
Sample records for platensis gom geitl

  1. Automating CPM-GOMS (United States)

    John, Bonnie; Vera, Alonso; Matessa, Michael; Freed, Michael; Remington, Roger


    CPM-GOMS is a modeling method that combines the task decomposition of a GOMS analysis with a model of human resource usage at the level of cognitive, perceptual, and motor operations. CPM-GOMS models have made accurate predictions about skilled user behavior in routine tasks, but developing such models is tedious and error-prone. We describe a process for automatically generating CPM-GOMS models from a hierarchical task decomposition expressed in a cognitive modeling tool called Apex. Resource scheduling in Apex automates the difficult task of interleaving the cognitive, perceptual, and motor resources underlying common task operators (e.g. mouse move-and-click). Apex's UI automatically generates PERT charts, which allow modelers to visualize a model's complex parallel behavior. Because interleaving and visualization is now automated, it is feasible to construct arbitrarily long sequences of behavior. To demonstrate the process, we present a model of automated teller interactions in Apex and discuss implications for user modeling. available to model human users, the Goals, Operators, Methods, and Selection (GOMS) method [6, 21] has been the most widely used, providing accurate, often zero-parameter, predictions of the routine performance of skilled users in a wide range of procedural tasks [6, 13, 15, 27, 28]. GOMS is meant to model routine behavior. The user is assumed to have methods that apply sequences of operators and to achieve a goal. Selection rules are applied when there is more than one method to achieve a goal. Many routine tasks lend themselves well to such decomposition. Decomposition produces a representation of the task as a set of nested goal states that include an initial state and a final state. The iterative decomposition into goals and nested subgoals can terminate in primitives of any desired granularity, the choice of level of detail dependent on the predictions required. Although GOMS has proven useful in HCI, tools to support the

  2. Response of Spirulina Platensis to Sulfamethazine Contamination (United States)

    Xu, Xiankuan; Lu, Xiaohong; Ma, Xiangjuan; Xia, Huilong


    The interaction between a positive important biological energy source algae Spirulina platensis and an antimicrobial drug sulfamethazine was studied by a panel of bioassays. The result demonstrated that the acute toxicity of sulfadimidine on Spirulina platensis gradually increased with the increasing of the concentration of sulfadimidine. During the exposure, the toxicity of sulfamethazine on Spirulina platensis enlarged at first and reduced thereafter, and the summit was at 48 h, showing a typical “bell” curve. The EC50 in 48 h was 6.06 mg/L. Spirulina platensis was able to accumulate and degrade sulfamethazine simultaneously. The amounts of sulfamethazine accumulated and degraded by Spirulina platensis were 1.40 mg/kg and 0.64 mg/kg (dry weight) at 24 h, respectively. After 96 h of exposure, the accumulation decreased to 0.47 mg/kg, however, the degradation of sulfamethazine increased to 6.57 mg/kg. Due to biological activity, the removal rate of sulfamethazine was 5.2 times in the nutrient solution with Spirulina platensis as that of without Spirulina platensis. The results of this study implied that Spirulina platensis had a potential to remove sulfamethazine in the sulfamethazine contaminated aquatic ecosystems.

  3. Using Apex To Construct CPM-GOMS Models (United States)

    John, Bonnie; Vera, Alonso; Matessa, Michael; Freed, Michael; Remington, Roger


    process for automatically generating computational models of human/computer interactions as well as graphical and textual representations of the models has been built on the conceptual foundation of a method known in the art as CPM-GOMS. This method is so named because it combines (1) the task decomposition of analysis according to an underlying method known in the art as the goals, operators, methods, and selection (GOMS) method with (2) a model of human resource usage at the level of cognitive, perceptual, and motor (CPM) operations. CPM-GOMS models have made accurate predictions about behaviors of skilled computer users in routine tasks, but heretofore, such models have been generated in a tedious, error-prone manual process. In the present process, CPM-GOMS models are generated automatically from a hierarchical task decomposition expressed by use of a computer program, known as Apex, designed previously to be used to model human behavior in complex, dynamic tasks. An inherent capability of Apex for scheduling of resources automates the difficult task of interleaving the cognitive, perceptual, and motor resources that underlie common task operators (e.g., move and click mouse). The user interface of Apex automatically generates Program Evaluation Review Technique (PERT) charts, which enable modelers to visualize the complex parallel behavior represented by a model. Because interleaving and the generation of displays to aid visualization are automated, it is now feasible to construct arbitrarily long sequences of behaviors. The process was tested by using Apex to create a CPM-GOMS model of a relatively simple human/computer-interaction task and comparing the time predictions of the model and measurements of the times taken by human users in performing the various steps of the task. The task was to withdraw $80 in cash from an automated teller machine (ATM). For the test, a Visual Basic mockup of an ATM was created, with a provision for input from (and measurement

  4. Effect of Spirulina platensis powder on metabolic syndrome in ...

    African Journals Online (AJOL)

    S. platensis inhibits also hemolysis of erythrocytes induced by AAPH. In conclusion, S. platensis powder prevent metabolic syndrome induced by high fructose and fat diet. These results justify the use of the plant in the treatment of diabetes in Benin. Keywords: Spirulina platensis, metabolic syndrome, fructose, diabetes, ...

  5. A GOMS model applied to a simplified control panel design

    International Nuclear Information System (INIS)

    Chavez, C.; Edwards, R.M.


    The design of the user interface for a new system requires many decisions to be considered. To develop sensitivity to user needs requires understanding user behavior. The how-to-do-it knowledge is a mixture of task-related and interface-related components. A conscientious analysis of these components, allows the designer to construct a model in terms of goals, operators, methods, and selection (GOMS model) rules that can be advantageously used in the design process and evaluation of a user interface. The emphasis of the present work is on describing the importance and use of a GOMS model as a formal user interface analysis tool in the development of a simplified panel for the control of a nuclear power plant. At Pennsylvania State University, a highly automated control system with a greatly simplified human interface has been proposed to improve power plant safety. Supervisory control is to be conducted with a simplified control panel with the following functions: startup, shutdown, increase power, decrease power, reset, and scram. Initial programming of the operator interface has been initiated within the framework of a U.S. Department of Energy funded university project for intelligent distributed control. A hypothesis to be tested is that this scheme can be also used to estimate mental work load content and predict human performance

  6. Offshore Minerals Management Platforms for the Gulf of Mexico (GOM), Geographic NAD83, MMS (2006) [platforms_mms_2006 (United States)

    Louisiana Geographic Information Center — Offshore Minerals Management Platforms for the Gulf of Mexico (GOM). Identifies the location of platforms in GOM. All platforms existing in the database are included.

  7. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria

    African Journals Online (AJOL)



    May 13, 2015 ... Key words: Spirulina platensis, nutritional, quality, proteins, fatty acids. ... advantages make S. platensis a good raw material for the healthy food (Anitha and ... The fat content is determined by the Soxhlet extraction method by using .... human milk and some expensive vegetable oils according to Pierlovisi ...

  8. Effect of feeding duration of Spirulina platensis on growth ...

    African Journals Online (AJOL)

    Spirulina platensis is a good candidate as an in-feed antibiotics substitute for broilers. However, its use seems impractical owing to its high price, especially when being administered throughout the whole rearing period. This study aimed to investigate the effects of feeding duration of S. platensis on growth, haematological ...

  9. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria ...

    African Journals Online (AJOL)

    Spirulina platensis, a blue green microalga, has been used since ancient times as a source of food because of its high protein content (65%) and nutritional value. Lipids isolated from S. platensis have been shown to contain high levels of polyunsaturated fatty acids, including linolenic acid which is a precursor of ...

  10. Isolation, characterization and localization of extracellular polymeric substances from the cyanobacterium Arthrospira platensis strain MMG-9

    NARCIS (Netherlands)

    Ahmed, M.; Moerdijk-Poortvliet, T.C.W.; Wijnholds, A.; Stal, L.J.; Hasnain, S.


    Arthrospira platensis is a cyanobacterium known for its nutritional value and secondary metabolites. Extracellular polymeric substances (EPS) are an important trait of most cyanobacteria, including A. platensis. Here, we extracted and analysed different fractions of EPS from a locally isolated

  11. Effect of microalga Spirulina platensis (Arthrospira platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Telma Elita Bertolin


    Full Text Available Studies have been conducted on microalga Spirulina platensis (Arthrospira platensis due to its therapeutic potential in several areas, including the capacity for preventing and decreasing the damages caused by hyperlipidemia and the antioxidant activity. The aim of the study was to evaluate the effect of microalga Spirulina platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia during 60 days. The measurement of hippocampus lipoperoxidation did not demonstrate significant difference (p>0.05 when Spirulina platensis was added to hypercholesterolemic diet. The evaluation of lipid profile showed that the administration of the microalga in therapeutic and preventive ways led to a significant protective effect (pA microalga Spirulina platensis (Arthrospira platensis vem sendo fonte de pesquisas devido a evidências de seu potencial terapêutico em diversas áreas, dentre elas a capacidade de prevenção e diminuição dos danos causados por dislipidemias e sua atividade antioxidante. Objetivou-se avaliar o efeito da microalga Spirulina platensis sobre a lipoperoxidação no hipocampo e perfil lipídico sérico em ratos com hipercolesterolemia induzida durante 60 dias. A dosagem da lipoperoxidação no hipocampo não demonstrou diferença significativa (p>0,05 quando Spirulina platensis foi adicionada na dieta hipercolêsterolemica. A avaliação do perfil lipídico demonstrou que a administração da microlaga de forma terapêutica e preventiva demonstrou efeito significativo (p<0,05 na proteção do desenvolvimento de hipercolesterolemia.

  12. Using GOMS and NASA-TLX to Evaluate Human-Computer Interaction Process in Interactive Segmentation

    NARCIS (Netherlands)

    Ramkumar, A.; Stappers, P.J.; Niessen, W.J.; Adebahr, S; Schimek-Jasch, T; Nestle, U; Song, Y.


    HCI plays an important role in interactive medical image segmentation. The Goals, Operators, Methods, and Selection rules (GOMS) model and the National Aeronautics and Space Administration Task Load Index (NASA-TLX) questionnaire are different methods that are often used to evaluate the HCI

  13. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    International Nuclear Information System (INIS)

    Fang Linchuan; Zhou Chen; Cai Peng; Chen Wenli; Rong Xingmin; Dai Ke; Liang Wei; Gu Jidong; Huang Qiaoyun


    Highlights: → The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. → Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. → XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH 4 NO 3 , respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  14. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    Energy Technology Data Exchange (ETDEWEB)

    Fang Linchuan [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Zhou Chen; Cai Peng [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Chen Wenli [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Rong Xingmin; Dai Ke; Liang Wei [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Gu Jidong [Department of Ecology and Biodiversity, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Huang Qiaoyun, E-mail: [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China)


    Highlights: {yields} The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. {yields} Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. {yields} XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH{sub 4}NO{sub 3}, respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  15. Performance Evaluation of HYCOM-GOM for Hydrokinetic Resource Assessment in the Florida Strait

    Energy Technology Data Exchange (ETDEWEB)

    Neary, Vincent S [ORNL; Gunawan, Budi [ORNL; Ryou, Albert S [ORNL


    The U.S. Department of Energy (DoE) is assessing and mapping the potential off-shore ocean current hydrokinetic energy resources along the U.S. coastline, excluding tidal currents, to facilitate market penetration of water power technologies. This resource assessment includes information on the temporal and three-dimensional spatial distribution of the daily averaged power density, and the overall theoretical hydrokinetic energy production, based on modeled historical simulations spanning a 7-year period of record using HYCOM-GOM, an ocean current observation assimilation model that generates a spatially distributed three-dimensional representation of daily averaged horizontal current magnitude and direction time series from which power density time series and their statistics can be derived. This study ascertains the deviation of HYCOM-GOM outputs, including transport (flow) and power density, from outputs based on three independent observation sources to evaluate HYCOM-GOM performance. The three independent data sources include NOAA s submarine cable data of transport, ADCP data at a high power density location, and HF radar data in the high power density region of the Florida Strait. Comparisons with these three independent observation sets indicate discrepancies with HYCOM model outputs, but overall indicate that the HYCOM-GOM model can provide an adequate assessment of the ocean current hydrokinetic resource in high power density regions like the Florida Strait. Additional independent observational data, in particular stationary ADCP measurements, would be useful for expanding this model performance evaluation study. ADCP measurements are rare in ocean environments not influenced by tides, and limited to one location in the Florida Strait. HF radar data, although providing great spatial coverage, is limited to surface currents only.

  16. El Cardenal Isidro Gomá y la cuestión vasca

    Directory of Open Access Journals (Sweden)

    Dionisio Vivas, Miguel Ángel


    Full Text Available One of the many areas of activity of Cardinal Isidro Goma during the Civil War was the attention to the Basque question. After, the controversy with lehendakari Aguirre A, the result of the alignment of Basque nationalism with the Republic. The primate was also a central role regarding the end of conflict in the Basque Country, with negotiations for the surrender of Bilbao. Finally had to face conflict with the national clergy, who remained in Spain, who was victimized who was exiled or those who criticized the position of Cardinal Goma.Uno de los múltiples campos de actuación del cardenal Isidro Gomá durante la guerra civil fue la atención a la cuestión vasca. En primer lugar los problemas derivados del enfrentamiento de las autoridades militares con el obispo de Vitoria, Mateo Múgica. Después la polémica entre el propio Gomá y el lehendakari Aguirre, consecuencia del alineamiento del nacionalismo vasco con la República. El primado tuvo, asimismo, un papel central en torno al fin del conflicto bélico en el Pais Vasco, con las negociaciones para la rendición de Bilbao. Por último debió afrontar los conflictos clero nacionalista, el que permaneció en España, el que fue represaliado y el que fue exiliado o aquellos que censuraron la posición del Cardenal Gomá.

  17. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis. (United States)

    Fang, Linchuan; Zhou, Chen; Cai, Peng; Chen, Wenli; Rong, Xingmin; Dai, Ke; Liang, Wei; Gu, Ji-Dong; Huang, Qiaoyun


    Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH(4)NO(3), respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Antioxidant potential of selected Spirulina platensis preparations. (United States)

    Dartsch, Peter C


    Recent studies suggest that Spirulina, a unicellular blue-green alga, may have a variety of health benefits and therapeutic properties and is also capable of acting as an antioxidant and antiinflammatory agent. In this study, a cell-free and a cell-based test assay were used to examine the antioxidant and antiinflammatory properties of four selected Spirulina platensis preparations: (1) Biospirulina, (2) SpiruComplex, a preparation with naturally bound selenium, chromium and zinc, (3) SpiruZink, a preparation with naturally bound zinc, (4) Zinkspirulina + Acerola, a preparation with naturally bound zinc and acerola powder. The cell-free test assay used potassium superoxide as a donor for superoxide radicals, whereas the cell-based test assay used the formation of intracellular superoxide radicals of functional neutrophils upon stimulation by phorbol-12-myristate-13-acetate as a model to investigate the potential of Spirulina preparations to inactivate superoxide radicals. In accordance with the recommended daily dosage, test concentrations ranging from 50 to 1000 microg/mL were chosen. The results showed a dose-dependent inactivation of free superoxide radicals (antioxidant effect) as well as an antiinflammatory effect characterized by a dose-dependent reduction of the metabolic activity of functional neutrophils and a dose-dependent inactivation of superoxide radicals generated during an oxidative burst. The results demonstrate that the tested Spirulina preparations have a high antioxidant and antiinflammatory potential. Especially SpiruZink and Zinkspirulina + Acerola might be useful as a supportive therapeutic approach for reducing oxidative stress and/or the generation of oxygen radicals in the course of inflammatory processes.

  19. GOM Deepwater Horizon Oil Spill: A Time Series Analysis of Variations in Spilled Hydrocarbons (United States)

    Palomo, C. M.; Yan, B.


    An estimated amount of 210 million gallons of crude oil was released into the Gulf of Mexico (GOM) from April 20th to July 15th 2010 during the Deepwater Horizon oil rig explosion. The spill caused a tremendous financial, ecological, environmental and health impact and continues to affect the GOM today. Variations in hydrocarbons including alkanes, hopanes and poly-cyclic aromatic hydrocarbons (PAHs) can be analyzed to better understand the oil spill and assist in oil source identification. Twenty-one sediment samples*, two tar ball samples and one surface water oil sample were obtained from distinct locations in the GOM and within varying time frames from May to December 2010. Each sample was extracted through the ASE 200 solvent extractor, concentrated down under nitrogen gas, purified through an alumina column, concentrated down again with nitrogen gas and analyzed via GC X GC-TOF MS. Forty-one different hydrocarbons were quantified in each sample. Various hydrocarbon 'fingerprints,' such as parental :alkylate PAH ratios, high molecular weight PAHs: low molecular weight alkane ratios, and carbon preference index were calculated. The initial objective of this project was to identify the relative hydrocarbon contributions of petrogenic sources and combustion sources. Based on the calculated ratios, it is evident that the sediment core taken in October of 2010 was greatly affected by combustion sources. Following the first month of the spill, oil in the gulf was burned in attempts to contain the spill. Combustion related sources have quicker sedimentation rates, and hydrocarbons from a combustion source essentially move into deeper depths quicker than those from a petrogenic source, as was observed in analyses of the October 2010 sediment. *Of the twenty-one sediment samples prepared, nine were quantified for this project.

  20. Development of cassava doughnuts enriched with Spirulina platensis biomass Desenvolvimento de 'sonho de mandioca' enriquecido com biomassa de Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Samantha Ferreira Rabelo


    Full Text Available The cyanobacteria Spirulina platensis has been cultivated in a fed batch process with urea as the nitrogen source, in order to obtain dehydrated biomass for incorporation into food, aiming at nutritional enrichment and the production of a functional character, due to the amount of proteins, vitamins and several bioactive compounds found in this cyanobacterium. In this study, response surface methodology was used to analyze the substitution of wheat flour by cassava in the development of doughnuts with added Spirulina platensis biomass and inverted sugar, in order to increase the rate of the Maillard's reaction and mask the green colour of the biomass. The formulations were evaluated in relation to their proximate, sensory and technological compositions, which, when compared to the standard formulation, without the addition of S. platensis biomass and inverted sugar, showed the feasibility of adding the biomass to bestow nutritional enrichment without significantly affecting the sensory acceptance of the product or its typical characteristics.Cultivos da cianobactéria Spirulina platensis vêm sendo conduzidos utilizando-se ureia como fonte de nitrogênio, em processo descontínuo alimentado, para obtenção de biomassa desidratada para ser incorporada em alimentos visando enriquecimento nutricional e conferir caráter funcional em virtude da composição rica em proteínas, vitaminas e diversos componentes bioativos. Neste trabalho, foi estudada a substituição da farinha de trigo pela mandioca, além da adição de biomassa de Spirulina platensis e açúcar invertido, para desenvolver um 'sonho' com elevada taxa da Reação de Maillard para mascarar a coloração verde da biomassa, por meio da metodologia de superfície de resposta. As formulações foram avaliadas em relação aos aspectos de composição centesimal, sensoriais e tecnológicos que, quando comparados com o padrão, sem adição de biomassa de S. platensis e açúcar invertido

  1. Fresh pasta production enriched with Spirulina platensis biomass

    Directory of Open Access Journals (Sweden)

    Ailton Cesar Lemes


    Full Text Available The aim of this work was to study the enrichment of Spirulina platensis in wheat flour to prepare fresh pasta to evaluate the green color and nutritional enrichment in addition to functional properties due to the presence of the bioactive compounds in the cyanobacterium. The pastas were evaluated for the centesimal composition, microbiological contamination, sensorial acceptance and technological characteristics such as cooking time, water absorption, volume displacement and loss of solids. The superior protein contents and the satisfactory technological and sensorial attributes compared with the control with no cyanobacterium showed the usefulness of incorporating S. platensis biomass in the fresh pastas. The microbiological quality was in compliance with the legislation in force. The sensorial quality was considered satisfactory (“liked very much” and purchase intention high (“probably would buy”.

