarez, R., E-mail: rlc@anuies.mx; Olea-Cardoso, O., E-mail: olc@anuies.mx [Universidad Autonoma del Edo. de Mexico, Facultad de Quimica (Mexico)

2011-11-15

Amorphous alloy ribbons of Fe{sub 77}Cr{sub 2}B{sub 16}Si{sub 5} were exposed to cold plasmas of N{sub 2} and Ar-N{sub 2} at temperatures lower than T{sub x} = 808 K. The conversion X-ray Moessbauer spectra of the plasma-exposed ribbons consist of a singlet and a broadened magnetic sextet. The singlet with isomer shift {delta} = -0.11 mm/s can be assigned to {gamma}-Fe austenite phase. Minor bulk magnetic changes in the alloy were measured as a consequence of these treatments; e.g. the relative intensities A23 of the transmission Moessbauer spectra of the untreated and treated samples, were 3.22 and 3.56, respectively, the B{sub hf} values changed from 22.9 T (untreated sample) to 22.4 T (plasma treated samples). Unexpectedly, the {gamma}-Fe phase can also be produced by simply heating the alloy ribbons under N{sub 2} flux at temperatures as low as 423 K. Moessbauer data of the crystallized samples are also reported, and a qualitative assessment on the mechanical properties of the Fe{sub 77}Cr{sub 2}B{sub 16}Si{sub 5} alloy associated with the plasma and/or temperature surface induced {gamma}-Fe phase is given.

Impact of gender and personality traits (BFI-10) on tech savviness

DEFF Research Database (Denmark)

Pavlicek, Antonin; Sudzina, Frantisek; Malinova, Ludmila

2017-01-01

Nowadays, it is necessary to use technology in various everyday activities. A certain level of what used to be called high-tech savviness is needed to access almost all modern services. The aim of this paper is to analyze if gender and personality traits (Big Five Inventory-10) influence self...

Design of Demand Driven Return Supply Chain for High-Tech Products

NARCIS (Netherlands)

Ashayeri, J.; Tuzkaya, G.

2010-01-01

Many high-tech supply chain operate in a context of high process and market uncertainties due to shorter product life cycles. When introducing a new product, a company must manage the cost of supply, including the cost of returns over its short life cycle. The returns distribution looks like a

RADHEAT-V3, a code system for generating coupled neutron and gamma-ray group constants and analyzing radiation transport

International Nuclear Information System (INIS)

Koyama, Kinji; Taji, Yukichi; Miyasaka, Shun-ichi; Minami, Kazuyoshi.

1977-07-01

The modular code system RADHEAT is for producing coupled multigroup neutron and gamma-ray cross section sets, analyzing the neutron and gamma-ray transport, and calculating the energy deposition and atomic displacements due to these radiations in a nuclear reactor or shield. The basic neutron cross sections and secondary gamma-ray production data are taken from ENDF/B and POPOP4 libraries respectively. The system (1) generates multigroup neutron cross sections, energy deposition coefficients and atomic displacement factors due to neutron reactions, (2) generates multigroup gamma-ray cross sections and energy transfer coefficients, (3) generates secondary gamma-ray production cross sections, (4) combines these cross sections into the coupled set, (5) outputs and updates the multigroup cross section libraries in convenient formats for other transport codes, (6) analyzes the neutron and gamma-ray transport and calculates the energy deposition and the number density of atomic displacements in a medium, (7) collapses the cross sections to a broad-group structure, by option, using the weighting functions obtained by one-dimensional transport calculation, and (8) plots, by option, multigroup cross sections, and neutron and gamma-ray distributions. Definitions of the input data required in various options of the code system are also given. (auth.)

The Risk Evaluation of Agricultural High-tech Investment Project%农业高新技术投资项目风险评价

Institute of Scientific and Technical Information of China (English)

陆迁; 苗姗姗

2005-01-01

The agricultural high-tech investment project (AHIP) is characterized by technology-intensive, high risk and great profit. This article analyzes essential factors of the risks of the agricultural high-tech investment projects and the traditional risk evaluation method of agricultural projects. We think that the applications of the sensitivity analysis and probability are defective. Therefore, this article introduces a structural model to evaluate the risks of the agricultural high-tech investment projects and the system of the concrete evaluation indexes.

High-tech Entrepreneurship and Growth: Myths and Facts

DEFF Research Database (Denmark)

Neergaard, Helle; Madsen, Henning; Ulhøi, John Parm

2004-01-01

Economic growth depends on the presence of an innovative and dynamic business sector, including the business players' ability to discover and exploit new business opportunities. Consequently, entrepreneurship has received increased attention within industrial policy. Entrepreneurs and their motives...... are, however, just as diverse as the rest of the population, thus making it impossible to apply a 'one-size-fits-all' principle when promoting entrepreneurship. This paper deals with a special kind of entrepreneurs - the high-tech entrepreneurs - in order to puncture the myths concerning their growth...

Neutron detection gamma ray sensitivity criteria

International Nuclear Information System (INIS)

Kouzes, Richard T.; Ely, James H.; Lintereur, Azaree T.; Mace, Emily K.; Stephens, Daniel L.; Woodring, Mitchell L.

2011-01-01

The shortage of 3 He has triggered the search for effective alternative neutron detection technologies for national security and safeguards applications. Any new detection technology must satisfy two basic criteria: (1) it must meet a neutron detection efficiency requirement, and (2) it must be insensitive to gamma-ray interference at a prescribed level, while still meeting the neutron detection requirement. It is the purpose of this paper to define measureable gamma ray sensitivity criteria for neutron detectors. Quantitative requirements are specified for: intrinsic gamma ray detection efficiency and gamma ray absolute rejection. The gamma absolute rejection ratio for neutrons (GARRn) is defined, and it is proposed that the requirement for neutron detection be 0.9 3 He based neutron detector is provided showing that this technology can meet the stated requirements. Results from tests of some alternative technologies are also reported.

gamma. -ray. Present status and problems

Energy Technology Data Exchange (ETDEWEB)

Okudaira, K [Rikkyo Univ., Tokyo (Japan). Faculty of Science

1975-01-01

As ..gamma..-ray advances straightly through space, the study on cosmic ..gamma..-ray will give the information concerning the origin directly. However, the intensity is weak, and the avoidance of background is a serious problem. The wide-spread components were studied by OSO-3. The intensity of the galactic disc component around 100 MeV was reported as (3.4+-1.0)x10/sup -5/ photons (cm/sup 2/, radian, sec)/sup -1/ by OSO-3 and 0.2x10/sup -4/ photons (cm/sup 2/, radian sec)/sup -1/ by SAS-2, and corresponds to the calculated ..gamma.. yield from ..pi../sup 0/. The strong disc component, so-called galactic center region, has been observed, and is due to the mixture of ..gamma..-ray from ..pi../sup 0/ and inverse Compton ..gamma..-ray. A peak at 476+-24 KeV was found as well as the continuous component. Special care must be taken for the observation of isotropic component, since it is hardly distinguished from the background. It is considered that the isotropic component is due to the inverse Compton scattering of 3/sup 0/K radiation in super-galactic space and the contribution from outer galaxy. The nearest point source of ..gamma..-ray is the sun. Among the other point sources, the crab nebula is the most reliable one. The energy flux of pulse component showed the spectrum of E/sup -1/. ..gamma..-ray bursts were observed by man-made satellites Vela-5 and 6. Theoretical explanation is still incomplete regarding the bursts. (Kato, T.).