  2. Extraction and In Vitro Antimalarial Activity Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Diah Anggraini


    Full Text Available Phycocyanin is biopigment found only in a conductor such as Spirulina platensis. Phycocyanin from Nostoc can inhibit Plasmodium falciparum with IC50 8.4 μg/mL so that phycocyanin from S. platensis also can inhibit P. falciparum like Nostoc. The aim of this study was to determine the best method for phycocyanin extraction using three solvents. They were phosphate buffer, water, and aseton. Spirulina were cultured in the conditions intensity of light 3000 Lux, salinity 15 ppt, dark-light 8-16 hours. The response parameters of this study were C-phycocyanin (C-PC content, yield, and protein content. Yield biomass of Spirulina which cultivated using toplest was higher than the aquarium. The best solvent for phycocyanin extraction was a phosphate buffer with C-PC content, yield, and protein content 8 mg/mL, 202.26 mg/g, and 1.88%.

  3. Production of Spirulina platensis by adding sodium bicarbonate and ...

    African Journals Online (AJOL)

    In this study, dry chicken manure (DCM) was used as the source of nitrogen in the production of Spirulina platensis. Experiment was conducted in two different types of nutrition. In the type I nutrition, the highest average cell increase was recorded as 289.70 filaments mL-1 in value in the type I group (DCM+urea). In the type ...

  4. Effets des extraits ou de la poudre de Spirulina platensis et Jatropha ...

    African Journals Online (AJOL)


    30 juin 2015 ... générale, les extraits ou la poudre de Spirulina platensis ont eu des ... Mots clés: Biostimulant, croissance, Spirulina platensis, Jatropha curcas, Solanum lycopersicum .... Le test de ..... in antioxidant metabolites, enzymes, and.

  5. Biomass composition of Arthrospira platensis during cultivation on industrial process water and harvesting

    DEFF Research Database (Denmark)

    Ljubic, Anita; Safafar, Hamed; Holdt, Susan Løvstad


    by optical microscopy showed that microfiltration caused cell rupture at the moderate level while centrifugation had more severe effect on A. platensis. Effect of centrifugal forces and shear stress on A. platensis cells was confirmed by detecting lower lipid content in samples after applying both...... microfiltration and centrifugation due to cell content leakage....

  6. Culture of microalgae Spirulina platensis with isotope stable Carbon-13

    International Nuclear Information System (INIS)

    Cronemberger, Luiz C.A.; Costa, Vladimir E.


    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical 99m Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ( 13 C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of 13 C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure 13 C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard


    Directory of Open Access Journals (Sweden)

    Zainal Syam Arifin


    Full Text Available Increasing the population impact on increasing energy demand. On the other hand, the energy generation industry has been blamed as one of the contributors of carbon dioxide about 25% of total CO2 emissions worldwide. Meanwhile, the production of biogas, which aims to address the increasing need of energy, produces carbon dioxide in the range of 25–50% by volume. To overcome this, a cheap method, optimum and efficient as well as environmentally friendly in reducing CO2 levels by using Spirulina platensis is needed. This research aims to created a mathematical models and found the optimum flow rate to reduced levels of CO2 by using Spirulina platensis. This study used a glass tubular bioreactor (D = 2.6 cm at a temperature of 30°C and irradiated with a fluorescent lamp Philips TL 36 Watt, color temperature: 6,200K cool daylight, light output: 2,600 lm, 72 lm/W. Tubular reactor was placed in a box lined with silver foil walls on three sides. With mathematical models of tubular reactor, the reaction rate constants could be predicted. Based on calculations of data and graphs, optimum volumetric velocity could also be predicted. Variation of flowrate to observed the reduction rate of CO2 was 0.25 mL/sec, 0.35 mL/sec, 0.5 mL/sec, 0.75 mL/sec, 1 mL/sec. Carbon source was 99.99% CO2.Observations of Spirulina growth was made on the flow rate of 0.25 mL/sec at the initial levels of dry weight 2.1208 g/L. The results of this study indicated that the low flowratewas a more effective way to reduced carbon dioxide levels using Spirulina platensis (= 2.82×10-4 sec-1. The highest conversion was obtained at a volumetric flow rate of 0.25 mL/sec and optimum speeds in the range of 0.3 to 0.4 mL/sec. The rate of incoming CO2 flux should be less than 0.047 mL/cm2.detik. Specific Growth Rate (µ of Spirulina platensis in this study was 2.56×10-2 minute-1.   Keywords: Spirulina platensis, a vertical tubular bioreactor, CO2 reduction     ABSTRAK

  8. 76 FR 50245 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA), Oil and Gas... (United States)


    ... (BOEMRE), Interior. ACTION: Notice of Availability (NOA) of a Final Supplemental Environmental Impact... sale's incremental contribution to the cumulative impacts on environmental and socioeconomic resources... Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA), Oil and Gas Lease Sale for the...

  9. 76 FR 70478 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA), Oil and Gas... (United States)


    ... DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management Gulf of Mexico (GOM), Outer... studies, NEPA analysis, resource evaluation, economic analysis, and renewable energy. BSEE is responsible... Program AGENCY: Bureau of Ocean Energy Management (BOEM), Interior. ACTION: Notice of Availability (NOA...


    Directory of Open Access Journals (Sweden)

    Haryo Kuntoro Adi


    Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

  11. Cultivation of microalgae Spirulina platensis (Arthrospira platensis from biological treatment of swine wastewater Cultivo da microalga Spirulina platensis (Arthrospira platensis a partir de tratamento biológico de efluente suíno

    Directory of Open Access Journals (Sweden)

    Natália Mezzomo


    Full Text Available The microalgae biomass production from swine wastewater is a possible solution for the environmental impact generated by wastewater discharge into water sources. The biomass can be added to fish feed, which can be used in the formulation of meat products. This work addresses the adaptation of the microalgae Spirulina platensis (Arthrospira platensis in swine wastewater and the study of the best dilution of the wastewater for maximum biomass production and for removal of Chemical Oxygen Demand (COD, ammonia and phosphorous to the microalgae. The cultivation of Spirulina platensis, strain Paracas presented maximum cellular concentrations and maximum specific growth rates in the wastewater concentration of 5.0 and 8.5%. The highest COD removals occurred with 26.5 and 30.0% of wastewater in the medium. The maximum removal of total phosphorous (41.6%, was with 8.5% of wastewater, which is related to the microalgae growth. The results of Spirulina culture in the swine wastewater demonstrated the possibility of using these microalgae for the COD and phosphorous removal and for biomass production.A produção de biomassa de microalgas a partir de efluente suíno consiste em uma possível solução para o impacto ambiental gerado pela descarga de efluentes em fontes naturais. A biomassa produzida pode ser adicionada a rações de peixes, os quais podem ser utilizados na formulação de produtos cárneos. O objetivo deste trabalho foi a adaptação da microalga Spirulina platensis (Arthrospira platensis em efluente suíno e o estudo da diluição ideal de efluente para obter a máxima produção de biomassa e remoção de Demanda Química de Oxigênio (DQO, amônia e fósforo do efluente pela microalga. O cultivo da Spirulina platensis, cepa Paracas apresentou máxima concentração celular e máxima taxa específica de crescimento em concentrações de efluente de 5,0 e 8,5%. As maiores remoções de DQO ocorreram com 26,5 e 30,0% de efluente no meio. A


    Directory of Open Access Journals (Sweden)

    Bakti Jos


    Full Text Available The growing awareness of the importance of natural colours especially food and cosmetic colorants has placedgreat demand on biological sources of natural colours. It is for this reason that the phycobiliproteins inSpirulina platensis is gaining increasing attention as an alternative colour for these products. Numerousscientific reports confirm the fact that Phycocyanin from Spirulina platensis, is not only an effective naturalblue colorant, but also a compound that is beneficial to the health of the consumer. The aim of this research is toconduct evaluation studies phycocyanin production by extraction with polar solvents at various concentrationsto obtain extracts for maximum yield. The methods in this study has several stages, namely preparation ofmaterials, extraction, solubility studies of phycocyanin, phycocyanin’s stability test. Changing variables in thisstudy are water, acetic acid 70%, 75%, 80%, ammonium sulphate 50%, 55%, 60%. The analysis of the extractsof phycocyanin’s content using spectrophotometric methods. The observations produces a blue pigment whichhas the highest color intensity with maximum absorbance of 620 nm. Acetic acid 80% is the most effectivesolvent to extract the blue pigment phycocyanin than water and ammonium sulfate. Extraction is influenced bythe pH of the increase in absorption (absorbance with increasing pH and was not influenced by storagetemperature and time

  13. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani


    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy. Keywords: Dietary fiber, jelly drink, protein, seaweed, Spirulina platensis

  14. Antiviral activity of exopolysaccharides from Arthrospira platensis against koi herpesvirus. (United States)

    Reichert, M; Bergmann, S M; Hwang, J; Buchholz, R; Lindenberger, C


    Although koi herpesvirus (KHV) has a history of causing severe economic losses in common carp and koi farms, there are still no treatments available on the market. Thus, the aim of this study was to test exopolysaccharides (EPS) for its antiviral activity against KHV, by monitoring inhibition and cytotoxic effects in common carp brain cells. These substances can be easily extracted from extracellular algae supernatant and were identified as groups of sulphated polysaccharides. In order to reach this aim, Arthrospira platensis, which is well known for its antiviral activity of intra- and extracellular compounds towards mammalian herpesviruses, was investigated as standard organism and compared to commercial antiviral drug, ganciclovir, which inhibits the viral DNA polymerization. The antiviral activity of polysaccharides of A. platensis against KHV was confirmed in vitro using qualitative assessment of KHV life cycle genes, and it was found by RT-PCR that EPS, applied at a concentration of >18 μg mL -1 and a multiplicity of infection (MOI) of 0.45 of KHV, suppressed the viral replication in common carp brain (CCB) cells even after 22 days post-infection, entirely. Further, this study presents first data indicating an enormous potential using polysaccharides as an additive for aquacultures to lower or hinder the spread of the KHV and koi herpesvirus disease (KHVD) in future. © 2017 John Wiley & Sons Ltd.

  15. In vitro and in vivo preliminary results on Spirulina platensis for ...

    African Journals Online (AJOL)



    May 1, 2013 ... platensis for treatment of impetigo: Topical cream application .... 7.5 g; liquid paraffin 3.75 ml; and aqueous phase: deionized water,. 35 ml; sodium ..... macroalgae from Gran Canaria (Canary Islands, Spain). Int. Microbiol.

  16. Equilibrium and thermodynamics of azo dyes biosorption onto Spirulina platensis

    Directory of Open Access Journals (Sweden)

    G. L. Dotto


    Full Text Available The equilibrium and thermodynamics of azo dye (tartrazine and allura red biosorption onto Spirulina platensis biomass were investigated. The equilibrium curves were obtained at 298, 308, 318 and 328 K, and four isotherm models were fitted the experimental data. Biosorption thermodynamic parameters (ΔG, ΔH and ΔS were estimated. The results showed that the biosorption was favored by a temperature decrease. For both dyes, the Sips model was the best to represent the equilibrium experimental data (R²>0.99 and ARE<5.0% and the maximum biosorption capacities were 363.2 and 468.7 mg g-1 for tartrazine and allura red, respectively, obtained at 298 K. The negative values of ΔG and ΔH showed that the biosorption of both dyes was spontaneous, favorable and exothermic. The positive values of ΔS suggested that the system disorder increases during the biosorption process.

  17. JST Thesaurus Headwords and Synonyms: Spirulina platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Spirulina platensis 名詞 一般 * * * *... スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Spirulina platensis

  18. JST Thesaurus Headwords and Synonyms: Arthrospira platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Arthrospira platensis 名詞 一般 * * *... * スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Arthrospira platensis

  19. Epithermal neutron activation analysis of blue-green algae Spirulina Platensis as a matrix for selenium-containing pharmaceuticals

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Gundorina, S.F.; Oprea, C.D.


    To evaluate the potentiality of the blue-green algae Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals, the background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina Platensis biomass were determined by means of epithermal neutron activation analysis. The possibility of the purpose-oriented incorporation of Se into Spirulina Platensis biomass was demonstrated. The polynomial dependence of the Se accumulation on nutritional medium loading was revealed. The employed analytical technique allows one to reliably control the amount of toxic elements in algae Spirulina Platensis. Based on this study, a conclusion of the possibility to use Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals was drawn

  20. Technological and nutritional assessment of dry pasta with oatmeal and the microalga Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Fernanda Arnhold Pagnussatt


    Full Text Available Wheat flour is the most important raw material in the production of pasta. The production process consists of mixing water and flour, kneading, extrusion and drying. Oats and the microalga Spirulina platensis play a physiological role in the growth, development and maintenance of the human organism due to their high nutritional value. The aim of this study was to assess the technological and nutritional properties of dry pasta prepared with the addition of oatmeal and Spirulina platensis. The wheat flour was characterized and the effect of partial replacement by oatmeal and Spirulina platensis (Arthrospira platensis was evaluated using response surface methodology (RSM. The mixtures were analysed for moisture, protein, ash, colour, particle size, falling number and alveography. The formulated pastas were dried and evaluated for moisture, colour, cooking test, acidity, proximate composition and amino acids. Generally, the addition of Spirulina platensis influenced the soluble solids content and colour of the pasta, while the oatmeal mainly affected the acid content. The oatmeal increased the values of crude protein and total dietary fibre (13.06% when compared with the commercial pasta (2.40% and may be considered as a source of fibre.

  1. Semicontinuous cultivation of the Cyanobacterium Spirulina platensis in a closed photobioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Reichert, C.C.; Costa, J.A.V. [Fundacao Universidade Federal do Rio Grande (FURG), Rio Grande, RS (Brazil). Dept. de Quimica], Email:; Reinehr, C.O. [Universidade de Passo Fundo, RS (Brazil). Centro de Pesquisa em Alimentacao], Email:


    The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate ({mu}{sub x}, day{sup -1}) and productivity (P{sub x}, in mg/L/day of Spirulina platensis biomass, dry weight basis) of two S. platensis strains (LEB-52 and Paracas) growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h) at 30 deg C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L) and high renewal rates (50% v/v) resulted in a high specific growth rate ({mu}{sub x} = 0.111 day{sup -1}) and high productivity (P{sub x} = 42.3 mg/L/day). These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable. (author)

  2. Semicontinuous cultivation of the cyanobacterium Spirulina platensis in a closed photobioreactor

    Directory of Open Access Journals (Sweden)

    C. C. Reichert


    Full Text Available The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate (µx, day-1 and productivity (Px, in mg/L/day of Spirulina platensis biomass, dry weight basis of two S. platensis strains (LEB-52 and Paracas growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h at 30°C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L and high renewal rates (50% v/v resulted in a high specific growth rate (µx = 0.111 day-1 and high productivity (Px = 42.3 mg/L/day. These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable.

  3. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani


    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy.

  4. Medical Application of Spirulina platensis Derived C-Phycocyanin

    Directory of Open Access Journals (Sweden)

    Qian Liu


    Full Text Available Along with the development of marine biological pharmaceutical research, high-effective and low-toxic drugs and functional foods isolated from marine organisms have become a new field of pharmacy and bromatology. The pharmacological actions, such as anti-inflammation, antioxidation, antitumor, immunological enhancement, and hepatorenal protection of C-phycocyanin (C-PC from Spirulina platensis, have been reported, and C-PC has important value of development and utilization either as drug or as functional food. There are many researches about the various pharmacological actions and mechanisms of C-PC, but related reports are only to some extent integrated deeply and accurately enough, which put some limitations to the further application of C-PC in medicine. Particularly, with the improvement of living standards and attention to health issues, C-PC being a functional food is preferred by more and more people. C-PC is easy to get, safe, and nontoxic; thus, it has a great potential of research and development as a drug or functional food. Here, the separation and purification, physicochemical properties, physiological and pharmacological activities, safety, and some applications are reviewed to provide relevant basis for the development of natural medicine and applied products.

  5. Study on the effect of different concentration of Spirulina platensis paste added into dried noodle to its quality characteristics (United States)

    Agustini, T. W.; Ma'ruf, W. F.; Widayat; Wibowo, B. A.; Hadiyanto


    High nutritional content of microalgae S. platensis is very good for human health especially for its protein and β-carotene. These compounds can be used for improving quality of food from nutritional point of view. This study was designed to observe the effect of different concentration of S. platensis paste to dried noodle quality based on physical, chemical and sensory perspectives. Material used in this study was S. platensis powder obtained from CV Neoalgae, Sukoharjo. The best treatment observed from preliminary study was then used for further study and compared to control treatment (without added S. platensis paste). The dried noodle resulted was then analyzed for elasticity, chemical (β-carotene, water, protein, ash, fat and carbohydrate) and sensory (hedonic). Parametric data obtained were analyzed using t-Test while non-parametric data was analyzed using Kruskal-Wallis followed by Multiple Comparison test. The study showed that dried noodle added with 9% S. platensis paste give significant effect (P<0.05) on elasticity; β-carotene, water, protein, ash, fat and carbohydrate and also sensory (hedonic). Dried noodle without added S. platensis paste has lower in β-carotene and protein compared to that of added S. platensis paste with the value of 0.06 mg/100 gr and 17.51 mg/100gr (β-carotene) and 8.88% and 38.6% (protein), respectively. Those, chemical composition of dried noodle added with S. platensis comply with Indonesian National Standard in term of protein, water, and ash content with sensory of 7.26 ≤ μ ≤ 7.63. Addition of S. platensis can significantly increase the nutritional of dried noodle especially protein (by 4 times) and β-carotene.

  6. The potential effects of Spirulina platensis (Arthrospira platensis on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level

    Directory of Open Access Journals (Sweden)

    Mai D. Ibrahem


    Full Text Available The current study was designed to investigate the potential effect of Spirulina platensis, Arthrospira platensis, (SP on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level. Five isonitrogenous and isocaloric rations containing graded levels of dried SP 5, 7.5,10, 15, and 20 g/kg diet were fed separately to five equal groups of O. niloticus fingerlings, additional control group was assigned for 3 months. Liver samples were separately collected from each group by the end of each month. The expression level of P53 showed a substantial decrease among the treated groups in a time-dependent manner. It is therefore advisable to incorporate SP in diets for tissue protection and antioxidant effects in cultured O. niloticus.