Search for neutrinoless {tau} decays: {tau}{r_arrow}e{gamma} and {tau}{r_arrow}{mu}{gamma}

Energy Technology Data Exchange (ETDEWEB)

Edwards, K.W. [Carleton University, Ottawa, Ontario, K1S 5B6 (CANADA); Bellerive, A.; Janicek, R.; MacFarlane, D.B.; McLean, K.W.; Patel, P.M. [McGill University, Montreal, Quebec, H3A 2T8 (CANADA); Sadoff, A.J. [Ithaca College, Ithaca, New York 14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Hancock, N.; Kotov, S.; Kravchenko, I.; Kwak, N. [University of Kansas, Lawrence, Kansas 66045 (United States); Anderson, S.; Kubota, Y.; Lattery, M.; ONeill, J.J.; Patton, S.; Poling, R.; Riehle, T.; Savinov, V.; Smith, A. [University of Minnesota, Minneapolis, Minnesota 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Severini, H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York 12222 (United States); Anastassov, A.; Blinov, S.; Duboscq, J.E.; Fujino, D.; Fulton, R.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Spencer, M.B.; Sung, M.; Undrus, A.; Wanke, R.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio 43210 (United States); Nemati, B.; Richichi, S.J.; Ross, W.R.; Skubic, P.; Wood, M. [University of Oklahoma, Norman, Oklahoma 73019 (United States); Bishai, M.; Fast, J.; Gerndt, E.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana 47907 (United States); Gibbons, L.; Johnson, S.D.; Kwon, Y.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Schaffner, S.F.; Ugolini, D.; Wang, R.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas 75275 (United States); Artuso, M.; Efimov, A.; Frasconi, F.; Gao, M.

1997-04-01

A search for the lepton-family-number-violating decays {tau}{r_arrow}e{gamma} and {tau}{r_arrow}{mu}{gamma} has been performed using CLEO II data. No evidence of a signal has been found and the corresponding upper limits are B({tau}{r_arrow}e{gamma}){lt}2.7{times}10{sup {minus}6} and B({tau}{r_arrow}{mu}{gamma}){lt}3.0{times}10{sup {minus}6} at 90{percent} C.L. {copyright} {ital 1997} {ital The American Physical Society}

GammaSem Proceedings - A Nordic seminar for users of gamma spectrometry

International Nuclear Information System (INIS)

Nunez, P.; Klemola, S.; Nielsen, Sven P.; Palsson, S.E.; Israelson, C.

2010-03-01

The project GammaSem was proposed to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and to establish a network of users of gamma spectrometry in the Nordic countries, thereby strengthening the collaboration and improving all participants' competence in practical gamma spectrometry. The seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 75 people participated; representing 34 different universities, commercial companies, research institutes and also all Nordic authorities. During the seminar several key issues for follow-up were identified and working groups for addressing the identified problems were established. The working groups were: 1) Uncertainties and detections of limits 2) True summing coincidence 3) Monte Carlo simulations and efficiency transfer 4) Absorption (density corrections and geometries) 5) Mobile gamma spectrometry systems 6) Nuclear forensics (on special samples and special parts of the spectra). The identified topics will form the basis for the agenda of the next seminar in 2010. There, the different working groups will be invited to present their ideas/solutions to the relevant problems. (author)

GammaSem Proceedings - A Nordic seminar for users of gamma spectrometry

Energy Technology Data Exchange (ETDEWEB)

Nunez, P. (ed.) (Institute for Energy Technology (IFE) (Norway)); Klemola, S. (Radiation and Nuclear Safety Authority (STUK) (Finland)); Nielsen, Sven P. (Technical Univ. of Denmark, Risoe National Lab. for Sustainable Energy. Roskilde (Denmark)); Palsson, S.E. (Icelandic Radiation Safety Authority (IS)); Israelson, C. (National Institute of Radiation Protection (Denmark))

2010-03-15

The project GammaSem was proposed to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and to establish a network of users of gamma spectrometry in the Nordic countries, thereby strengthening the collaboration and improving all participants' competence in practical gamma spectrometry. The seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 75 people participated; representing 34 different universities, commercial companies, research institutes and also all Nordic authorities. During the seminar several key issues for follow-up were identified and working groups for addressing the identified problems were established. The working groups were: 1) Uncertainties and detections of limits 2) True summing coincidence 3) Monte Carlo simulations and efficiency transfer 4) Absorption (density corrections and geometries) 5) Mobile gamma spectrometry systems 6) Nuclear forensics (on special samples and special parts of the spectra). The identified topics will form the basis for the agenda of the next seminar in 2010. There, the different working groups will be invited to present their ideas/solutions to the relevant problems. (author)