  7. Application of an Ultrafine Shearing Method for the Extraction of C-Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Jianfeng Yu


    Full Text Available Cell disruption is an important step during the extraction of C-phycocyanin from Spirulina platensis. An ultrafine shearing method is introduced and combined with soaking and ultrasonication to disrupt the cell walls of S. platensis efficiently and economically. Five kinds of cell disruption method, including soaking, ultrasonication, freezing-thawing, soaking-ultrafine shearing and soaking-ultrafine shearing-ultrasonication were applied to break the cell walls of S. platensis. The effectiveness of cell breaking was evaluated based on the yield of the C-phycocyanin. The results show that the maximum C-phycocyanin yield was 9.02%, achieved by the soaking-ultrafine shearing-ultrasonication method, followed by soaking (8.43%, soaking-ultrafine shearing (8.89%, freezing and thawing (8.34%, and soaking-ultrasonication (8.62%. The soaking-ultrafine shearing-ultrasonication method is a novel technique for breaking the cell walls of S. platensis for the extraction of C-phycocyanin.

  8. Arthrospira (Spirulina) platensis supplementation affects folliculogenesis, progesterone and ghrelin levels in fattening pre-pubertal gilts

    NARCIS (Netherlands)

    Abadjieva, Desislava; Nedeva, Radka; Marchev, Yordan; Jordanova, Gergana; Chervenkov, Mihail; Dineva, Julieta; Shimkus, Almantas; Shimkiene, Aldona; Teerds, Katja; Kistanova, Elena


    The aim of the present investigation was to study the effect of Arthrospira (Spirulina) platensis supplemented diet on follicular development and related endocrine parameters, such as estradiol and progesterone levels as well as ghrelin levels in pre-pubertal gilts. Twenty-one 60-day-old Danube

  9. Proteome-wide analysis and diel proteomic profiling of the cyanobacterium Arthrospira platensis PCC 8005.

    Directory of Open Access Journals (Sweden)

    Sabine Matallana-Surget

    Full Text Available The filamentous cyanobacterium Arthrospira platensis has a long history of use as a food supply and it has been used by the European Space Agency in the MELiSSA project, an artificial microecosystem which supports life during long-term manned space missions. This study assesses progress in the field of cyanobacterial shotgun proteomics and light/dark diurnal cycles by focusing on Arthrospira platensis. Several fractionation workflows including gel-free and gel-based protein/peptide fractionation procedures were used and combined with LC-MS/MS analysis, enabling the overall identification of 1306 proteins, which represents 21% coverage of the theoretical proteome. A total of 30 proteins were found to be significantly differentially regulated under light/dark growth transition. Interestingly, most of the proteins showing differential abundance were related to photosynthesis, the Calvin cycle and translation processes. A novel aspect and major achievement of this work is the successful improvement of the cyanobacterial proteome coverage using a 3D LC-MS/MS approach, based on an immobilized metal affinity chromatography, a suitable tool that enabled us to eliminate the most abundant protein, the allophycocyanin. We also demonstrated that cell growth follows a light/dark cycle in A. platensis. This preliminary proteomic study has highlighted new characteristics of the Arthrospira platensis proteome in terms of diurnal regulation.

  10. Production of Spirulina platensis using dry chicken manure supplemented with urea and sodium bicarbonate

    Directory of Open Access Journals (Sweden)

    Thepparath Ungsethaphand


    Full Text Available The cyanobacterium Spirulina platensis is an attractive source of valuable protein for both human and animal consumption. The conventional nitrogen source for S. platensis is nitrate. However, recent research has evaluated the potential of using animal waste as a low-cost nitrogen source. In this work, the cultivation of S. platensis was done using dry chicken manure (DCM, collected from a closed-system poultry house, as nitrogen source. The experiment was carried out in open concrete tanks with 100 litres of culture medium and an initial biomass concentration of 0.5 g/L. The culture media were prepared to test the effect of unsupplemented DCM, DCM supplemented with 2.0 mg/L of urea (DCM+U, and/or 40 mg/L of sodium bicarbonate (DCM+U+B or DCM+B. The best cellular growth and highest protein production were observed for S. platensis in the biomass harvested from the culture medium containing DCM supplemented with 2.0 mg/L of urea (DCM+U.

  11. In vitro evaluation of Spirulina platensis extract incorporated skin cream with its wound healing and antioxidant activities. (United States)

    Gunes, Seda; Tamburaci, Sedef; Dalay, Meltem Conk; Deliloglu Gurhan, Ismet


    Algae have gained importance in cosmeceutical product development due to their beneficial effects on skin health and therapeutical value with bioactive compounds. Spirulina platensis Parachas (Phormidiaceae) is renowned as a potential source of high-value chemicals and recently used in skincare products. This study develops and evaluates skin creams incorporated with bioactive S. platensis extract. Spirulina platensis was cultivated, the aqueous crude extract was prepared and in vitro cytotoxicity of S. platensis extract in the range of 0.001-1% concentrations for 1, 3 and 7 d on HS2 keratinocyte cells was determined. Crude extracts were incorporated in skin cream formulation at 0.01% (w/w) concentration and in vitro wound healing and genotoxicity studies were performed. Immunohistochemical staining was performed to determine the collagen activity. 0.1% S. platensis extract exhibited higher proliferation activity compared with the control group with 198% of cell viability after 3 d. Skin cream including 1.125% S. platensis crude extract showed enhanced wound healing effect on HS2 keratinocyte cell line and the highest HS2 cell viability % was obtained with this concentration. The micronucleus (MN) assay results indicated that S. platensis extract incorporated creams had no genotoxic effect on human peripheral blood cells. Immunohistochemical analysis showed that collagen 1 immunoreactivity was improved by increased extract concentration and it was strongly positive in cells treated with 1.125% extract incorporated skin cream. The cell viability, wound healing activity and genotoxicity results showed that S. platensis incorporated skin cream could be of potential value in cosmeceutical and biomedical applications.

  12. Effect of Spirulina platensis Supplementation by Different Concentration in Diet on Red Color Intensity of Kohaku Koi (Cyprinus carpio L.

    Directory of Open Access Journals (Sweden)

    N.B.P Utomo


    Full Text Available Kohaku koi (Cyprinus carpio is one of the fancy koi that has a high price.  Red color intensity of kohaku determines its market price.  This study was performed to verify the effect of Spirulina platensis supplementation in diet  with different dosages (1, 3 and 5% on red color intensity of kohaku koi.  The result of study show that inclusion of Spirulina platensis in the diet increased intensity of koi color.  Feeding with  1% of Spirulina platensis enriched paste diet for 5 weeks resulted in  a brighter red color compared to other treatments and control.   Alteration of red color intensity has not been followed by its patch length.  No effect of Spirulina supplementation on koi growth by weight and length were observed. Keywords: Spirulina platensis, color, kohaku, koi, Cyprinus carpio   ABSTRAK Ikan koi kohaku (Cyprinus carpio L merupakan salah satu jenis ikan koi yang memiliki harga tinggi.  Kecerahan warna merah ikan koi kohaku menentukan harga jualnya.  Penelitian ini untuk mengetahui pengaruh penambahan Spirulina platensis in the diet dengan dosis berbeda (1, 3 dan 5% terhadap kualitas warna merah koi kohaku.  Hasil penelitian ini menunjukkan bahwa penambahan Spirulina platensis melalui pakan dapat meningkatkan kualitas warna pada ikan koi. Pemberian pakan berupa pasta yang diperkaya dengan Spirulina platensis sebanyak 1% selama 5 minggu menghasilkan warna merah lebih cerah dibandingkan perlakuan lainnya dan kontrol. Perubahan warna yang terjadi tidak diikuti oleh perubahan panjang bercak warnanya. Penambahan Spirulina pada pakan tidak berpengaruh pada pertumbuhan berat dan panjang ikan koi. Kata kunci: Spirulina platensis, warna, kohaku, koi, Cyprinus carpio

  13. Experimental grounds for developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Frontas'eva, M.V.; Pavlov, S.S.; Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.


    The possibility of using blue-green algae Spirulina platensis as a matrix for production of the selenium- and iodine-containing pharmaceuticals was studied. The dependence of Se and I accumulation in Spirulina biomass during the cultivation in a nutrient medium loading of above elements was determined more precisely. The dynamics of Spirulina biomass growth was observed with nutrient medium loading of selenium. It is found that Spirulina platensis biomass quality may be used for pharmaceutical purposes

  14. Paloma Fernández Gomá: latidos de poesía que unen orillas


    Medrano, Susana de los Ángeles


    En la lírica española contemporánea ya no cabe duda de que la poesía de mujer constituye un aporte significativo. Dentro de su entramado, en la panorámica actual de la lírica femenina de Andalucía, Paloma Fernández Gomá se perfila como una de las poetas más interesantes y singulares. Nacida en Madrid y asentada en Algeciras (Cádiz) desde niña, su poesía se inicia tempranamente pero recién se da a conocer en 1991 con El ocaso del girasol, al que le siguen hasta el momento una decena de poemari...

  15. Culture of microalgae Spirulina platensis with isotope stable Carbon-13; Cultivo da microalga Spirulina platensis com isótopo estável Carbono-13

    Energy Technology Data Exchange (ETDEWEB)

    Cronemberger, Luiz C.A.; Costa, Vladimir E., E-mail:, E-mail: [Universidade Estadual Paulista Julio de Mesquita Filho (CIE/UNESP), Botucatu, SP (Brazil). Centro de Isótopos Estáveis Prof. Dr. Carlos Ducatti


    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical {sup 99m}Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ({sup 13}C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of {sup 13}C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure {sup 13}C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard.

  16. Effects of Spirulina platensis on DNA damage and chromosomal aberration against cadmium chloride-induced genotoxicity in rats. (United States)

    Aly, Fayza M; Kotb, Ahmed M; Hammad, Seddik


    Todays, bioactive compounds extracted from Spirulina platensis have been intensively studied for their therapeutical values. Therefore, in the present study, we aimed to evaluate the effects of S. platensis extract on DNA damage and chromosomal aberrations induced by cadmium in rats. Four groups of male albino rats (n = 7 rats) were used. The first group served as a control group and received distilled water. The second group was exposed intraperitoneally to cadmium chloride (CdCl 2 ) (3.5 mg/kg body weight dissolved in 2 ml distilled water). The third group included the rats that were orally treated with S. platensis extract (1 g/kg dissolved in 5 ml distilled water, every other day for 30 days). The fourth group included the rats that were intraperitoneally and orally exposed to cadmium chloride and S. platensis, respectively. The experiment in all groups was extended for 60 days. The results of cadmium-mediated toxicity revealed significant genetic effects (DNA fragmentation, deletion or disappearance of some base pairs of DNA, and appearance of few base pairs according to ISSR-PCR analysis). Moreover, chromosomes showed structural aberrations such as reduction of chromosomal number, chromosomal ring, chromatid deletions, chromosomal fragmentations, and dicentric chromosomes. Surprisingly, S. platensis extract plus CdCl 2 -treated group showed less genetic effects compared with CdCl 2 alone. Further, S. platensis extract upon CdCl 2 toxicity was associated with less chromosomal aberration number and nearly normal appearance of DNA fragments as indicated by the bone marrow and ISSR-PCR analysis, respectively. In conclusion, the present novel study showed that co-treatment with S. platensis extract could reduce the genotoxic effects of CdCl 2 in rats.

  17. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates

    Directory of Open Access Journals (Sweden)

    Nur Maulida Safitri


    Full Text Available The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51 was identified and synthetized, which exhibited 45.98 ± 1.7% at concentration 128.15 µg/mL. Therefore, S. platensis is indicated as a potential therapeutic source for combating oxidative stress.

  18. Effect of humic acids on the growth and the biochemical composition of Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Massiel Vanessa Rivera Gonzalez


    Full Text Available The purpose of this research was to evaluate the effect of three concentrations of humic acids (HA 1, 10, 100 mg/L against a concentration of indole acetic acid (IAA on production of biomass, pigments, proteins, carbohydrates and lipids of A. platensis.  Cultures discontinuous in Zarrouk 25% medium supplemented with HA and IAA under conditions of aeration constant and photoperiod from 12:12 hours, during 30 days were made. It was found that the maximum biomass production was higher in the culture supplemented with 10 mg / L of AH, compared to the control and cultures supplemented with AIA. In the same way the highest production of pigments, proteins and carbohydrates were observed in this treatment. Therefore, the growth and production of metabolites of A. platensis was increased, which makes it possible to observe the potential use of these substances as organic biological stimulants.

  19. Cultivo mixotrófico da microalga Spirulina platensis em batelada alimentada Mixotrophic growth of Spirulina platensis in fed-batch mode

    Directory of Open Access Journals (Sweden)

    Adriana Muliterno


    Full Text Available A Spirulina platensis tem sido estudada devido a seu alto valor protéico, digestibilidade e por apresentar quantidades significativas de ácidos graxos poliinsaturados, vitaminas, fenólicos e ficocianina, podendo ser utilizada na alimentação humana. A utilização de nutrientes de baixo custo é um fator importante na produção da cianobactéria por possibilitar a redução de custos de processo. Objetivou-se com este trabalho estudar o cultivo mixotrófico da S. platensis por meio da adição de uma fonte orgânica de carbono (glicose em modo bateladaalimentada. Foi utilizado um Planejamento Fatorial Completo 2³ para o cultivo e as variáveis de estudo foram a concentração de glicose (0,5 gL-1 e 1,0 gL-1, a diluição do meio Zarrouk (50% e 75% e a iluminância (1800 lux e 3000 lux. A concentração celular máxima obtida foi de 5,38 gL-1 com uma velocidade específica máxima de crescimento de 0,0063 h-1, nas condições de 0,5 gL-1 de glicose, diluição do meio de 75% e iluminância de 3000 lux.The cyanobacterium Spirulina platensis has been studied due to its high content (~65% of highly digestible protein as well as significant amounts of polyunsaturated fatty acids, phenolics, vitamins, minerals and phycocyanin which could be useful in the human nutrition. The use of nutrients of low costs in the cyanobacterium growth could reduce the costs of production. We studied the fed-batch mixotrophic growth of the S. platensis in Zarrouk's medium with glucose (0.5 gL-1 and 1.0 gL-1 as carbon source and also investigated the effects of dilution (50% and 75%, with water and illumination (1,800 lux and 3,000 lux using a 2³ factorial design. The maximum celular concentration of 5.38 gL-1 and maximum specific growth rate of 0.0063 h-1 were obtained with a glucose concentration of 0.5 gL-1, 50% dilution and 1800 lux of illuminance.

  20. Nutritional control of antibiotic production by Streptomyces platensis MA7327: importance of L-aspartic acid


    Falzone, Maria; Crespo, Emmanuel; Jones, Klarissa; Khan, Gulaba; Korn, Victoria L; Patel, Amreen; Patel, Mira; Patel, Krishnaben; Perkins, Carrie; Siddiqui, Sana; Stenger, Drew; Yu, Eileen; Gelber, Michael; Scheffler, Robert; Nayda, Vasyl


    Streptomyces platensis MA7327 is a bacterium producing interesting antibiotics, which act by the novel mechanism of inhibiting fatty acid biosynthesis. The antibiotics produced by this actinomycete are platensimycin and platencin plus some minor related antibiotics. Platensimycin and platencin have activity against antibiotic-resistant bacteria such as methicillin-resistant Staphylococcus aureus and vancomycin-resistant Enterococcus; they also lack toxicity in animal models. Platensimycin als...

  1. Influence of Spirulina platensis exudates on the endocrine and nervous systems of a mammalian model


    Samah M.M. Fathy; Ashraf M.M. Essa


    Objective: To investigate the effect of intra-peritoneal injection of purified exudates of axenic Spirulina platensis on the mammalian endocrine and nervous systems. Methods: The intra-peritoneal injection of the cyanobacterial exudates in mice was applied. Sex hormonal levels of testosterone and progesterone were measured using radioimmunoassay while the follicular stimulating hormone and luteinizing hormone were evaluated by direct chemiluminescence. In addition, superoxide dismutase, ca...

  2. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods


    Liliana CEPOI; Ludmila RUDI; Vera MISCU; Angela COJOCARI; Tatiana CHIRIAC; Daniela SADOVNIC


    The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC), radical-scavenging activity by DPPH ...

  3. Acoustic, electrochemical and microscopic characterization of interaction of Arthrospira platensis biofilm and heavy metal ions


    Tekaya , Nadèje; Gammoudi , Ibtissèm; Braiek , Mohamed; Tarbague , Hakim; Morote , Fabien; Raimbault , Vincent; Sakly , Nawfel; Rebière , Dominique; Ben Ouada , Hatem; Lagarde , Florence; Ben Ouada , Hafedh; Cohen-Bouhacina , Touria; Déjous , Corinne; Jaffrezic-Renault , Nicole


    International audience; This study examines a biofilm of Arthrospira platensis and its interactions with cadmium and mercury, using electrochemical admittance spectroscopy technique combined with highly sensitive Love wave platform for the real-time detection in liquid medium. Spirulina cells were immobilized via multilayers of polyelectrolyte (PEM) on Si/SiO2 surface of both transducers and characterized using atomic force microscopy (AFM). Scanning electron microscopy (SEM) cell images reve...

  4. Deodorization of Arthrospira platensis biomass for further scale-up food applications. (United States)

    Cuellar-Bermúdez, Sara P; Barba-Davila, Bertha; Serna-Saldivar, Sergio O; Parra-Saldivar, Roberto; Rodriguez-Rodriguez, José; Morales-Davila, Sandra; Goiris, Koen; Muylaert, Koenraad; Chuck-Hernández, Cristina


    Given the importance of A. platensis as a potential food protein source, we describe an affordable deodorization process that does not significantly affect the nutritional value of algae biomass. Ethanol, acetone or hexane were used to deodorize algae biomass and then to identify the profile of volatile compounds associated with its distinctive odor. Sensorial characteristics were improved in the biomass cake after the proposed solvent extraction. Panelists identified the ethanolic extract with the most pronounced algae-related odor. Gas chromatography-mass spectrometry analysis showed that a mixture of 20 different compounds derived from fatty acids and amino acids contributed to the characteristic smell of A. platensis biomass. The results of the present study show that the ethanol solvent-free A. platensis biomass contained > 600 g kg -1 protein,  65% in vitro protein digestibility, similar to the original biomass. The Fourier transform infrared spectroscopy secondary protein structure was comparable among samples, indicating that the only change after ethanol extraction was a reduction of the algae smell. The various extraction procedures investigated in the present study were effective in deodorizing the algae biomass. The most effective protocol was the removal of odoriferous compounds with ethanol. This particular procedure yielded an algae biomass with an improved sensorial traits. The results of the present study should help with the identification of odoriferous compounds derived from fatty acids, pigments and proteins associated with A. platensis. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  5. Performance of the mixed LED light quality on the growth and energy efficiency of Arthrospira platensis. (United States)

    Mao, Ruixin; Guo, Shuangsheng


    The effect of mixed light quality with red, blue, and green LED lamps on the growth of Arthrospira platensis was studied, so as to lay the theoretical and technical basis for establishing a photo-bioreactor lighting system for application in space. Meanwhile, indexes, like morphology, growth rate, photosynthetic pigment compositions, energy efficiency, and main nutritional components, were measured respectively. The results showed that the blue light combined with red light could decrease the tightness of filament, and the effect of green light was opposite. The combination of blue light or green light with red light induced the filaments to get shorter in length. The 8R2B treatment could promote the growth of Arthrospira platensis significantly, and its dry weight reached 1.36 g L -1 , which was 25.93% higher than the control. What's more, 8R2B treatment had the highest contents of carbohydrate and lipid, while 8R2G was rich in protein. 8R0.5G1.5B had the highest efficiency of biomass production, which was 161.53 mg L -1  kW -1  h -1 . Therefore, the combination of red and blue light is more conducive to the growth of Arthrospira platensis, and a higher biomass production and energy utilization efficiency can be achieved simultaneously under the mixed light quality with the ratio of 8R0.5G1.5B.