FUNDAMENTALIZATION OF ICT LEARNING IN MODERN HIGH TECH ENVIRONMENT

Directory of Open Access Journals (Sweden)

M. P. Shyshkina

2013-03-01

Full Text Available The article outlines the features of the process of fundamentalization of ICT learning, educational background to ensure it in high school. The concept of fundamental knowledge and its role in training of a specialist is described. The problems of access to qualitative education, particularly to electronic learning resources in modern high-tech environment are revealed. The role of computer mathematics as a tool of ICT learning fundamentalization is emphasized.

Dicty_cDB: VHJ560 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Translated Amino Acid sequen...eiiryisqnivkrckdd dmvkegfveatqnckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Frame C: tivilqtynflkcl*

Synergistic Effects of Squalene and Omega-3 on Lipid Peroxidation and some Antioxidants in Gamma-Irradiated Male Albino Rats

International Nuclear Information System (INIS)

Ahmed, A. G.; Abdel-Magied, N.

2011-01-01

The present study aims to investigate the synergistic effects of squalene and omega-3 as an antioxidant in protection against oxidative stress which induced by gamma- irradiated in male albino rats. The experimental animals, male albino rats (n=48) weighing (120-150 g) were divided into 4 groups: control, gamma irradiated with a single dose of 6 Gy, oral administration with 0.4 ml/kg b. wt from squalene and omega-3 for 30 days and oral administration with 0.4 ml/kg b. wt from squalene and omega-3 for 30 days and irradiated with a single dose level (6 Gy). Animals were sacrificed on the 3rd and 7th day post irradiation. Biochemical analysis was carried out on blood glutathione content (GSH), superoxide dismutase activity (SOD), catalase activity (CAT) and lipid peroxidation (MDA). Also lipid profile: plasma total cholesterol (TC), triglycerides (TG), LDL-cholesterol (LDL-C) and HDL-cholesterol (HDL-C) were assayed. Exposure to gamma radiation at dose level 6 Gy elevated significantly lipid peroxidation (MDA) and decline in level of blood glutathione content (GSH), superoxide dismutase activity (SOD), and catalase activity (CAT) also, a significant increase in plasma total cholesterol (TC), triglycerides (TG), LDL-cholesterol (LDL-C) and decrease in HDL-cholesterol (HDL-C). Combined supplementation of squalene and omega-3 significantly prevented the elevation of (MDA) and decline in antioxidant parameters after radiation and ameliorates plasma lipid profile. The results indicated that the combination of aqualene and omega-3 has a protective role, antioxidant effect and antilipidemic effect against gamma radiation in exposed rats

Characterisation of a tertiary mixture of {alpha}-Fe{sub 2}O{sub 3}, {gamma}-Fe{sub 2}O{sub 3} and Fe{sub 3}O{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Srinivasan, M.P.; Narasimhan, S.V. [Water and Steam Chemistry Laboratory (Chemistry Group, BARC) BARC Facilities, Kalpakkam, Tamil Nadu 603 102. (India)