  6. Functional Properties and Amino Acid Profile of Spirulina Platensis Protein Isolates

    International Nuclear Information System (INIS)

    Bashir, S.; Sharif, M. K.; Butt, M. S.; Shahid, M.


    Protein malnutrition and food insecurity represent serious obstructions to sustainable development, poverty reduction and food quality throughout the world. The present study has been designed to evaluate the Spirulina platensis (SP) as a protein alternative source for the utilization in food products. A protein isolate was prepared from S. platensis powder through extraction with 0.1N NaOH, precipitation at pH 3, neutralization of the dispersed precipitate to pH 6.8-7.0, and subsequent freeze drying. The S. platensis isolate amino acids compositions revealed that the total essential amino acids contribution was comparatively higher in SPI (31.16±1.43 g/100 g) as compared with SP (27.75±1.21 g/100 g). Moreover, oil and water absorption capacities, foaming and emulsifying properties, surface hydrophobicity and nitrogen solubility index were found better functional properties under laboratory conditions except emulsion properties. Conclusively, SP and its isolates might be used in various food products to curtail protein energy malnutrition. (author)

  7. Spirulina platensis feeding inhibited the anemia- and leucopenia-induced lead and cadmium in rats

    Energy Technology Data Exchange (ETDEWEB)

    Simsek, Nejdet [University of Atatuerk, Faculty of Veterinary Medicine, Department of Histology and Embryology, 25700 Erzurum (Turkey); Karadeniz, Ali, E-mail: [University of Atatuerk, Faculty of Veterinary Medicine, Department of Physiology, 25700 Erzurum (Turkey); Kalkan, Yildiray; Keles, Osman N.; Unal, Buenyami [University of Atatuerk, Faculty of Medicine, Department of Histology and Embryology, 25240 Erzurum (Turkey)


    In the present investigation, the effect of Spirulina platensis (Sp) was undertaken on rats fed with lead and cadmium including diet by using physiological, enzymehistochemical and stereological methods. For this aim, 50 rats were equally divided into five groups as control (C), lead (Pb), Spirulina + lead (Sp + Pb), cadmium (Cd), and Spirulina + cadmium (Sp + Cd). Red blood cell (RBC) and white blood cell (WBC) counts, packed cell volume (PCV), and haemoglobine (Hb) concentrations were determined by haemocytometric methods in blood samples collected on 30th day. Population of T lymphocyte was counted by the {alpha}-naphthyl acetate esterase (ANAE) staining method, and reticulocytes were counted by stereological method. The counts of RBC, WBC, and ANAE positive T lymphocyte, and the values of Hb, PCV, and MCHC were decreased in the Pb and Cd groups compared to control group. Also, the number of reticulocytes (polychromatofilic erythrocyte) increased in the Pb groups, whereas it decreased in the Cd group. On the other hand, these values were ceased by S. platensis in the treated groups. These results suggest that S. platensis supplementation may be useful in adjuvant treatment of leukemia and anemia caused by lead and cadmium toxication.

  8. Temperature, salinity, chlorophyll pigments, nutrients and other parameters as part of the ECOHAB-GOM: The Ecology and Oceanography of Toxic Alexandrium Blooms in the Gulf of Maine project (NODC Accession 0064309) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The subproject described here is one of several components of ECOHAB-GOM: The Ecology and Oceanography of Toxic Alexandrium Blooms in the Gulf of Maine, a multi-PI,...

  9. Chromium (VI) biosorption and removal of chemical oxygen demand by Spirulina platensis from wastewater-supplemented culture medium. (United States)

    Magro, Clinei D; Deon, Maitê C; De Rossi, Andreia; Reinehr, Christian O; Hemkemeier, Marcelo; Colla, Luciane M


    The inappropriate discharge of wastewater containing high concentrations of toxic metals is a serious threat to the environment. Given that the microalga Spirulina platensis has demonstrated a capacity for chromium VI (Cr (VI) biosorption, we assessed the ideal concentration of chromium-containing wastewater required for maximum removal of Cr (VI) and chemical oxygen demand (COD) from the environment by using this microalga. The Paracas and Leb-52 strains of S. platensis, with initial wastewater concentrations of 0%, 12.5%, 25%, and 50%, were cultured in Zarrouk medium diluted to 50% under controlled air, temperature, and lighting conditions. The cultures were maintained for 28 days, and pH, biomass growth, COD, and Cr (VI) were assessed. The wastewater concentration influenced microalgal growth, especially at high concentrations. Removal of 82.19% COD and 60.92% Cr (VI) was obtained, but the COD removal was greater than the Cr (VI) removal in both strains of S. platensis.

  10. Phytoremediation of kitchen wastewater by Spirulina platensis (Nordstedt Geiteler: pigment content, production variable cost and nutritional value

    Directory of Open Access Journals (Sweden)

    Siripen Traichaiyaporn1


    Full Text Available Phytoremediation of domestic wastewater by Spirulina platensis was carried out using kitchen wastewater. A complete randomised design (CRD was created for the experiment which was performed on modified Zarrouk’s medium (Zm, 100% kitchen wastewater (100%Kw and 90% kitchen wastewater (90%Kw. Water quality, biomass production, pigment content and nutritional value of Spirulina platensis were determined from cultures harvested every 5 days for a period of 15 days. The physico-chemical properties of cultivated wastewater were: water temperature 27-28 oC, pH 8.73-9.77 and DO 0.20-7.20 mg L-1. The 100%Kw and 90%Kw produced lower BOD, COD, TP, NH3-N, ON, TKN, NO3-N, NO2-N, TON and TN compared to Zm with p< 0.05. After cultivation, the treated kitchen wastewater met the standards for safe discharge in Thailand. The highest level of -carotene of S. platensis was achieved in Zm (0.29 mg g-1 and 100%Kw (0.29 mg g – 1 while the highest levels of C-phycocyanin were obtained in 100%Kw (17.95 mg g -1 and 90%Kw (16.31 mg g-1. The highest production variable cost for dry weight of S. platensis was in Zm (310.6 Baht kg -1 and 90%Kw (303.6 Baht kg -1 as compared to 100%Kw (276.6 Baht kg -1, with p<0.05. The highest biomass production of S. platensis was achieved in Zm (0.84 g L-1 and 100%Kw (0.82 g L-1, with protein content of 54.44% and 35.86%, respectively. Implications for the use of S. platensis for phytoremediation and C-phycocyanin production using of 100%Kw and 90% Kw are discussed.

  11. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases.

    Directory of Open Access Journals (Sweden)

    Antonella Marangoni

    Full Text Available The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli, in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml, against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.


    Directory of Open Access Journals (Sweden)

    M. G. MORAIS


    Full Text Available

    As microalgas, como Spirulina, podem ser fonte de proteínas para alimentação humana, com a possibilidade de obter outros produtos como biopigmentos, vitaminas e lipídios. A biomassa obtida pode ser introduzida diretamente na dieta podendo auxiliar em casos de desnutrição. O objetivo deste trabalho foi avaliar as características físico-química, sensorial e digestibilidade de biscoitos de chocolate enriquecidos com a microalga Spirulina platensis. Foram elaborados quatro biscoitos de chocolate: controle (sem Spirulina e biscoitos contendo 1,0; 3,0 e 5,0% de Spirulina platensis. O biscoito com adição de 5,0% de Spirulina platensis apresentou o conteúdo protéico 7,7% maior que o controle. Os biscoitos com adição de 1,0% de S. platensis apresentaram maior digestibilidade (86,9% que os demais. Volume específico, espessura e fator de expansão não foram alterados pela adição de Spirulina. Não houve diferença significativa entre o biscoito controle e os biscoitos com adição de 5,0% nos atributos cor, crocância, mastigabilidade e maciez. Na avaliação questionamento de intenção de compra, comparando os biscoitos com adição de S. platensis, a amostra com maior aceitação pelos julgadores foi com 1,0% de S. platensis.

  13. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases. (United States)

    Marangoni, Antonella; Foschi, Claudio; Micucci, Matteo; Nahui Palomino, Rogers Alberto; Gallina Toschi, Tullia; Vitali, Beatrice; Camarda, Luca; Mandrioli, Mara; De Giorgio, Marta; Aldini, Rita; Corazza, Ivan; Chiarini, Alberto; Cevenini, Roberto; Budriesi, Roberta


    The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli), in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml), against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.

  14. Compostos fenólicos totais, atividade antioxidante e antifúngica demultimisturas enriquecidas com a microalga Spirulina platensis


    Bierhals, Vânia da Silva; Machado, Vanessa Goulart; Echevenguá, Walesca Oliveira; Costa, Jorge Alberto Vieira; Furlong, Eliana Badiale


    Com o objetivo de avaliar o conteúdo fenólico e as atividades antioxidantes e antifúngicas de multimisturas enriquecidas com Spirulina platensis, foram formuladas quatro multimisturas com farelo de arroz ou trigo, duas contendo Spirulina platensis e duas com sementes de girassol. Os compostos fenólicos foram estimados pela técnica de Folin-Ciocalteau. A atividade antioxidante foi avaliada por meio de inibição do radical livre DPPH e a atividade antifúngica foi analisada por meio de ensaio de ...

  15. Epithermal neutron activation analysis of Spirulina platensis biomass, of the C-phycocianin and of DNA extracted from it

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pomyakushina, E.V.


    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration of 27 macro-, micro- and trace elements ranging from 10 -3 up to 10 4 ppm were determined. It was found that the biomass of Spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole Spirulina biomass with that of a refined C-phycocianin preparation was made

  16. Synthesis of CdSe nanoparticles and their effect on the antioxidant activity of Spirulina platensis and Porphyridium cruentum cells

    International Nuclear Information System (INIS)

    Rudic, V.; Cepoi, L.; Rudi, L.; Chiriac, T.; Nicorici, A.; Todosiciuc, A.; Gutsul, T.


    Single-crystalline cadmium selenide nanoparticles were obtained using high-temperature solution phase synthesis (HTSPS) synthesis. X-Ray powder diffraction and transmission electron microscopy were used to confirm the crystallinity and morphology of the resulting nanoparticles. To study the action of CdSe on antioxidant activity, we selected two biotechnological important strains of microalgae: cyanobacteria Spirulina platensis and red microalgae Porphyridium cruentum. In the case of Porphyridium cruentum, the obtained results demonstrated an increase in the productivity. For Spirulina platensis, the presence of the compound in the cultivating medium decreased the productivity of cyanobacteria.

  17. Epithermal Neutron Activation Analysis of Spirulina platensis Biomass, of the C-Phycocianin and of DNA Extracted from It

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Kirkesali, E I; Khizanishvili, A I; Pomyakushina, E V


    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration 27 macro-, micro- and trace elements ranging from 10^{-3} up to 10^{4} ppm were determined. It was found that the biomass of spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole spirulina biomass with that of a refined C-phycocianin preparation was made.

  18. Dynamics of gonadal development of Aegla platensis Schmitt (Decapoda, Anomura, Aeglidae Dinâmica do desenvolvimento gonadal de Aegla platensis Schmitt (Decapoda, Anomura, Aeglidae

    Directory of Open Access Journals (Sweden)

    Carolina C. Sokolowicz


    Full Text Available One way to estimate gonadal development through the reproductive cycle is to observe the growth of the gonads related to the organs used to store energy. The aim of this study was to follow the gonadosomatic and hepatosomatic indexes during annual cycle of Aegla platensis Schmitt, 1942. Adult animals were collected in Taquara, Rio Grande do Sul, Brazil (29°46'S, 50°53'W. Males and females were initially weighed and dissected and had their gonads and hepatopancreas (HP removed and weighed in order to estimate the Gonadosomatic (GI and hepatosomatic (HI indexes. In females, the indexes were also compared to the degree of development of the ovaries. In males the GI showed a peak of gonadal development in the autumn (p Uma maneira de estimar o desenvolvimento gonadal ao longo do ciclo reprodutivo é observar o crescimento das gônadas em relação aos órgãos utilizados para o estoque de energia. O objetivo desse estudo foi acompanhar os índices gonadossomático e hepatossomático durante o ciclo reprodutivo de Aegla platensis Schmitt, 1942. Animais adultos foram coletados em Taquara, Rio Grande do Sul, Brasil (29°46'S, 50°53'W. Machos e fêmeas foram pesados e dissecados, gônadas e hepatopâncreas (HP foram retirados e pesados para obtenção dos índices gonadossomático (IG e hepatossomático (IH. Nas fêmeas, os índices também foram comparados com o grau de desenvolvimento dos ovários. Nos machos o IG mostrou um pico de desenvolvimento gonadal no outono (p < 0,05, quando os valores do IH diminuíram (p < 0,05. Fêmeas mostraram um aumento do IG no final do verão e início do outono (p < 0,05 e os valores do IG aumentaram à medida que o ovário tornava-se maduro. Em A. platensis, tanto nos machos como nas fêmeas, os valores do IH nunca mostraram valores mais baixos que o IG, o que pode indicar que esses aeglídeos apresentam um padrão de utilização de energia diferente dos outros decápodos, onde à medida que o desenvolvimento

  19. La forja de Isidro Gomá como adalid del antirrepublicanismo en la Iglesia de España (1927-1933 Comment le cardinal Gomá devint le fer de lance de l’antirépublicanisme au sein de l’Église d’Espagne (1927-1933

    Directory of Open Access Journals (Sweden)

    Roberto Ceamanos Llorens


    Full Text Available Este artículo investiga la labor realizada por Isidro Gomá y Tomás al frente del obispado de Tarazona y Tudela (1927-1933. Gomá, arzobispo de Toledo y primado de la Iglesia de España (1933-1940, es una de las principales figuras por la que se han interesado los historiadores de la Guerra Civil española a causa del apoyo que concedió a los sublevados. Sin embargo, el período previo a su nombramiento como Primado permanece desconocido. En estas líneas se muestra como, durante su estancia en Tarazona, Gomá dirigió con mano firme su diócesis y, llegada la República, se enfrentó con contundencia a las reformas laicas, consolidándose como un referente fundamental en los medios integristas y antirrepublicanos católicos. Esta circunstancia llevó al Vaticano a pensar en él cuando decidió cubrir la vacante sede de Toledo.Cet article porte sur le travail réalisé par Isidro Gomá y Tomás lorsqu’il était à la tête de l’évêché de Tarazona et Tudela (1927-1933. Gomá, archevêque de Tolède et primat de l’Église d’Espagne (1933-1940, est l’une des figures principales à laquelle se sont intéressés les historiens de la guerre civile espagnole, notamment en raison de l’appui qu’il fournit aux révoltés. La période qui précéda sa nomination comme Primat reste toutefois méconnue. Les lignes qui suivent montrent comment Gomá a dirigé d’une main de fer son diocèse durant son séjour à Tarazona et comment il s’est radicalement opposé –après l’avènement de la République– aux réformes laïques, devenant ainsi un référent fondamental parmi les milieux intégristes et antirrépublicains catholiques. C’est d’ailleurs pour cela que le Vatican a pensé à lui lorsqu’il fallut pourvoir le siège de Tolède resté vacant.This article examines the work of Isidro Gomá y Tomás in the see of Tarazona and Tudela (1927-1933. Gomá, the archbishop of Toledo (1933-1940, is one of foremost personalities

  20. The Role of Gamma Irradiation on Growth and Some Metabolic Activities of Spirulina platensis

    International Nuclear Information System (INIS)

    Moussa, H.R.; El-Shaer, E.A.; Ismaiel, M.M.S.; Shabana, E.F.; Gabr, M.A.


    Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same trend for phycobiliproteins fractions. The photosynthetic activity and total carbohydrate content of the irradiated Spirulina cells increased with elevating the doses of gamma irradiation and reached a maximum value at a dose of 2.0 kGy as compared to the control. The activity of ribulose-1,5-bisphosphate-carboxylase/oxygenase (RUBISCO) was increased up to irradiation dose of 2.0 kGy. whereas, the maximum activity of the phosphoenol pyruvate carboxylase (PEPCASE) was recorded at the irradiation dose of 1.0 kGy Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same

  1. Influence of Spirulina platensis powder on the microflora of yoghurt and acidophilus milk

    Directory of Open Access Journals (Sweden)

    Metin Guldas


    Full Text Available The main purpose of this research was to monitor the influence of the powdered Cyanobacterium Spirulina platensis addition to plain yoghurt and the yoghurt containing Lactobacillus acidophiluson survival of the microbiota during the refrigerated storage. The cell viability of yoghurt starter cultures (Lactobacillus delbrueckii subsp. bulgaricus and Streptococcus thermophilus and Lactobacillus acidophilus under refrigeration conditions in yoghurts prepared with (0.5 or 1.0 (w/w % and without the addition of Spirulina powder was investigated. The yoghurts were prepared under hygienic laboratory conditions and their pH and acidity were controlled during the process. The samples of yoghurts were stored at 4 °C and investigated on days 1, 5, 10, 15, 20, 25 and 30. Viable counts of the lactic acid bacteria were above 6 cfu g-1of all “spirulina powder” added samples whereas control yoghurt samples contained lower lactic acid bacteria count at the end of the storage period. Addition of 1 % Spirulina platensis powder into the yoghurts did not cause significant differences on the viable lactic acid bacteria (p≤0.05. The results showed the positive effect of S. platensis powder on the survival of the lactic acid bacteria during storage of yoghurt (P≤0.05. The sensory analysis was also performed for the yoghurt samples. Sensory scores of 0.5 % spirulina powder added yoghurt samples were better than 1 % spirulina powder added ones. It was determined that spirulina powder added yoghurt is a good medium of lactic acid bacteria during the 30 days of refrigerated storage.

  2. C-phycocyanin extraction assisted by pulsed electric field from Artrosphira platensis. (United States)

    Martínez, Juan Manuel; Luengo, Elisa; Saldaña, Guillermo; Álvarez, Ignacio; Raso, Javier


    This paper assesses the application of pulsed electric fields (PEF) to the fresh biomass of Artrhospira platensis in order to enhance the extraction of C-phycocyanin into aqueous media. Electroporation of A. platensis depended on both electric field strength and treatment duration. The minimum electric field intensity for detecting C-phycocyanin in the extraction medium was 15kV/cm after the application of a treatment time 150μs (50 pulses of 3μs). However higher electric field strength were required when shorter treatment times were applied. Response surface methodology was used in order to investigate the influence of electric field strength (15-25kV/cm), treatment time (60-150μs), and temperature of application of PEF (10-40°C) on C-phycocyanin extraction yield (PEY). The increment of the temperature PEF treatment reduced the electric field strength and the treatment time required to obtain a given PEY and, consequently decreased the total specific energy delivered by the treatment. For example, the increment of temperature from 10°C to 40°C permitted to reduce the electric field strength required to extract 100mg/g d w of C-phycocyanin from 25 to 18kV/cm, and the specific energy input from 106.7 to 67.5kJ/Kg. Results obtained in this investigation demonstrated PEF's potential for selectively extraction C-phycocyanin from fresh A. platensis biomass. The purity of the C-phycocyanin extract obtained from the electroporated cells was higher than that obtained using other techniques based on the cell complete destruction. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Spirulina platensis: process optimization to obtain biomass Spirulina platensis: otimização de processo para a obtenção de biomassa

    Directory of Open Access Journals (Sweden)

    Iracema de Oliveira Moraes


    Full Text Available Spirulina platensis is a photoautotrophic mesophilic cyanobacterium. Its main sources of nutrients are nitrate, urea, and ammonium salts. Spirulina cultivation requires temperature, light intensity, and nutrient content control. This microalgae has been studied and used commercially due to its therapeutic and antioxidant potential. In addition, several studies have reported its ability to use CO2, its immune activity, and use as an adjuvant nutritive factor in the treatment of obesity. The objective of this study is the production of biomass of S. platensis using different rates of stirring, nitrogen source, amount of micronutrients, and luminosity. A 2(4 experimental design with the following factors: stirring (120 and 140 RPM, amount of nitrogen (1.5 and 2.5 g/L, amount of micronutrients (0,25 and 0,75 mL/L (11 and 15 W, and luminosity was used. Fermentation was performed in a 500 mL conical flask with 250 mL of culture medium and 10% inoculum in an incubator with controlled stirring and luminosity. Fermentation was monitored using a spectrophotometer (560 nm, and each fermentation lasted 15 days. Of the parameters studied, luminosity is the one with the highest significance, followed by the amount of nitrogen and the interaction between stirring and micronutrients. Maximum production of biomass for 15 days was 2.70 g/L under the following conditions: luminosity15W; stirring, 120 RPM; source of nitrogen, 1.5 g/L; and micronutrients, 0.75 mL/L.A Spirulina platensis é uma cianobactéria mesofílica, fotoautotrófica, que utiliza como nutrientes os nitratos, ureia e sais de amônio. O cultivo necessita de controle de temperatura, intensidade de luz e do teor de nutrientes utilizados. Esta microalga tem sido estuda pelo seu potencial nutricional, antioxidante, terapêutico e adjuvante em tratamento de obesidade. O objetivo deste trabalho foi a produção de biomassa de S. platensis em diferentes níveis de agitação, fonte de nitrog

  4. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates


    Nur Maulida Safitri; Endang Yuli Herawati; Jue Liang Hsu


    The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl) assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51) was identified and synthetized, w...

  5. Phyocyanin extraction from microalgae Spirulina platensis assisted by ultrasound irradiation: effect of time and temperature

    Directory of Open Access Journals (Sweden)



    Full Text Available This research was aimed to extract phycocyanin from microalgae Spirulina platensis using an extraction assisted by ultrasound irradiation. The extraction was conducted by using variable of extraction time, temperature and ultrasound frequency, while ethanol was used as solvent. The results show that the yield of phycocyanin extract was 15.97% at constant frequency of 42 kHz and 11.24% at constant frequency of 28 kHz, while the soxhlet extraction method obtained yield at 11.13%. The ultrasound could reduce the extraction time from 4 hrs (conventional to 20 minutes, while the optimum temperature of extraction was found at 55°C.

  6. Antioxidative effect of Arthrospira platensis biomass on the lipid oxidation| Efeito antioxidante da biomassa de Arthrospira platensis sobre a oxidação lipídica

    Directory of Open Access Journals (Sweden)

    Dayane Meireles de Souza


    Full Text Available Introduction: Cyanobacteria are promising natural sources of antioxidants. Environmental conditions that influence synthesis of substances in cultures of cyanobacteria have been studied. Objective: This investigation aimed to evaluate the antioxidative effect of Arthrospira platensis biomass on the process of lipid oxidation in bulk oil and oil/water emulsion. Method: Arthrospira platensis growth potential for antioxidant production under different cultivation conditions using an experimental design. The antioxidative effect of the methanolic extracts and the biomass on preventing lipid oxidation was measured by peroxide value (PV. Results: The results showed that the growing conditions to obtain the biomass promoted change in the protective ability of different biomass extracts. Extracts obtained from the cultivated biomass grown under 150 μmol photons/m2s-1, 1.875 g.L-1 NaNO3; 13.5 g.L-1 NaHCO3 (assay14 and 50 μmol photons/m2s-1, 2.5 g.L-1 NaNO3; 18.0 g.L-1 NaHCO3 (standard showed the most antioxidative effect on preventing lipid oxidation, therefore used in the formulation of mayonnaise. The mayonnaise made with soybean oil and 0.5% biomass was preserved against lipid photodegradation during seven days of storage, but the peroxide value related to control varied from 2.9 to 3.1 mEqO2.Kg-1, with no significant difference in the preservation afforded by tert-butilhydroquinone, in the same period of storage. In mayonnaise made with sunflower oil, biomass, independent of concentration, was unable to protect the product against photooxidation. Conclusions: The results demonstrate the protective ability on preventing lipid oxidation of Arthrospira platensis biomass and its potential for use in food lipid-based of soybean oil. ============================================== Introdução: Cianobactérias são promissoras fontes naturais de antioxidantes. Condições ambientais que influenciam síntese de substâncias em cultivos de cianobact

  7. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption (United States)

    Markou, Giorgos; Depraetere, Orily; Vandamme, Dries; Muylaert, Koenraad


    In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P) source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina) platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control). Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control. PMID:25690037

  8. New evidences on the presence of Stegomastodon platensis Ameghino, 1888, Proboscidea: Gomphotheriidae, in the Late Pleistocene of Central Chile

    Energy Technology Data Exchange (ETDEWEB)

    Labarca, R.; Alberdi, M.T.; Prado, J.L.; Mansilla, P.; Mourgues, F.A.


    This paper contextualizes, describes and taxonomically assigned cranial and dental Gomphotheriidae materials from the El Trebal 1, late Pleistocene form central Chile. Starting from metric and morphological variables fossils are included in Stegomastodon platensis. Taxonomic implications of this finding as well as some regional paleoenvironmental history are discussed. (Author)

  9. Anti-cancer effects of blue-green alga Spirulina platensis, a natural source of bilirubin-like tetrapyrrolic compounds

    Czech Academy of Sciences Publication Activity Database

    Koníčková, R.; Vaňková, K.; Vaníková, J.; Váňová, K.; Muchová, L.; Subhanová, I.; Zadinová, M.; Zelenka, Jaroslav; Dvořák, Aleš; Kolář, Michal; Strnad, Hynek; Rimpelová, S.; Ruml, T.; Wong, R.J.; Vítek, L.


    Roč. 13, č. 2 (2014), s. 273-283 ISSN 1665-2681 Institutional support: RVO:67985823 ; RVO:68378050 Keywords : bilirubin * chlorophyll * heme oxygenase * phycocyanin * phycocyanobilin * Spirulina platensis * tetrapyrroles Subject RIV: FD - Oncology ; Hematology Impact factor: 2.065, year: 2014

  10. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption

    Directory of Open Access Journals (Sweden)

    Giorgos Markou


    Full Text Available In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control. Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control.

  11. Antioxidant Potential of Spirulina platensis Mitigates Oxidative Stress and Reprotoxicity Induced by Sodium Arsenite in Male Rats (United States)

    Bashandy, Samir A. E.; El Awdan, Sally A.; Ebaid, Hossam; Alhazza, Ibrahim M.


    The present study aimed to examine the protective role of Spirulina platensis (S. platensis) against arsenic-induced testicular oxidative damage in rats. Arsenic (in the form of NaAsO2 at a dose of 6.3 mg/kg body weight for 8 weeks) caused a significant accumulation of arsenic in testicular tissues as well as a decrease in the levels of testicular superoxide dismutase (SOD), catalase (CAT), reduced glutathione, and zinc. Moreover, it significantly decreased plasma testosterone, luteinizing hormone (LH), triiodothyronine (T3), and thyroxine (T4) levels and reduced sperm motility and sperm count. Arsenic (AS) led to a significant increase in testicular malondialdehyde (MDA), tumour necrosis factor alpha (TNF-α), nitric oxide (NO), and sperm abnormalities. S. platensis at a dose of 300 mg/kg was found to attenuate As-induced oxidative stress, testicular damage, and sperm abnormalities by its potent antioxidant activity. S. platensis may represent a potential therapeutic option to protect the testicular tissue from arsenic intoxication. PMID:26881036

  12. Antioxidant Potential of Spirulina platensis Mitigates Oxidative Stress and Reprotoxicity Induced by Sodium Arsenite in Male Rats

    Directory of Open Access Journals (Sweden)

    Samir A. E. Bashandy


    Full Text Available The present study aimed to examine the protective role of Spirulina platensis (S. platensis against arsenic-induced testicular oxidative damage in rats. Arsenic (in the form of NaAsO2 at a dose of 6.3 mg/kg body weight for 8 weeks caused a significant accumulation of arsenic in testicular tissues as well as a decrease in the levels of testicular superoxide dismutase (SOD, catalase (CAT, reduced glutathione, and zinc. Moreover, it significantly decreased plasma testosterone, luteinizing hormone (LH, triiodothyronine (T3, and thyroxine (T4 levels and reduced sperm motility and sperm count. Arsenic (AS led to a significant increase in testicular malondialdehyde (MDA, tumour necrosis factor alpha (TNF-α, nitric oxide (NO, and sperm abnormalities. S. platensis at a dose of 300 mg/kg was found to attenuate As-induced oxidative stress, testicular damage, and sperm abnormalities by its potent antioxidant activity. S. platensis may represent a potential therapeutic option to protect the testicular tissue from arsenic intoxication.

  13. Bacterias halotolerantes/alcalofilas productoras de acido indol acético (AIA asociadas a Arthrospira platensis (Cyanophyceae

    Directory of Open Access Journals (Sweden)

    Liliana Cecilia Gómez Gómez


    Full Text Available Título en ingles: Halotolerant alkalophilic and indolacetic acid producing acid producing bacteria associated with Arthrospira platensis (Cyanophyceae Resumen: Este trabajo tuvo como propósito contribuir al conocimiento de la interacción entre la cianobacteria alcalófila Arthrospira platensis y las bacterias que crecen asociadas a su mucilago. Se desarrolló un  medio de cultivo heterotrófico en el cual se aislaron cinco cepas bacterianas asociadas a un monocultivo de A. platensis. Se determinó la capacidad de estas cinco cepas para producir ácido 3- indol acético (AIA. La tipificación molecular de los aislamientos bacterianos permitió identificarlos como Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str.  Kh10-101, Indibacter alkaliphilus, type str. LW1T; todas las cepas bacterianas obtenidas  son halotolerantes, alcalófilas y productoras de AIA. Los resultados aportan evidencia para sugerir una interacción benéfica entre A. platensis y sus bacterias asociadas,  quizá como estrategia evolutiva  de cooperación para desarrollarse en  un ambiente hipersalino.    Palabras claves: Bacillus okhensis, Exiguobacterium aurantiacum, Halomonas sp., Indibacter alkaliphilus. Xanthomonas sp. Abstract: The aim of this study was contribute to knowledge over alkalophilic cianobacteryum  Arthrospira platensis  and their  interaction with some associated bacteria growing in their mucilage. Heterotrophic culture medium was designed, in this medium were isolated five bacterial strains associated to single culture of A. platensis. It was measured the 3-indol acetic acid (IAA production by these bacterial strains. Molecular typing allowed identify these bacterial strains like Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str. Kh10-101, Indibacter alkaliphilus, type str. LW1T; all these bacteria are halotolerant

  14. Purification and Identification of Antioxidant Peptides from Enzymatic Hydrolysate of Spirulina platensis. (United States)

    Yu, Jie; Hu, Yuanliang; Xue, Mingxiong; Dun, Yaohao; Li, Shenao; Peng, Nan; Liang, Yunxiang; Zhao, Shumao


    The aim of this study was to isolate antioxidant peptides from an enzymatic hydrolysate of Spirulina platensis. A novel antioxidant peptide was obtained by ultrafiltration, gel filtration chromatography, and reverse-phase high-performance liquid chromatography, with the 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging assay used to measure the antioxidant activity, and the sequence was determined to be Pro-Asn-Asn (343.15 Da) by electrospray ionization tandem mass spectrometry. This peptide was synthesized to confirm its antioxidant properties, and it exhibited 81.44 ± 0.43% DPPH scavenging activity at 100 µg/ml, which was similar to that of glutathione (82.63 ± 0.56%). Furthermore, the superoxide anion and hydroxyl free-radical scavenging activities and the SOD activity of the peptide were 47.84 ± 0.49%, 54.01 ± 0.82%, and 12.55 ± 0.75%, respectively, at 10 mg/ml. These results indicate that S. platensis is a good source of antioxidant peptides, and that its hydrolysate may have important applications in the pharmaceutical and food industries.

  15. Synthesis of gold nanoparticles by blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Kalabegishvili, T.; Kirkesali, E.; Rcheulishvili, A.


    The synthesis of gold nanoparticles by one of the many popular microorganisms - blue-green algae Spirulina platensis was studied. The complex of optical and analytical methods was applied for investigation of experimental samples after exposure to chloroaurate (HAuCl 4 ) solution at different doses and for different time intervals. To characterize formed gold nanoparticles UV-vis, TEM, SEM, EDAX, and XRD were used. It was shown that after 1.5-2 days of exposure the extracellular formation of nanoparticles of spherical form and the distribution peak within the interval of 20-30 nm took place. To determine gold concentrations in the Spirulina platensis biomass, neutron activation analysis (NAA) and atomic absorption spectrometry (AAS) were applied. The results obtained evidence that the concentration of gold accumulated by Spirulina biomass is rapidly growing in the beginning, followed by some increase for the next few days. The obtained substance of Spirulina biomass with gold nanoparticles may be used for medical, pharmaceutical, and technological purposes

  16. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Selvaraj Karthick Raja Namasivayam


    Full Text Available Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  17. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Institute of Scientific and Technical Information of China (English)

    Duraisamy Jayakumar; Ramesh Kumar; Rajan SowriArvind Bharani


    Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  18. Biological Synthesis of Silver Nanoparticles by Cell-Free Extract of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Gaurav Sharma


    Full Text Available The present study explores biological synthesis of silver nanoparticles (AgNPs using the cell-free extract of Spirulina platensis. Biosynthesised AgNPs were characterised by UV-Vis spectroscopy, SEM, TEM, and FTIR analysis and finally evaluated for antibacterial activity. Extracellular synthesis using aqueous extract of S. platensis showed the formation of well scattered, highly stable, spherical AgNPs with an average size of 30–50 nm. The size and morphology of the nanoparticles were confirmed by SEM and TEM analysis. FTIR and UV-Vis spectra showed that biomolecules, proteins and peptides, are mainly responsible for the formation and stabilisation of AgNPs. Furthermore, the synthesised nanoparticles exhibited high antibacterial activity against pathogenic Gram-negative, that is, Escherichia coli, MTCC-9721; Proteus vulgaris, MTCC-7299; Klebsiella pneumoniae, MTCC-9751, and Gram-positive, that is, Staphylococcus aureus, MTCC-9542; S. epidermidis, MTCC-2639; Bacillus cereus, MTCC-9017, bacteria. The AgNPs had shown maximum zone of inhibition (ZOI that is 31.3±1.11 in P. vulgaris. Use of such a microalgal system provides a simple, cost-effective alternative template for the biosynthesis of nanomaterials of silver in a large scale that could be of great use in biomedical applications.

  19. Pão sem gluten enriquecido com a microalga Spirulina platensis Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Felipe da Silva Figueira


    Full Text Available Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha. Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães não sofreram alteração com a adição de até 4% da alga, porem mostraram redução de 22% nos valores de volume e aumento de 113% na dureza quando se adicionou-se 5% (em base de farinha. Quando comparados ao pão não enriquecido, a adição de Spiriulina platensis provocou uma melhoria da qualidade nutricional dos pães, confirmada pelo aumento significativo de 39,04% do conteúdo protéico, alem de vários aminoácidos essenciais (treonina, metionina, isoleucina e leucina. Com relação a cor, os pães com Spirulina apresentaram redução de luminosidade com o aumento de adição de microalga, sendo também observada tendência de aumento de tonalidade verde. Na avaliação sensorial, não se verificou diferença significativa quanto a preferência entre os pães adicionados com 3% e 5% de Spirulina na formulação.With the objective of offering a product for people with celiac disease, due to their gluten intolerance, gluten-free bread made with rice flour was elaborated, in substitution of the wheat flour. To increase the protein content of the bread, dried Spirulina platensis, a microalga, was added to the products in the range from 2 to 5% (flour basis. The bread samples were evaluated according to their specific volume (V/W, crumb hardness, measured with a texturometer, and the crumb color. It was shown that the specific volume and crumb hardness were not affected by the addition of up to 4% of alga, but a decrease of 22% in the

  20. Spirulina platensis effects on the levels of total cholesterol, HDL and triacylglycerols in rabbits fed with a hypercholesterolemic diet

    Directory of Open Access Journals (Sweden)

    Luciane Maria Colla


    Full Text Available In this work, hypercholesterolemia was induced in rabbits by feeding them a high cholesterol diet (CD, 350 mg/d and the effects of supplementing this diet with 0.5 g/d Spirulina platensis was evaluated by measuring the levels of serum total-cholesterol (TC, triacylglycerols (TAG and high-density lipoprotein (HDL-cholesterol at the start of the experiment and after 30 d and 60 d. It was found that the levels of serum cholesterol decreased from 1,054±101 mg.dL-1 in the rabbits fed a CD without S. platensis to 516±163 mg.dL-1 to those fed with a high cholesterol diet supplemented with S. platensis (significant at p A microalga Spirulina é cultivada e comercializada no mundo devido a suas características nutricionais (elevada concentração de proteínas, em torno de 65%, vitaminas e sais minerais e ao seu potencial terapêutico no tratamento de inúmeras doenças, inclusive a hipercolesterolemia. Neste trabalho foi avaliada a inibição da hipercolesterolemia induzida em coelhos por uma dieta adicionada de colesterol (350 mg.d-1, pela suplementação de 0,5 g.dia-1 de biomassa de Spirulina platensis, sendo avaliados os níveis de colesterol total, triglicerídeos e HDL nos tempos de 0 d, 30 d e 60 d de tratamento. Os resultados indicaram que a adição de Spirulina platensis na dieta ocasionou decréscimo nos níveis de colesterol total de 1054±101 mg.dL-1 para 516±163 mg.dL-1 (p<0,0001, para os coelhos alimentados com a dieta colesterolêmica em comparação com os que receberam a dieta adicionada de Spirulina platensis. A adição de Spirulina a dieta colesterolêmica não ocasionou decréscimo significativo nos níveis de triglicerídios dos coelhos. Os valores de HDL aumentaram de 73±31 mg.dL-1 para 91,0±15,7 mg.dL-1, comparando-se os coelhos alimentados com a dieta colesterolêmica e os alimentados com a dieta adicionada de Spirulina, estatisticamente diferentes a um nível de significância maior que 0,1533.