1998-12-31

A method has been developed to quantify the individual components of a ternary mixture containing {alpha}-Fe{sub 2}O{sub 3}, {gamma}- Fe{sub 2}O{sub 3} and Fe{sub 3}O{sub 4} based on the preferential dissolution of the components at a fixed time (fixed time - depending on the strength of the chelating agent) in a dilute chemical formulation (containing a chelant and an organic acid) both in presence and absence of reductant. A ternary component diagram was constructed based on the percentage dissolution of the individual components in 2,6-Pyridine dicarboxylic acid (PDCA), Nitrilo triacetic acid (NTA) and EDTA based formulation at 60degC both in presence and absence of reductant. In these formulations, the observed behaviour that the {alpha}-Fe{sub 2}O{sub 3} dissolved very little both in presence and absence of reductant and {gamma}-Fe{sub 2}O{sub 3} dissolved very little in absence of reductant were used for resolving the ternary physical mixture composition. Physical mixtures of Fe{sub 3}O{sub 4}, {alpha}-Fe{sub 2}O{sub 3} and {gamma}-Fe{sub 2}O{sub 3} based on mole ratio were taken such that the total quantity of Fe present would be 1.37 mM for complete dissolution. In presence and absence of reductant, dissolution percentage of Fe observed at fixed time in these formulations, when fit into the already constructed three component phase diagram for each formulation at the same fixed duration, the experimentally resolved composition showed good agreement with that based on individual components. This method is useful to resolve different polymorphs of metal oxides having the metal ions in single and/or multiple oxidation states. (author)

Virginia Tech announces AdvanceVT awards seed grants; names leadership fellows

OpenAIRE

Cox, Clara B.

2004-01-01

AdvanceVT, a comprehensive program that promotes and enhances the careers of women in science and engineering at Virginia Tech, has awarded its first seed grants and named its first leadership fellows as part of an ongoing effort to increase the number of women electing to pursue or remain in academic careers.

High temperature oxidation behavior of gamma-nickel+gamma'-nickel aluminum alloys and coatings modified with platinum and reactive elements

Science.gov (United States)

Mu, Nan

Materials for high-pressure turbine blades must be able to operate in the high-temperature gases (above 1000°C) emerging from the combustion chamber. Accordingly, the development of nickel-based superalloys has been constantly motivated by the need to have improved engine efficiency, reliability and service lifetime under the harsh conditions imposed by the turbine environment. However, the melting point of nickel (1455°C) provides a natural ceiling for the temperature capability of nickel-based superalloys. Thus, surface-engineered turbine components with modified diffusion coatings and overlay coatings are used. Theses coatings are capable of forming a compact and adherent oxide scale, which greatly impedes the further transport of reactants between the high-temperature gases and the underlying metal and thus reducing attack by the atmosphere. Typically, these coatings contain beta-NiAl as a principal constituent phase in order to have sufficient aluminum content to form an Al2O3 scale at elevated temperatures. The drawbacks to the currently-used beta-based coatings, such as phase instabilities, associated stresses induced by such phase instabilities, and extensive coating/substrate interdiffusion, are major motivations in this study to seek next-generation coatings. The high-temperature oxidation resistance of novel Pt+Hf-modified gamma-Ni+gamma'-Ni 3Al-based alloys and coatings were investigated in this study. Both early-stage and 4-days isothermal oxidation behavior of single-phase gamma-Ni and gamma'-Ni3Al alloys were assessed by examining the weight changes, oxide-scale structures, and elemental concentration profiles through the scales and subsurface alloy regions. It was found that Pt promotes Al 2O3 formation by suppressing the NiO growth on both gamma-Ni and gamma'-Ni3Al single-phase alloys. This effect increases with increasing Pt content. Moreover, Pt exhibits this effect even at lower temperatures (˜970°C) in the very early stage of oxidation. It

Analysis of Gafchromic EBT3 film calibration irradiated with gamma rays from different systems: Gamma Knife and Cobalt-60 unit.

Science.gov (United States)

Najafi, Mohsen; Geraily, Ghazale; Shirazi, Alireza; Esfahani, Mahbod; Teimouri, Javad

2017-01-01

In recent years, Gafchromic films are used as an advanced instrument for dosimetry systems. The EBT3 films are a new generation of Gafchromic films. Our main interest is to compare the response of the EBT3 films exposed to gamma rays provided by the Theratron 780C as a conventional radiotherapy system and the Leksell Gamma Knife as a stereotactic radiotherapy system (SRS). Both systems use Cobalt-60 sources, thus using the same energy. However, other factors such as source-to-axis distance, number of sources, dose rate, direction of irradiation, shape of phantom, the field shape of radiation, and different scatter contribution may influence the calibration curve. Calibration curves for the 2 systems were measured and plotted for doses ranging from 0 to 40 Gy at the red and green channels. The best fitting curve was obtained with the Levenberg-Marquardt algorithm. Also, the component of dose uncertainty was obtained for any calibration curve. With the best fitting curve for the EBT3 films, we can use the calibration curve to measure the absolute dose in radiation therapy. Although there is a small deviation between the 2 curves, the p-value at any channel shows no significant difference between the 2 calibration curves. Therefore, the calibration curve for each system can be the same because of minor differences. The results show that with the best fitting curve from measured data, while considering the measurement uncertainties related to them, the EBT3 calibration curve can be used to measure the unknown dose both in SRS and in conventional radiotherapy. Copyright © 2017. Published by Elsevier Inc.

A multi-disciplinary and model-based design methodology for high-tech systems

NARCIS (Netherlands)

Heemels, W.P.M.H.; Waal, van de E.; Muller, G.J.

2006-01-01

System architecting for high-tech machines is currently performed by highly experienced individuals, who often use an intuitive approach to their craft. In order to allow better cooperation, and to enable the dissemination of experience and knowledge, a framework is needed in which the methods,

Measurement of B(psi -> gamma chi(c1)) and search for psi -> gamma chi(c2)

NARCIS (Netherlands)

Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Liao, J. B.; Liao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Komicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiging; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thomdike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zheruchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

2015-01-01

We report a measurement of the branching fraction for psi(3770) -> gamma chi(c1) and search for the transition psi(3770) -> gamma chi(c2) based on 2.92 fb(-1) of e(+)e(-) data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. We measure B(psi(3770) -> gamma chi(c1))

AegeanMarTech project: General Introduction

Science.gov (United States)

Psarra, S.; Zervakis, V.; Karageorgis, A. P.

2017-10-01

This issue of "Continental Shelf Research" is dedicated to the study of processes potentially responsible for the relatively high productivity of the North Aegean Sea in comparison to other regions of the Eastern Mediterranean. This region, one of the most important fishing grounds in the eastern Mediterranean, is characterized by: i) the inflow of mesotrophic waters of Black Sea (BSW) origin into the North Aegean and their interaction with the more saline Levantine waters (LW); and ii) the wind-generated coastal upwelling occurring every summer in the eastern Aegean. The study of these two natural fertilization mechanisms has been the major aim of the AegeanMarTech project ("Technological and oceanographic cooperation Network for the Study of mechanisms fertilizing the North-East Aegean Sea").

Recombining Plasma and Gamma-Ray Emission in the Mixed-morphology Supernova Remnant 3C 400.2

Energy Technology Data Exchange (ETDEWEB)

Ergin, T. [TUBITAK Space Technologies Research Institute, ODTU Campus, 06800, Ankara (Turkey); Sezer, A. [Department of Electrical-Electronics Engineering, Avrasya University, 61250 Trabzon (Turkey); Sano, H.; Fukui, Y. [Department of Physics, Nagoya University, Chikusa-ku, Nagoya, Aichi 464–8601 (Japan); Yamazaki, R., E-mail: ergin.tulun@gmail.com, E-mail: aytap.sezer@avrasya.edu.tr, E-mail: sano@a.phys.nagoya-u.ac.jp [Department of Physics and Mathematics, Aoyama Gakuin University, 5-10-1 Fuchinobe, Sagamihara 252–5258 (Japan)