  1. Hallazgo de Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae en el estado brasileño de "Rio Grande do Sul" Finding of Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae in the Brazilian State of "Rio Grande do Sul"

    Directory of Open Access Journals (Sweden)

    Roberto Salvatella


    Full Text Available Triatoma platensis Neiva 1913 (Hemiptera, Triatominae, especie ornitófila, con área de dispersión conocida en Argentina, Bolivia, Paraguay y Uruguay es notificada en un primer registro para Brasil. Hallada en el municipio de Uruguaiana (Río Grande do Sul en nidos de Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae donde cohabitaba con cricétidos de la especie Orizomys flavescens. Ningún ejemplar de los siete colectados se presentó infectado por Trypanosoma cruzi.Triatoma platensis, an ornitophilic species, found in Argentina, Bolivia, Paraguay and Uruguay is reported for the first time in Brazil. It was found in the county of Uruguaiana (Rio Grande do Sul in nests of Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae where it cohabited with cricetids belonging to the species Orizomys flavescens. None of the seven individuals collected were infected by Trypanosoma cruzi.

  2. Microbial synthesis of silver nanoparticles by Streptomyces glaucus and Spirulina platensis

    International Nuclear Information System (INIS)

    Tsibakhashvili, N.Ya.; Kirkesali, E.I.; Pataraya, D.T.


    For the first time in Georgia a novel actinomycete strain Streptomyces glaucus 71 MD isolated from a soy rhizosphere has been used for microbial synthesis of silver nanoparticles. The Transmission Electron Microscopy (TEM) images revealed that most of the particles produced by these microorganisms from AgNO 3 are spherical-like in shape with an average size of 13 nm. The Scanning Electron Microscope (SEM) allowed one to observe extracellular synthesis of nanoparticles, which has many advantages from the point of view of applications. Production of silver nanoparticles proceeds extracellularly with the participation of another microorganism, blue-green microalgae Spirulina platensis. It is shown that the production rate of the nanoparticles depends not only on the initial concentration of AgNO 3 but also varies with time in a no monotonic way

  3. Experimental and modelling of Arthrospira platensis cultivation in open raceway ponds. (United States)

    Ranganathan, Panneerselvam; Amal, J C; Savithri, S; Haridas, Ajith


    In this study, the growth of Arthrospira platensis was studied in an open raceway pond. Furthermore, dynamic model for algae growth and CFD modelling of hydrodynamics in open raceway pond were developed. The dynamic behaviour of the algal system was developed by solving mass balance equations of various components, considering light intensity and gas-liquid mass transfer. A CFD modelling of the hydrodynamics of open raceway pond was developed by solving mass and momentum balance equations of the liquid medium. The prediction of algae concentration from the dynamic model was compared with the experimental data. The hydrodynamic behaviour of the open raceway pond was compared with the literature data for model validation. The model predictions match the experimental findings. Furthermore, the hydrodynamic behaviour and residence time distribution in our small raceway pond were predicted. These models can serve as a tool to assess the pond performance criteria. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Scavenging of peroxynitrite by phycocyanin and phycocyanobilin from Spirulina platensis: protection against oxidative damage to DNA. (United States)

    Bhat, V B; Madyastha, K M


    Peroxynitrite (ONOO(-)) is known to inactivate important cellular targets and also mediate oxidative damage in DNA. The present study has demonstrated that phycocyanin, a biliprotein from spirulina platensis and its chromophore, phycocyanobilin (PCB), efficiently scavenge ONOO(-), a potent physiological inorganic toxin. Scavenging of ONOO(-) by phycocyanin and PCB was established by studying their interaction with ONOO(-) and quantified by using competition kinetics of pyrogallol red bleaching assay. The relative antioxidant ratio and IC(50) value clearly indicate that phycocyanin is a more efficient ONOO(-) scavenger than PCB. The present study has also shown that PCB significantly inhibits the ONOO(-)-mediated single-strand breaks in supercoiled plasmid DNA in a dose-dependent manner with an IC(50) value of 2.9 +/- 0.6 microM. These results suggest that phycocyanin, has the ability to inhibit the ONOO(-)-mediated deleterious biological effects and hence has the potential to be used as a therapeutic agent. Copyright 2001 Academic Press.

  5. Microbiological decontamination of Spirulina Platensis and green coffee using accelerated electron beams

    International Nuclear Information System (INIS)

    Nemtanu, Monica R.; Brasoveanu, Mirela; Minea, R.; Mitru, Ecaterina; Grecu, Maria Nicoleta; Albulescu, Mihaela


    Biological raw materials can be contaminated with microorganisms and to make them suitable for commercialization, the quality relative to microbial content is necessary to be achieved. Irradiation is a decontamination method for numerous foodstuffs, being a feasible, very effective and environment friendly procedure. The aim of the paper is to evaluate the possibility to apply the electron beam treatment on Spirulina Platensis and green coffee for biological decontamination. The cyanobacterium Spirulina and green coffee have been irradiated with electron beams up to 40 kGy. To determine the microbial load, antioxidant activity, and rheological behaviour the techniques of electron paramagnetic resonance (EPR) and absorption spectroscopy have been applied. The results showed that accelerated electron beams could be efficient to decontaminate Spirulina as well as green coffee without significant changes in their properties. (authors)

  6. Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis


    Figueira, Felipe da Silva; Crizel, Tainara de Morais; Silva, Camila Rubira; Salas-Mellado, Myriam de las Mercedes


    Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha). Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães ...

  7. Proteomic analysis and qRT-PCR verification of temperature response to Arthrospira (Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Wang Huili

    Full Text Available Arthrospira (Spirulina platensis (ASP is a representative filamentous, non-N2-fixing cyanobacterium that has great potential to enhance the food supply and possesses several valuable physiological features. ASP tolerates high and low temperatures along with highly alkaline and salty environments, and can strongly resist oxidation and irradiation. Based on genomic sequencing of ASP, we compared the protein expression profiles of this organism under different temperature conditions (15°C, 35°Cand 45°C using 2-DE and peptide mass fingerprinting techniques. A total of 122 proteins having a significant differential expression response to temperature were retrieved. Of the positively expressed proteins, the homologies of 116 ASP proteins were found in Arthrospira (81 proteins in Arthrospira platensis str. Paraca and 35 in Arthrospira maxima CS-328. The other 6 proteins have high homology with other microorganisms. We classified the 122 differentially expressed positive proteins into 14 functions using the COG database, and characterized their respective KEGG metabolism pathways. The results demonstrated that these differentially expressed proteins are mainly involved in post-translational modification (protein turnover, chaperones, energy metabolism (photosynthesis, respiratory electron transport, translation (ribosomal structure and biogenesis and carbohydrate transport and metabolism. Others proteins were related to amino acid transport and metabolism, cell envelope biogenesis, coenzyme metabolism and signal transduction mechanisms. Results implied that these proteins can perform predictable roles in rendering ASP resistance against low and high temperatures. Subsequently, we determined the transcription level of 38 genes in vivo in response to temperature and identified them by qRT-PCR. We found that the 26 differentially expressed proteins, representing 68.4% of the total target genes, maintained consistency between transcription and

  8. Stable Isolation of Phycocyanin from Spirulina platensis Associated with High-Pressure Extraction Process

    Directory of Open Access Journals (Sweden)

    Kyung-Hwan Jung


    Full Text Available A method for stably purifying a functional dye, phycocyanin from Spirulina platensis was developed by a hexane extraction process combined with high pressure. This was necessary because this dye is known to be very unstable during normal extraction processes. The purification yield of this method was estimated as 10.2%, whose value is 3%–5% higher than is the case from another conventional separation method using phosphate buffer. The isolated phycocyanin from this process also showed the highest purity of 0.909 based on absorbance of 2.104 at 280 nm and 1.912 at 620 nm. Two subunits of phycocyanin namely α-phycocyanin (18.4 kDa and β-phycocyanin (21.3 kDa were found to remain from the original mixtures after being extracted, based on SDS-PAGE analysis, clearly demonstrating that this process can stably extract phycocyanin and is not affected by extraction solvent, temperature, etc. The stability of the extracted phycocyanin was also confirmed by comparing its DPPH (α,α-diphenyl-β-picrylhydrazyl scavenging activity, showing 83% removal of oxygen free radicals. This activity was about 15% higher than that of commercially available standard phycocyanin, which implies that the combined extraction method can yield relatively intact chromoprotein through absence of degradation. The results were achieved because the low temperature and high pressure extraction effectively disrupted the cell membrane of Spirulina platensis and degraded less the polypeptide subunits of phycocyanin (which is a temperature/pH-sensitive chromoprotein as well as increasing the extraction yield.

  9. Cultivation of Arthrospira (Spirulina platensis using confectionary wastes for aquaculture feeding

    Directory of Open Access Journals (Sweden)

    Hala Y. El-Kassas


    Full Text Available The microalga biomass production from confectionary effluent is a possible solution for the urgent need for a live food in aquaculture. Arthrospira (Spirulina platensis was the dominant alga in effluent of “Biscomisr a confectionary factory”, in Alexandria–Egypt. Therefore, it was isolated from the effluent samples and used throughout the study. The cyanobacterium, A. platensis was grown on the effluent using 22 Central Composite Design (22 CCD. This work addresses the best effluent dilution (WC, % as well as sodium bicarbonate concentration (SBC on the alga growth and biochemical composition. Total protein, carbohydrate, lipid contents and fatty acid profiles of the produced algal biomass were highly improved. The statistical analyses suggested that the main effect of (WC, % is significant negative influences on the algal contents of proteins, lipids and carbohydrates (p > 0.01. Although it had a significant positive influence on chlorophyll (p > 0.01, no significant effect on algal β carotenes (p > 0.05 had been reported. The inter action effect of SBC together with WC, % exerted a significant negative influence on the algal proteins (p > 0.01 and no significant effect on the other responses (p > 0.05. The produced alga biomass was used for feeding the rotifer, Brachionus plicatilis for further application in aquaculture. Growth rate, reproductive rate and fecundity attributes, fatty acid content of B. plicatilis were amended. The Pearson correlation test indicated that β carotenes displayed a highly positive significant correlation with the growth rate of B. plicatilis (r = 0.733, p < 0.01 and the carbohydrates showed significant positive correlations with Egg % (r = 0.657, p < 0.05.

  10. Role of pH on antioxidants production by Spirulina (Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Mostafa Mahmoud Sami Ismaiel


    Full Text Available Abstract Algae can tolerate a broad range of growing conditions but extreme conditions may lead to the generation of highly dangerous reactive oxygen species (ROS, which may cause the deterioration of cell metabolism and damage cellular components. The antioxidants produced by algae alleviate the harmful effects of ROS. While the enhancement of antioxidant production in blue green algae under stress has been reported, the antioxidant response to changes in pH levels requires further investigation. This study presents the effect of pH changes on the antioxidant activity and productivity of the blue green alga Spirulina (Arthrospira platensis. The algal dry weight (DW was greatly enhanced at pH 9.0. The highest content of chlorophyll a and carotenoids (10.6 and 2.4 mg/g DW, respectively was recorded at pH 8.5. The highest phenolic content (12.1 mg gallic acid equivalent (GAE/g DW was recorded at pH 9.5. The maximum production of total phycobiliprotein (159 mg/g DW was obtained at pH 9.0. The antioxidant activities of radical scavenging activity, reducing power and chelating activity were highest at pH 9.0 with an increase of 567, 250 and 206% compared to the positive control, respectively. Variation in the activity of the antioxidant enzymes superoxide dismutase (SOD, catalase (CAT and peroxidase (POD was also reported. While the high alkaline pH may favor the overproduction of antioxidants, normal cell metabolism and membrane function is unaffected, as shown by growth and chlorophyll content, which suggests that these conditions are suitable for further studies on the harvest of antioxidants from S. platensis.


    Directory of Open Access Journals (Sweden)

    Leilson Rocha Bezerr a


    Full Text Available The experiment was carried out in Maria Paz Ranch/SheepProduction Department, in São José de Espinharas, PB. Analyseswere performed in the Laboratory of Animal Nutrition/Centrode Saúde e Tecnologia Rural/Universidade Federal de CampinaGrande. The objectives of this study were to evaluate the effectof the supplementation with cow milk enriched with Spirulinaplatensis (Sp on lamb performance submitted to creep feeding,and determine the most adequate period to suplemet nursinglambs with Spirulina platensis. Data on dry matter (DMC andcrude protein (CPC consumptions, body weight (BW, and meandaily body weight gain (MDBWG were colleted. The three levelsof Spirulina supplementation were assigned to 30 lambs (plotsaccording to a randomized block (lamb weight design with 10replications. Data were collected in four consecutive periods,characterizing a split plot in time. DM and CP consumptions werenot affected by spirulina level x period interaction, and increasedwith periods (animal age. BW and MDBWG were affected bythe spirulina level x period interaction. Spirulina levels affectedMDBWG only from day 0 to day 15, when the MDBWG (300gwas higher at level 10g than at level zero of Spirulina that resulted in 205g in MDBWG. Live body weight at the end of each periodwas also higher when the lambs were supplemented with 10 g ofSpirulina (12.00 17.02, 19.71 and 25.30kg, respectively, for thefour consecutive periods. The dilution of Spirulina platensis incow milk showed to be efficient on the daily performance of lambswhen utilized in concentration of 10g/day and from period 15 to30 days of age.

  12. Supercritical Carbon Dioxide and Microwave-Assisted Extraction of Functional Lipophilic Compounds from Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Diego A. Esquivel-Hernández


    Full Text Available Arthrospira platensis biomass was used in order to obtain functional lipophilic compounds through green extraction technologies such as supercritical carbon dioxide fluid extraction (SFE and microwave-assisted extraction (MAE. The temperature (T factor was evaluated for MAE, while for SFE, pressure (P, temperature (T, and co-solvent (ethanol (CS were evaluated. The maximum extraction yield of the obtained oleoresin was (4.07% ± 0.14% and (4.27% ± 0.10% for SFE and MAE, respectively. Extracts were characterized by gas chromatography mass spectrometry (GC-MS and gas chromatography flame ionization detector (GC-FID. The maximum contents of functional lipophilic compounds in the SFE and MAE extracts were: for carotenoids 283 ± 0.10 μg/g and 629 ± 0.13 μg/g, respectively; for tocopherols 5.01 ± 0.05 μg/g and 2.46 ± 0.09 μg/g, respectively; and for fatty acids 34.76 ± 0.08 mg/g and 15.88 ± 0.06 mg/g, respectively. In conclusion, the SFE process at P 450 bar, T 60 °C and CS 53.33% of CO2 produced the highest yield of tocopherols, carotenoids and fatty acids. The MAE process at 400 W and 50 °C gives the best extracts in terms of tocopherols and carotenoids. For yield and fatty acids, the MAE process at 400 W and 70 °C produced the highest values. Both SFE and MAE showed to be suitable green extraction technologies for obtaining functional lipophilic compounds from Arthrospira platensis.

  13. UT-GOM2-1: Prospecting, Drilling and Sampling a Coarse-Grained Hydrate Reservoir in Green Canyon 955, the Deepwater Gulf of Mexico (United States)

    Flemings, P. B.; Phillips, S. C.


    In May 2017, a science team led by the University of Texas-Austin conducted drilling and coring operations from the Helix Q4000 targeting gas hydrates in sand-rich reservoirs in the Green Canyon 955 block in the northern Gulf of Mexico. The UT-GOM2-1 expedition goals were to 1) test two configurations of pressure coring devices to assess relative performance with respect to recovery and quality of samples and 2) gather sufficient samples to allow laboratories throughout the US to investigate a range of outstanding science questions related to the origin and nature of gas hydrate-bearing sands. In the first well (UT-GOM2-1-H002), 1 of the 8 cores were recovered under pressure with 34% recovery. In the second well (UT-GOM2-1-H005), 12 of 13 cores were recovered under pressure with 77% recovery. The pressure cores were imaged and logged under pressure. Samples were degassed both shipboard and dockside to interpret hydrate concentration and gas composition. Samples for microbiological and porewater analysis were taken from the depressurized samples. 21 3 ft pressure cores were returned to the University of Texas for storage, distribution, and further analysis. Preliminary analyses document that the hydrate-bearing interval is composed of two interbedded (cm to m thickness) facies. Lithofacies II is composed of sandy silt and has trough cross bedding whereas Lithofacies III is composed of clayey silt and no bedforms are observed. Lithofacies II has low density (1.7 to 1.9 g/cc) and high velocity (3000-3250 m/s) beds whereas Lithofacies 3 has high density ( 1.9-2.1g/cc) and low velocity ( 1700 m/s). Quantitative degassing was used to determine that Lithofacies II contains high hydrate saturation (66-87%) and Lithofacies III contains moderate saturation ( 18-30%). Gas samples were analyzed periodically in each experiment and were composed of primarily methane with an average of 94 ppm ethane and detectable, but not quantifiable, propane. The core data will provide a

  14. Pressurized liquid extracts from Spirulina platensis microalga Determination of their antioxidant activity and preliminary analysis by micellar electrokinetic chromatography


    Herrero, Miguel; Ibáñez, Elena; Señorans, F. Javier; Cifuentes, Alejandro


    In this work, different extracts from the microalga Spirulina platensis are obtained using pressurized liquid extraction (PLE) and four different solvents (hexane, light petroleum, ethanol andwater). Different extraction temperatures (115 and 170 ◦C) were tested using extraction times ranging from 9 to 15 min. The antioxidant activity of the different extracts is determined by means of an in vitro assay using a free radical method. Moreover, a new and fast method is developed using m...

  15. Carlos García Gual, Javier Gomá Lanzón, Fernando Savater. Muchas felicidades. Tres visiones y más de la idea de felicidad

    Directory of Open Access Journals (Sweden)

    Gabriel Laguna Mariscal


    Full Text Available Carlos García Gual, Javier Gomá Lanzón, Fernando Savater. Muchas felicidades. Tres visiones y más de la idea de felicidad. Madrid: Ariel, 2015, 207 pp. ISBN: 978-84-344-1892-9.

  16. Fed-batch strategy for enhancing cell growth and C-phycocyanin production of Arthrospira (Spirulina) platensis under phototrophic cultivation. (United States)

    Xie, Youping; Jin, Yiwen; Zeng, Xianhai; Chen, Jianfeng; Lu, Yinghua; Jing, Keju


    The C-phycocyanin generated in blue-green algae Arthrospira platensis is gaining commercial interest due to its nutrition and healthcare value. In this study, the light intensity and initial biomass concentration were manipulated to improve cell growth and C-phycocyanin production of A.platensis in batch cultivation. The results show that low light intensity and high initial biomass concentration led to increased C-phycocyanin accumulation. The best C-phycocyanin productivity occurred when light intensity and initial biomass concentration were 300μmol/m(2)/s and 0.24g/L, respectively. The fed-batch cultivation proved to be an effective strategy to further enhance C-phycocyanin production of A.platensis. The results indicate that C-phycocyanin accumulation not only requires nitrogen-sufficient condition, but also needs other nutrients. The highest C-phycocyanin content (16.1%), production (1034mg/L) and productivity (94.8mg/L/d) were obtained when using fed-batch strategy with 5mM medium feeding. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Spirulina platensis

    African Journals Online (AJOL)



    Aug 28, 2013 ... techniques for cultivation of useful microalgae ... cheaper nutritional sources such as ammonia and urea. (Bezerra et al., 2008; .... The analysis was conducted with .... tion effect was less marked with urea due to enzymatic.