2017-06-10

3C 400.2 belongs to the mixed-morphology supernova remnant class, showing center-filled X-ray and shell-like radio morphology. We present a study of 3C 400.2 with archival Suzaku and Fermi -LAT observations. We find recombining plasma (RP) in the Suzaku spectra of north–east and south–east regions. The spectra of these regions are well described by two-component thermal plasma models: the hard component is in RP, while the soft component is in collisional ionization equilibrium (CIE) conditions. The RP has enhanced abundances, indicating that the X-ray emission has an ejecta origin, while the CIE has solar abundances associated with the interstellar material. The X-ray spectra of north–west and south–west regions are best fitted by a two-component thermal plasma model: an ionizing and a CIE plasma. We have detected GeV gamma-ray emission from 3C 400.2 at the level of ∼5 σ , assuming a point-like source model with a power-law (PL) type spectrum. We have also detected a new GeV source at the level of ∼13 σ, assuming a Gaussian extension model with a PL-type spectrum in the neighborhood of the supernova remnant. We report the analysis results of 3C 400.2 and the new extended gamma-ray source, and discuss the nature of gamma-ray emission of 3C 400.2 in the context of existing NANTEN CO data, Dominion Radio Astrophysical Observatory H i data, and the Suzaku X-ray analysis results.

The p110beta isoform of phosphoinositide 3-kinase signals downstream of G protein-coupled receptors and is functionally redundant with p110gamma.

Science.gov (United States)

Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart

2008-06-17

The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.

Clinical results of Hi-tech Knee II total knee arthroplasty in patients with rheumatoid athritis: 5- to 12-year follow-up

Directory of Open Access Journals (Sweden)

Yamanaka Hajime

2012-02-01

Full Text Available Abstract Background Total knee arthroplasty (TKA is a common form of treatment to relieve pain and improve function in cases of rheumatoid arthritis (RA. Good clinical outcomes have been reported with a variety of TKA prostheses. The cementless Hi-Tech Knee II cruciate-retaining (CR-type prosthesis, which has 6 fins at the anterior of the femoral component, posterior cruciate ligament (PCL retention, flat-on-flat surface component geometry, all-polyethylene patella, strong initial fixation by the center screw of the tibial base plate, 10 layers of titanium alloy fiber mesh, and direct compression molded ultra high molecular weight polyethylene (UHMWPE, is appropriate for TKA in the Japanese knee. The present study was performed to evaluate the clinical results of primary TKA in RA using the cementless Hi-Tech Knee II CR-type prosthesis. Materials and methods We performed 32 consecutive primary TKAs using cementless Hi-Tech Knee II CR-type prosthesis in 31 RA patients. The average follow-up period was 8 years 3 months. Clinical evaluations were performed according to the American Knee Society (KS system, knee score, function score, radiographic evaluation, and complications. Results The mean postoperative maximum flexion angle was 115.6°, and the KS knee score and function score improved to 88 and 70 after surgery, respectively. Complications, such as infection, occurred in 1 patient and revision surgery was performed. There were no cases of loosening in this cohort, and prosthesis survival rate was 96.9% at 12 years postoperatively. Conclusion These results suggest that TKA using the cementless Hi-Tech Knee II CR-type prosthesis is a very effective form of treatment in RA patients at 5 to 12 years postoperatively. Further long-term follow-up studies are required to determine the ultimate utility of this type of prosthesis.

Low Tech Hacking Street Smarts for Security Professionals

CERN Document Server

Wiles, Jack; Jabbusch, Jennifer; Rogers, Russ; Lowther, Sean

2011-01-01

Criminals using hacking techniques can cost corporations, governments, and individuals millions of dollars each year. While the media focuses on the grand-scale attacks that have been planned for months and executed by teams and countries, there are thousands more that aren't broadcast. Low Tech Hacking focuses on the everyday hacks that, while simple in nature, actually add up to the most significant losses. Attackers are using common techniques like social engineering, wireless hacking, and targeting and surveillance to gain access to valuable data. This book contains detailed descriptions

Rolls-Royce's decision to build manufacturing plant will impact Virginia Tech

OpenAIRE

Nystrom, Lynn A.

2007-01-01

Virginia Tech's College of Engineering will receive three endowed chairs, $2 million in support from the state of Virginia for laboratory renovations, some graduate fellowships, and resources for specific international program efforts, as a result of plans by British-based Rolls-Royce to build a new jet engine manufacturing plant in Prince George County.