  18. Influence of desalinator wastewater for the cultivation of Arthrospira platensis. Fatty acids profile

    Directory of Open Access Journals (Sweden)

    Volkmann, Harriet


    Full Text Available The need for a desalination processes in northeastern Brazil is due to the salinity of its water sources. However, these processes produce residues with high saline concentrations and a significant environmental impact. These wastewaters can be used for Arthrospira platensis cultivation. This work aimed to cultivate Arthrospira platensis in three different media: Paoletti Synthetic Medium (PSM, Salinated Water Medium (SWM and Desalinator Wastewater Médium (DWWM. Microalgae were cultivated under controlled conditions, in 4 L photobioreactors, 30±1°C, 12 hours of light/dark photoperiod provided by fluorescent lamps at a light intensity of 140 μmol• m–2•s–1 and constant bubbling of air (0.5 L•L–1 •min–1. The effect of different media on cell concentration, productivity, total content of lipids and fatty acids profile was verified. Higher cell concentration, as well as higher productivity was observed in DWWM: 4.954 (±0.554 g•L–1 and 0.225 (±0.042 g•L–1 •day–1, respectively. Concerning total lipids, the contents of 4.54% and 4.69% were observed in DWWM and SWM, respectively. High levels of saturated fatty acids were observed in both treatments. Concerning γ-linolenic acid, the contents of 13.09% (DWWM and 11.95% (SWM were found.En la región nordeste de Brasil, debido a la elevada salinidad de los acuíferos, existe la necesidad de utilizar procesos de desalación. Sin embargo, estos procesos generan residuos con alta concentración salina, con significativo impacto ambiental. El objetivo de este trabajo fue el cultivo de Arthrospira platensis en tres medios de cultivo diferentes: medio de Paoletti, medio de agua salinizada y medio de agua de desecho obtenida en el proceso de desalación de acuíferos. Las microalgas fueron cultivadas en laboratorio, con condiciones controladas, en fotobiorreactores de 4 L, a 30±1°C y periodos de 12 horas de claridad/oscuridad con iluminación de 140 μmol•m–2•s–1 e

  19. SOILS, FERTILIZATION AND MANAGEMENT OF WATER Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Liliana Gómez G


    Full Text Available Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibith better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.

  20. Induction of ovarian growth in Aegla platensis (Crustacea, Aeglidae by means of neuroregulators incorporated to food

    Directory of Open Access Journals (Sweden)

    Alejandra V Cahansky


    Full Text Available The freshwater crab Aegla platensis was used as a model to induce ovarian growth by adding different neuroregulators to a pellet food formulation. Added compounds were the dopaminergic inhibitor spiperone or the enkephalinergic inhibitor naloxone, both of them at a dose of 10-8 mol/animal. Animals were fed on the enriched pellets twice a week. After 7 wk, the gonadosomatic index (GI was calculated as (gonad fresh weight / body fresh weight x 100. GI significantly increased only for those females fed on spiperone pellets, compared to a control group receiving pellets with no compound added. During the assayed period, spiperone would be reverting the arrest exerted by dopamine on the neuroendocrine stimulation of ovarian growth. On the other hand, for both spiperone and naloxone a higher GI was correlated to a higher lipid content of both gonads and/or hepatopancreas, suggesting an increased energetic demand in accordance with an active investment in reproduction. Rev. Biol. Trop. 56 (3: 1201-1207. Epub 2008 September 30.Se utilizó al anomuro de agua dulce Aegla platensis como modelo para inducir el crecimiento ovárico mediante el agregado de diferentes neuroreguladores a una formulación de alimento pelleteado. Los compuestos agregados fueron el inhibidor dopaminergico spiperona ó el inhibidor encefalinérgico naloxone, ambos a una dosis de 10-8 moles/animal. Los animales fueron alimentados dos veces a la semana con pellets enriquecidos con alguno de los neuroreguladores. Luego de 7 semanas, se calculó el índice gonadomático (IG como (peso gonadal fresco/ peso corporal fresco x 100. El IG mostró un incremento significativamente sólo en aquellas hembras alimentadas con pellets enriquecidos con spiperona, en comparación con un grupo control que recibió pellets sin agregado alguno. Durante el período ensayado, la spiperona estaría revirtiendo el arresto ejercido por la dopamina sobre la estimulación neuroendocrina del crecimiento ov


    Directory of Open Access Journals (Sweden)



    Full Text Available This study aimed to evaluate the influence of S. platensis as a food supplement for Nile tilapia post-larvae. Two trials was running. In the first, was used two treatments, one offered freshwater microalgae (green water and other offered microalga S. platensis. In the second trial, were evaluated the effect of without copepods, administration of copepods alone and copepods enriched with S. platensis. Throughout the study, all animals were fed diets with masculinizing hormone 17-K-methyl-testosterone. It was evaluated the growth in weight and length, the survival rate and the rate of sex reversal of tilapia (mean +,- SD. In the first trial, the fish that received the S. platensis and receiving freshwater microalgae showed as result, 0.21 +,- 0.042 g; 2.50 +,- 0.091 cm; 97.5 ± 1,00% and 0.11 +,- 0.022 g; 1.91 +,- 0.419 cm; 98.33 +,- 0.70%, respectively. In the second trial, when the copepods were utilized, with and without S. platensis, the post-larvae as result, 0.221 ± 0.008 g; 2.70 ± 0.070 cm; 86.67 +,- 1.03% and 0.211 +,- 0.014 g; 2.56 ± 0.121 cm; 77.50 +,- 1.33%, respectively. The animals that received only commercial had as result, 0.190 +,- 0.008 g; 2.22 +,- 0.215 cm and 79.17 +,-0.21%. Using S. platensis resulted in better growth in weight and length, but did not affect survival and rates of sex reversal Nile tilapia post-larvae of exposed to natural food.

  2. Optimization of phycocyanin extraction from microalgae Spirulina platensis by sonication as antioxidant (United States)

    Dianursanti, Indraputri, Claudia Maya; Taurina, Zarahmaida


    Cardiovascular disease is known as an epidemic disease which has high casualty in the world. One of its trigger factors is the amount of reactive oxygen species (ROS) inside the body. In order to regulate its amount, antioxidant ingestion is compulsory. Microalgae can be adopted as a source of antioxidant. Spirulina platensis is one of the consistently produced microalgae. It contains phycocyanin, a blue pigment, which is known as a nutritious food agent. Phycocyanin could be assumed as an antioxidant and has been clinically validated both in vitro and in vivo. This research is proposed to determine the optimum extraction time. The experiment was conducted by sonication at 37 kHz using phosphate buffer as the solvent. The result exhibited that increasing the sonication time would increase the yield until it achieved the optimum yield. Based on the experiment, the optimum extraction time was 25 minutes with yield of 8.25 mg/g dry biomass and purity of 0.6. It can be summarized that extraction time also affected the extraction efficiency and its antioxidant activity. This paper shows a prospect on future development in cultivating micro flora in Indonesia, particularly in Depok.

  3. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    Directory of Open Access Journals (Sweden)

    Liliana CEPOI


    Full Text Available The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC, radical-scavenging activity by DPPH method (DPPH, antioxidant activity by the ABTS+ radical cation assay (ABTS, Folin-Ciocalteu reducing capacity (FCRC. We showed the presence of antioxidative substances in ethanol extractions from 2 species of cyanobacteria, and possibility to increase their activity varying ethanol concentration. It facilitates the extraction both water- and lipid-soluble components from biomass. Regarding used methods for antioxidative activity determination, we have used only those based on reaction of electrons return (which widely used nowadays in vitro. Obtained in different ways results demonstrate high reduction capacity of the extracts and possibility to select suitable analytical methods for each case.

  4. Spirulina platensis attenuates the associated neurobehavioral and inflammatory response impairments in rats exposed to lead acetate. (United States)

    Khalil, Samah R; Khalifa, Hesham A; Abdel-Motal, Sabry M; Mohammed, Hesham H; Elewa, Yaser H A; Mahmoud, Hend Atta


    Heavy metals are well known as environmental pollutants with hazardous impacts on human and animal health because of their wide industrial usage. In the present study, the role of Spirulina platensis in reversing the oxidative stress-mediated brain injury elicited by lead acetate exposure was evaluated. In order to accomplish this aim, rats were orally administered with 300 mg/kg bw Spirulina for 15 d, before and simultaneously with an intraperitoneal injection of 50 mg/kg bw lead acetate [6 injections through the two weeks]. As a result, the co-administration of Spirulina with lead acetate reversed the most impaired open field behavioral indices; however, this did not happen for swimming performance, inclined plane, and grip strength tests. In addition, it was observed that Spirulina diminished the lead content that accumulated in both the blood and the brain tissue of the exposed rats, and reduced the elevated levels of oxidative damage indices, and brain proinflammatory markers. Also, because of the Spirulina administration, the levels of the depleted biomarkers of antioxidant status and interleukin-10 in the lead-exposed rats were improved. Moreover, Spirulina protected the brain tissue (cerebrum and cerebellum) against the changes elicited by lead exposure, and also decreased the reactivity of HSP70 and Caspase-3 in both cerebrum and cerebellum tissues. Collectively, our findings demonstrate that Spirulina has a potential use as a food supplement in the regions highly polluted with heavy metals. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Improvement the Yoghurt Nutritional Value, Organoleptic Properties and Preferences by Spirulina (Spirulina platensis) Supplementation (United States)

    Suzery, M.; Hadiyanto; Sutanto, H.; Widiastuti, Y.; Judiono


    Spirulina sp has been identified as potential source food functional such as protein, amino acids and other high added value compounds from microalgae. One of the compounds is phycocyanin as also known for antioxidant use. This research was aimed to increase the nutritional value and organoleptic properties and preferences yoghurt by Spirulina platensis supplementation. Completely randomized controlled group design conducted by 31 respondents. Spirulina Research accomplished in Food Technology, Microbiology and Chemistry Laboratory at Bandung Health Polytechnic in Bandung. Samples divided randomly into three groups: (1) yoghurt standard supplemented 50 ml, (2) yoghurt and spirulina 1% supplemented 50 ml, (3) yoghurt and spirulina 1,2% supplemented 50 ml. Spirulina was added concentration by 0, 1, 1,2 % calculated by dx trial. Proximate analysis revealed the highest protein in enriched by spirulina 1%. However fat was lower 3.48 – 3.56 compare to control. All products found growing Lactobacillus acidophilus with a pH of 4.0 range. There was no microbial contamination such as E coli, Salmonella sp, Pseudomonas sp. Supplementation of spirulina to yoghurt products can be accepted by organoleptic, chemical and microbiological tests of concentrations of 1 and 1.2%. The material makes the blue colours more attractive and can be accepted by the expert panellist.

  6. Development of a chemically defined medium for the production of the antibiotic platensimycin by Streptomyces platensis. (United States)

    Falzone, Maria; Martens, Evan; Tynan, Heather; Maggio, Christian; Golden, Samantha; Nayda, Vasyl; Crespo, Emmanuel; Inamine, Gregory; Gelber, Michael; Lemence, Ryan; Chiappini, Nicholas; Friedman, Emily; Shen, Ben; Gullo, Vincent; Demain, Arnold L


    The actinomycete Streptomyces platensis produces two compounds that display antibacterial activity: platensimycin and platencin. These compounds were discovered by the Merck Research Laboratories, and a complex insoluble production medium was reported. We have used this medium as our starting point in our studies. In a previous study, we developed a semi-defined production medium, i.e., PM5. In the present studies, by varying the concentration of the components of PM5, we were able to develop a superior semi-defined medium, i.e., PM6, which contains a higher concentration of lactose. Versions of PM6, containing lower concentrations of all components, were also found to be superior to PM5. The new semi-defined production media contain dextrin, lactose, MOPS buffer, and ammonium sulfate in different concentrations. We determined antibiotic production capabilities using agar diffusion assays and chemical assays via thin-layer silica chromatography and high-performance liquid chromatography. We reduced crude nutrient carryover from the seed medium by washing the cells with distilled water. Using these semi-defined media, we determined that addition of the semi-defined component soluble starch stimulated antibiotic production and that it and dextrin could both be replaced with glucose, resulting in the chemically defined medium, PM7.

  7. Subcellular proteomic characterization of the high-temperature stress response of the cyanobacterium Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Cheevadhanarak Supapon


    Full Text Available Abstract The present study examined the changes in protein expression in Spirulina platensis upon exposure to high temperature, with the changes in expression analyzed at the subcellular level. In addition, the transcriptional expression level of some differentially expressed proteins, the expression pattern clustering, and the protein-protein interaction network were analyzed. The results obtained from differential expression analysis revealed up-regulation of proteins involved in two-component response systems, DNA damage and repair systems, molecular chaperones, known stress-related proteins, and proteins involved in other biological processes, such as capsule formation and unsaturated fatty acid biosynthesis. The clustering of all differentially expressed proteins in the three cellular compartments showed: (i the majority of the proteins in all fractions were sustained tolerance proteins, suggesting the roles of these proteins in the tolerance to high temperature stress, (ii the level of resistance proteins in the photosynthetic membrane was 2-fold higher than the level in two other fractions, correlating with the rapid inactivation of the photosynthetic system in response to high temperature. Subcellular communication among the three cellular compartments via protein-protein interactions was clearly shown by the PPI network analysis. Furthermore, this analysis also showed a connection between temperature stress and nitrogen and ammonia assimilation.

  8. Theoretical investigation of biomass productivities achievable in solar rectangular photobioreactors for the cyanobacterium Arthrospira platensis. (United States)

    Pruvost, Jeremy; Cornet, J F; Goetz, Vincent; Legrand, Jack


    Modeling was done to simulate whole-year running of solar rectangular photobioreactors (PBRs). Introducing the concept of ideal reactor, the maximal biomass productivity that could be achieved on Earth on nitrate as N-source was calculated. Two additional factors were also analyzed with respect to dynamic calculations over the whole year: the effect of PBR location and the effects of given operating conditions on the resulting decrease in productivity compared with the ideal one. Simulations were conducted for the cyanobacterium Arthospira platensis, giving an ideal productivity (upper limit) in the range 55-60 tX ha(-1) year(-1) for a sun tracking system (and around 35-40 tX ha(-1) year(-1) for a fixed horizontal PBR). For an implantation in France (Nantes, west coast), the modification in irradiation conditions resulted in a decrease in biomass productivity of 40%. Various parameters were investigated, with special emphasis on the influence of the incident angle of solar illumination on resulting productivities, affecting both light capture and light transfer inside the bulk culture. It was also found that with appropriate optimization of the residence time as permitted by the model, productivities close to maximal could be achieved for a given location. Copyright © 2012 American Institute of Chemical Engineers (AIChE).

  9. Nutritional control of antibiotic production by Streptomyces platensis MA7327: importance of l-aspartic acid. (United States)

    Falzone, Maria; Crespo, Emmanuel; Jones, Klarissa; Khan, Gulaba; Korn, Victoria L; Patel, Amreen; Patel, Mira; Patel, Krishnaben; Perkins, Carrie; Siddiqui, Sana; Stenger, Drew; Yu, Eileen; Gelber, Michael; Scheffler, Robert; Nayda, Vasyl; Ravin, Ariela; Komal, Ronica; Rudolf, Jeffrey D; Shen, Ben; Gullo, Vincent; Demain, Arnold L


    Streptomyces platensis MA7327 is a bacterium producing interesting antibiotics, which act by the novel mechanism of inhibiting fatty acid biosynthesis. The antibiotics produced by this actinomycete are platensimycin and platencin plus some minor related antibiotics. Platensimycin and platencin have activity against antibiotic-resistant bacteria such as methicillin-resistant Staphylococcus aureus and vancomycin-resistant Enterococcus; they also lack toxicity in animal models. Platensimycin also has activity against diabetes in a mouse model. We have been interested in studying the effects of primary metabolites on production of these antibiotics in our chemically defined production medium. In the present work, we tested 32 primary metabolites for their effect. They included 20 amino acids, 7 vitamins and 5 nucleic acid derivatives. Of these, only l-aspartic acid showed stimulation of antibiotic production. We conclude that the stimulatory effect of aspartic acid is due to its role as a precursor involved in the biosynthesis of aspartate-4-semialdehyde, which is the starting point for the biosynthesis of the 3-amino-2,4-dihydroxy benzoic acid portion of the platensimycin molecule.

  10. Protein production by Arthrospira (Spirulina platensis in solid state cultivation using sugarcane bagasse as support

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Pelizer


    Full Text Available The genus Arthrospira comprises a group of filamentous multicellular cyanobacteria and can be used for animal feed and human food. Solid state fermentation or cultivation (SSF involves the use of a culture medium composed of solid material with given moisture content. No studies have been published about the cultivation of microalgae or cyanobacteria on solid medium. Furthermore, although sugar-cane bagasse is used as source of energy in alcohol distilleries in Brazil, the excess could be a support to photosynthetic microorganism growth. The experimental design methodology was used to evaluate the protein production by Arthrospira platensis under SSF using sugarcane bagasse as support, taking into account the moisture content of the medium, light intensity and inoculum concentration. Moisture was found to have a strong influence on the performance of the process. The best conditions were: moisture of 98.8%; inoculum concentration of 0.15 g biomass·kg wet culture medium−1 and light intensity of 6.0 klx.

  11. Investigation of the interaction of chrome compounds with blue-green microalgae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Frontas'eva, M.V.; Pavlov, S.S.; Aksenova, N.G.


    The interaction of CrIII with the cells of blue-green microalgae Spirulina platensis in course of cultivation in a nutrient medium loaded with corresponding chrome compounds is studied. It is shown that the rate of absorption of CrVI ions by spirulina biomass from the nutrient medium is approximately two orders of magnitude lower as compared to that of CrIII ions. At the same time the presence of CrVI in a nutrient medium is accompanied by a significant decrease in the cell growth rate and by deteriorating the quality of spirulina biomass. It is established that at endogenous insertion of CrIII into the biocomplex of spirulina no change in the valence state of chromium in the nutrient medium is observed and the natural properties of the biomass do not change. On the basis of the obtained concentration dependences, the recommended doses of CrIII in the preparation 'Cr-Spirulina' within the ranges of 30-100 μg/g as a food addition, and 200-250 μg/g for a medical preventive treatment are determined. (author)

  12. Investigation of the Structure and Element Composition of C-Phycocyanin Extracted from the Microalgae Spirulina platensis

    CERN Document Server

    Mosulishvili, L M; Kirkesali, E I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F


    The structure and element composition of C-phycocyanin (C-PC) extracted from the blue-green alga Spirulina platensis were studied. The behavior of structural subunits forming phycobilisomes in the purification process was studied by capillary electrophoresis. Their proportion in high-purity C-PC was determined. The element composition of C-PC of different purity was studied by means of epithermal neutron activation analysis, and metals which may form macromolecular complexes with C-PC were determined (Zn, Cr, Ni, Co, As, Sr, Mo, Ag, Hg). It was shown that contents of toxic metals did not exceed accepted permissible levels for the human organism.

  13. Application of Epithermal Neutron Activation Analysis to Investigate Accumulation and Adsorption of Mercury by Spirulina platensis Biomass

    CERN Document Server

    Mosulishvili, L M; Khizanishvili, A I; Frontasyeva, M V; Kirkesali, E I; Aksenova, N G


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations \\sim 100 {\\mu}g/l.