Racial and Mental Illness Stereotypes and Discrimination: An Identity-Based Analysis of the Virginia Tech and Columbine Shootings

OpenAIRE

Chen, Charlene Y.; Purdie-Vaughns, Valerie; Phelan, Jo C.; Yu, Gary; Yang, Lawrence H.

2014-01-01

The Virginia Tech and Columbine High shootings are 2 of the deadliest school massacres in the United States. The present study investigates in a nationally representative sample how White Americans’ causal attributions of these shooting moderate their attitudes toward the shooter’s race. White Americans shown a vignette based on the Virginia Tech shooting were more likely to espouse negative beliefs about Korean American men and distance themselves from this group the more they believed that ...

Genomic sequences of murine gamma B- and gamma C-crystallin-encoding genes: promoter analysis and complete evolutionary pattern of mouse, rat and human gamma-crystallins.

Science.gov (United States)

Graw, J; Liebstein, A; Pietrowski, D; Schmitt-John, T; Werner, T

1993-12-22

The murine genes, gamma B-cry and gamma C-cry, encoding the gamma B- and gamma C-crystallins, were isolated from a genomic DNA library. The complete nucleotide (nt) sequences of both genes were determined from 661 and 711 bp, respectively, upstream from the first exon to the corresponding polyadenylation sites, comprising more than 2650 and 2890 bp, respectively. The new sequences were compared to the partial cDNA sequences available for the murine gamma B-cry and gamma C-cry, as well as to the corresponding genomic sequences from rat and man, at both the nt and predicted amino acid (aa) sequence levels. In the gamma B-cry promoter region, a canonical CCAAT-box, a TATA-box, putative NF-I and C/EBP sites were detected. An R-repeat is inserted 366 bp upstream from the transcription start point. In contrast, the gamma C-cry promoter does not contain a CCAAT-box, but some other putative binding sites for transcription factors (AP-2, UBP-1, LBP-1) were located by computer analysis. The promoter regions of all six gamma-cry from mouse, rat and human, except human psi gamma F-cry, were analyzed for common sequence elements. A complex sequence element of about 70-80 bp was found in the proximal promoter, which contains a gamma-cry-specific and almost invariant sequence (crygpel) of 14 nt, and ends with the also invariant TATA-box. Within the complex sequence element, a minimum of three further features specific for the gamma A-, gamma B- and gamma D/E/F-cry genes can be defined, at least two of which were recently shown to be functional. In addition to these four sequence elements, a subtype-specific structure of inverted repeats with different-sized spacers can be deduced from the multiple sequence alignment. A phylogenetic analysis based on the promoter region, as well as the complete exon 3 of all gamma-cry from mouse, rat and man, suggests separation of only five gamma-cry subtypes (gamma A-, gamma B-, gamma C-, gamma D- and gamma E/F-cry) prior to species separation.

Review of the Czubek--Jonas gamma-log program

International Nuclear Information System (INIS)

Matthews, M.

1978-11-01

Several gamma-ray logs were computer processed using the Czubek--Jones and DOE's MDDAT gamma-log programs. Both of these programs convert counts per second from the gamma-ray logs to percent eU 3 O 8 . The results of these programs were compared to each other and to the core analysis (percent U 3 O 8 ) of the logged boreholes. The two gamma-log programs produced similar results. The core analysis did not compare favorably with the results of either gamma-log program. This unfavorable comparison is probably due to an incorrect assumption of secular equilibrium for the ore surrounding the boreholes. The Czubek--Jonas program requires a knowledge of the linear attenuation coefficient of the rocks surrounding a borehole. This limits the usefulness of the program because this coefficient is generally not known and varies for different gamma-ray energies. It is recommended that the MDDAT program continue to be used for estimating the grade (percent eU 3 O 8 ) from gamma-log data and not be replaced by the Czubek--Jonas program