  14. Application of epithermal neutron activation analysis to investigate accumulation and adsorption of mercury by Spirulina platensis biomass

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Kirkesali, E.I.; Aksenova, N.G.


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations ∼100 μg/1

  15. Removal of Nitrate and Phosphate from Municipal Wastewater Sludge by Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda

    Directory of Open Access Journals (Sweden)

    Jalal K.C.A


    Full Text Available Nitrate and phosphorus in wastewater contribute to health and environmental threats as they are linked to illnesses as well as ecosystem disruption via algal blooms in contaminated water bodies. Based on above perspectives a comparative study was conducted on three local freshwater microalgae:Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda to evaluate their effects on nitrate and phosphorus removal from municipal wastewater sludge (MWS. Algae performance in removing nitrate and phosphorus was evaluated by measuring nitrate and phosphorus content of MWS incubated with the strains for 7 days. Instantaneous readings were taken every 48 hours to determine periodic levels of the nutrients phosphate and nitrate. BOD5 was also evaluated to identify the strain with the most robust growth that would demand for oxygen the most in the dark. Spirulina platensis was shown as the most efficient microalgae to reduce nitrate in MWS and the best-growing among the three strains, while Chlorella vulgaris removed phosphorus the most effectively. Thus Spirulina and Chlorella could be potential candidates by showing their intrinsic merit for the reduction of phosphate and nitrate in wastewater treatment.ABSTRAK: Nitrat dan fosforus dalam air sisa menggugat kesihatan dan mengancam alam sekitar memandangkan ia berkait dengan penyakit-penyakit serta gangguan terhadap ekosistem melalui pembiakan alga dalam air yang tercemar. Berdasarkan perspektif di atas, satu kajian perbandingan telah dijalankan terhadap tiga mikro alga air tawar tempatan : Chlorella vulgaris, Spirulina platensis dan Scenedesmus quadricauda untuk dinilai kesannya terhadap penyingkiran nitrat dan fosforus dari enap cemar air sisa bandaran (municipal wastewater sludge (MWS. Kebolehan alga dalam penyingkiran nitrat dan fosforus dikaji dengan menyukat kandungan nitrat dan fosforus dalam MWS yang dieramkan dengan strain ini selama 7 hari. Bacaan serta-merta diambil setiap 48 jam untuk

  16. Diurnal changes of photosynthesis and growth of Arthrospira platensis cultured in a thin-layer cascade and an open pond

    Czech Academy of Sciences Publication Activity Database

    Benavides, A.M.S.; Ranglová, Karolína; Malapascua, José R.; Masojídek, Jiří; Torzillo, G.


    Roč. 28, DEC (2017), s. 48-56 ISSN 2211-9264 R&D Projects: GA MŠk(CZ) LO1416; GA MŠk EE2.3.30.0059 Grant - others:AV ČR(CZ) CNR-16-29 Program:Bilaterální spolupráce Institutional support: RVO:61388971 Keywords : Arthrospira platensis * Pond * Thin-layer cascade Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.994, year: 2016

  17. Protective effects of a polysaccharide from Spirulina platensis on dopaminergic neurons in an MPTP-induced Parkinson′s disease model in C57BL/6J mice

    Directory of Open Access Journals (Sweden)

    Fang Zhang


    Full Text Available The present study aimed to determine whether a polysaccharide obtained from Spirulina platensis shows protective effects on dopaminergic neurons. A Parkinson′s disease model was established through the intraperitoneal injection of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP in C57BL/6J mice. Prior to the MPTP injection, some mice were pretreated with intraperitoneal injections of a polysaccharide derived from Spirulina platensis once daily for 10 days. The results showed that the immunoreactive staining and mRNA expression of the dopamine transporter and tyrosine hydroxylase, the rate-limiting enzyme in dopamine synthesis, in the substantia nigra, were significantly increased in mice pretreated with 800 mg/kg of the polysaccharide compared with those in MPTP-treated mice. The activities of superoxide dismutase and glutathione peroxidase in the serum and midbrain were also increased significantly in mice injected with MPTP after pretreatment with the polysaccharide from Spirulina platensis. By contrast, the activity of monoamine oxidase B in serum and midbrain maintained unchanged. These experimental findings indicate that the polysaccharide obtained from Spirulina platensis plays a protective role against the MPTP-induced loss of dopaminergic neurons in C57BL/6J mice, and that the antioxidative properties of this polysaccharide likely underlie its neuroprotective effect.

  18. Application of Spirulina platensis for prevention of white spot syndrome virus in post larvae and juvenile black tiger shrimp (Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Hemtanon, P.


    Full Text Available In this study, the extract of Spirulina platensis were examined in vitro to inhibit white spot syndrome virus (WSSV and application of dry S. platensis in diet for prevention of white spot syndrome (WSS in post larvae and juvenile black tiger shrimp (Penaeus monodon. The results showed that the lowest concentration of the extract for inhibiting WSSV was 0.01 mg/ml, while the optimum concentration was found to be 0.1 mg/ ml in which the mortality rate of the shrimp was 4 percents and infection was not detected from survivalshrimp by the immunohistochemistry method.Furthermore, The results showed that the survival rate of the post larvae fed on steamed egg containing dry S. platensis 5 g/kg of diet was higher than that of the control (p<0.05 when challenged with WSSV and no WSSV infected shrimp examine by polymerase chain reaction (PCR assay. In the case of juvenile shrimp, the survival rate of shrimp fed pellets containing dry S. platensis 10 g/kg of diet was higher than that of the control group (p<0.05 after challenging with WSSV. Moreover percent of WSSV infection in the survival shrimp using the immunohistochemistry method was lower than that of the control group.

  19. Sequence of the gamma-subunit of Spirulina platensis : a new principle of thiol modulation of F0F1 ATP synthase?

    NARCIS (Netherlands)

    Steinemann, D.; Lill, H


    The gene encoding the gamma subunit of Spirulina platensis F0F1, the relative of the chloroplast F1 subunit responsible for thiol activation, has been cloned and sequenced. As in other cyanobacteria, a specific couple of cysteines like those involved in thiol modulation of the chloroplast enzyme was

  20. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis

    DEFF Research Database (Denmark)

    Pedersen, Morten Løbner; Walsted, Anette; Larsen, Rune


    The effect of consumption of Immulina, a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis, on adaptive immune responses was investigated by evaluation of changes in leukocyte responsiveness to two foreign recall antigens, Candida albicans (CA) and tetanus...

  1. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals

    Directory of Open Access Journals (Sweden)

    Radhakrishnan Ammu


    Full Text Available Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. Methods The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3 cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS. The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls. Results Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL. The extract reduced significantly (p Conclusions The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  2. Anti-Inflammatory Effects of Spirulina platensis Extract via the Modulation of Histone Deacetylases

    Directory of Open Access Journals (Sweden)

    Tho X. Pham


    Full Text Available We previously demonstrated that the organic extract of Spirulina platensis (SPE, an edible blue-green alga, possesses potent anti-inflammatory effects. In this study, we investigated if the regulation of histone deacetylases (HDACs play a role in the anti-inflammatory effect of SPE in macrophages. Treatment of macrophages with SPE rapidly and dose-dependently reduced HDAC2, 3, and 4 proteins which preceded decreases in their mRNA levels. Degradation of HDAC4 protein was attenuated in the presence of inhibitors of calpain proteases, lysosomal acidification, and Ca2+/calmodulin-dependent protein kinase II, respectively, but not a proteasome inhibitor. Acetylated histone H3 was increased in SPE-treated macrophages to a similar level as macrophages treated with a pan-HDAC inhibitor, with concomitant inhibition of inflammatory gene expression upon LPS stimulation. Knockdown of HDAC3 increased basal and LPS-induced pro-inflammatory gene expression, while HDAC4 knockdown increased basal expression of interleukin-1β (IL-1β, but attenuated LPS-induced inflammatory gene expression. Chromatin immunoprecipitation showed that SPE decreased p65 binding and H3K9/K14 acetylation at the Il-1β and tumor necrosis factor α (Tnfα promoters. Our results suggest that SPE increased global histone H3 acetylation by facilitating HDAC protein degradation, but decreases histone H3K9/K14 acetylation and p65 binding at the promoters of Il-1β and Tnfα to exert its anti-inflammatory effect.

  3. Composition and functional property of photosynthetic pigments under circadian rhythm in the cyanobacterium Spirulina platensis. (United States)

    Kumar, Deepak; Kannaujiya, Vinod K; Richa; Pathak, Jainendra; Sundaram, Shanthy; Sinha, Rajeshwar P


    Circadian rhythm is an important endogenous biological signal for sustainable growth and development of cyanobacteria in natural ecosystems. Circadian effects of photosynthetically active radiation (PAR), ultraviolet-A (UV-A) and ultraviolet-B (UV-B) radiations on pigment composition have been studied in the cyanobacterium Spirulina platensis under light (L)/dark (D) oscillation with a combination of 4/20, 8/16, 12/12, 16/8, 20/4 and 24/24 h time duration. Circadian exposure of PAR + UV-A (PA) and PAR + UV-A + UV-B (PAB) showed more than twofold decline in Chl a, total protein and phycocyanin (PC) in light phase and significant recovery was achieved in dark phase. The fluorescence emission wavelength of PC was shifted towards lower wavelengths in the light phase of PAB in comparison to P and PA whereas the same wavelength was retrieved in the dark phase. The production of free radicals was accelerated twofold in the light phase (24 h L) whereas the same was retrieved to the level of control during the dark phase. Oxidatively induced damage was alleviated by antioxidative enzymes such as catalase (CAT), peroxidase (POD), superoxide dismutase (SOD) and ascorbate peroxidase (APX) in the light phase (0-24-h L) whereas the dark phase showed significant inhibition of the same enzymes. Similar characteristic inhibition of free radicals and recovery of PC was observed inside cellular filament after circadian rhythm of 24/24 h (L/D). Circadian exposure of P, PA and PAB significantly altered the synthesis and recovery of pigments that could be crucial for optimization and sustainable production of photosynthetic products for human welfare.

  4. Construction of a Genome-Scale Metabolic Model of Arthrospira platensis NIES-39 and Metabolic Design for Cyanobacterial Bioproduction.

    Directory of Open Access Journals (Sweden)

    Katsunori Yoshikawa

    Full Text Available Arthrospira (Spirulina platensis is a promising feedstock and host strain for bioproduction because of its high accumulation of glycogen and superior characteristics for industrial production. Metabolic simulation using a genome-scale metabolic model and flux balance analysis is a powerful method that can be used to design metabolic engineering strategies for the improvement of target molecule production. In this study, we constructed a genome-scale metabolic model of A. platensis NIES-39 including 746 metabolic reactions and 673 metabolites, and developed novel strategies to improve the production of valuable metabolites, such as glycogen and ethanol. The simulation results obtained using the metabolic model showed high consistency with experimental results for growth rates under several trophic conditions and growth capabilities on various organic substrates. The metabolic model was further applied to design a metabolic network to improve the autotrophic production of glycogen and ethanol. Decreased flux of reactions related to the TCA cycle and phosphoenolpyruvate reaction were found to improve glycogen production. Furthermore, in silico knockout simulation indicated that deletion of genes related to the respiratory chain, such as NAD(PH dehydrogenase and cytochrome-c oxidase, could enhance ethanol production by using ammonium as a nitrogen source.

  5. Evaluation of the integrated hydrothermal carbonization-algal cultivation process for enhanced nitrogen utilization in Arthrospira platensis production. (United States)

    Yao, Changhong; Wu, Peichun; Pan, Yanfei; Lu, Hongbin; Chi, Lei; Meng, Yingying; Cao, Xupeng; Xue, Song; Yang, Xiaoyi


    Sustainable microalgal cultivation at commercial scale requires nitrogen recycling. This study applied hydrothermal carbonization to recover N of hot-water extracted Arthrospira platensis biomass residue into aqueous phase (AP) under different operation conditions and evaluated the N utilization, biomass yield and quality of A. platensis cultures using AP as the sole N source. With the increase of temperature at 190-210°C or reaction time of 2-3h, the N recovery rate decreased under nitrogen-repletion (+N) cultivation, while contrarily increased under nitrogen-limitation (-N) cultivation. Under +N biomass accumulation in the cultures with AP under 190°C was enhanced by 41-67% compared with that in NaNO3, and the highest protein content of 51.5%DW achieved under 200°C-2h was also 22% higher. Carbohydrate content of 71.4%DW under -N cultivation achieved under 210°C-3h was 14% higher than that in NaNO3. HTC-algal cultivation strategy under -N mode could save 60% of conventional N. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Spirulina platensis versus silymarin in the treatment of chronic hepatitis C virus infection. A pilot randomized, comparative clinical trial

    Directory of Open Access Journals (Sweden)

    Yakoot Mostafa


    Full Text Available Abstract Background Spirulina platensis, a cynobacterium used frequently as a dietary supplement had been found to exhibit many immune-stimulating and antiviral activities. It had been found to activate macrophages, NK cells, T cells, B cells, and to stimulate the production of Interferon gamma (IFN-γ and other cytokines. Natural substances isolated from Spirulina platensis had been found to be potent inhibitors against several enveloped viruses by blocking viral absorption/penetration and some replication stages of progeny viruses after penetration into cells. We aimed to study whether this dietary supplement possesses any therapeutically feasible activity worthy of further larger controlled clinical evaluation. Methods Sixty six patients with chronic hepatitis C virus infection and eligible for inclusion had been randomized to either Spirulina or Silymarin treated groups for a period of six months treatment. The two groups were followed up and blindly compared for early (after 3 months and end of 6 months treatment virological response. The effects of both treatments on each of alanine aminotransferase (ALT, Chronic Liver Disease Questionnaire scores (CLDQ, Arizona Sexual Experience Scale scores (ASEX and the occurrence of any attributable adverse events were also compared. Results Among the 30 patients who had been treated with Spirulina and completed the 6 months protocol, 4 patients (13.3% had a complete end of treatment virological response and 2 patients (6.7% had a partial end of treatment response defined as significant decrease of virus load of at least 2-logs10. Though the proportion of responders in Spirulina group was greater than in the Silymarin group, the difference was not statistically significant at the end of both 6 months (p = 0.12 and 3 months treatment (p = 0.22 by Exact test. Alanine aminotransferase as well as CLDQ and ASEX scores were found to be more significantly improved in Spirulina than in Silymarin treated group

  7. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals. (United States)

    Chu, Wan-Loy; Lim, Yen-Wei; Radhakrishnan, Ammu Kutty; Lim, Phaik-Eem


    Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3) cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control) at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH) or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS). The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls). Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL). The extract reduced significantly (p assay, the radical scavenging activity of the extract was higher than phycocyanin and was at least 50% of vitamin C and vitamin E. Based on the ABTS assay, the antioxidant activity of the extract at 50 μmug/mL was as good as vitamin C and vitamin E. The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  8. Optimization of Arthrospira platensis (Spirulina Growth: From Laboratory Scale to Pilot Scale

    Directory of Open Access Journals (Sweden)

    Florian Delrue


    Full Text Available Arthrospira platensis (Spirulina is the most cultivated microalga worldwide. Improving its cultivation in terms of biomass productivity, quality, or production cost could significantly impact the Spirulina industry. The objectives of this paper were defined as to contribute to this goal. Spirulina biomass productivity was investigated through medium choice. A modified Zarrouk’s medium was selected as it gave higher final dry weights and longer sustained growth than Hiri’s and Jourdan’s media. Then, in order to reduce Spirulina production cost, modified Zarrouk’s medium was rationalized by testing different dilutions. It was found that modified Zarrouk’s medium could be diluted up to five times without impacting the growth rates in a 28-days batch cultivation. Higher dry weights were even observed after 21 days of batch cultivation (1.21 g/L for 20%-modified Zarrouk’s medium in comparison to 0.84 g/L for modified Zarrouk’s medium. Iron uptake was then investigated as one of the major contributors to Spirulina nutritional quality. An increase in iron content was obtained by replacing iron sulfate by iron EDTA at a concentration of 10 mgFe/L (2.11 ± 0.13 mgFe/gbiomass for EDTA-FeNa, 3 H2O at 10 mgFe/L compared to 0.18 ± 0.13 for FeSO4,6H2O at 2 mgFe/L. Impact of light intensity on Spirulina biomass productivity was also investigated in a 2 L Photobioreactor (PBR. Specific growth rates were calculated for Photosynthetically Photon Flux Densities (PPFD from 85 to 430 µmol/m2/s. At 430 µmol/m2/s, photoinhibition was not observed and the specific growth rate was maximum (0.12/day. Finally, a 40-day cultivation experiment was conducted in a 1000 L PBR giving a maximum daily areal productivity of 58.4 g/m2/day. A techno-economic analysis gave production cost two to 20 times higher for PBR (from 18.71 to 74.29 €/kg than for open ponds (from 3.86 to 9.59 €/kg depending on Spirulina productivity.

  9. Morfoanatomia e ontogênese do fruto e semente de Vernonia platensis (Spreng. Less. (Asteraceae Morphology, anatomy and ontogeny of the fruit and seed of Vernonia platensis (Spreng. Less. (Asteraceae

    Directory of Open Access Journals (Sweden)

    Natália Arias Galastri


    Full Text Available Asteraceae possui cerca de 23.000 espécies e Vernonieae tem sua maior representatividade no Brasil, sendo Vernonia o maior gênero da tribo. Devido à ampla ocorrência nos Cerrados, V. platensis foi selecionada para a realização deste trabalho, que objetiva descrever a morfoanatomia e o desenvolvimento do pericarpo e da semente desta espécie, comparando os resultados com a literatura. O material coletado foi processado segundo técnicas usuais. O ovário é ínfero, bicarpelar, sincárpico, unilocular, com um óvulo anátropo, unitegumentado, tenuinucelado, formado em placentação basal. A parede ovariana é homogênea, com células mais densas perifericamente. O tegumento possui três regiões, destacando-se evidente endotélio. Na maturidade, a maioria das camadas colapsa, mantendo-se as fibras mesocárpicas externas; o pápus duplo persiste formado por células lignificadas. A semente madura apresenta testa restrita a uma faixa de células colapsadas; o endosperma é celular, persistindo residualmente na maturidade, e o embrião exibe eixo hipocótilo-radícula axial, espesso e curto. Em apenas 40% das cipselas maduras analisadas, há sementes completamente desenvolvidas. As observações deste trabalho corroboram pesquisas anteriores com Asteraceae, mas destaca-se o papel nutritivo do tegumento no desenvolvimento seminal e a baixa produção de sementes em V. platensis.The Asteraceae comprises approximately 23,000 species and Vernonieae is best represented in Brazil; Vernonia is the largest genus in this tribe. Due to occurrence in extensive areas of Cerrado, Vernonia platensis was selected for this work that aims to describe the morphology, anatomy and development of the pericarp and seed of this species, comparing the results with the literature. The collected material was processed by conventional techniques. The ovary is inferior, bicarpellate, syncarpous, unilocular with a single anatropous ovule, unitegmic, tenuinucelate

  10. GoM Diet Matrix (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set was taken from CRD 08-18 at the NEFSC. Specifically, the Gulf of Maine diet matrix was developed for the EMAX exercise described in that center...

  11. Towards Real-Time GOMS (United States)


    as possible, thinking aloud as he played. Gray videotaped KP performing this task to provide observed behavior against which to measure the...Lehman, J. F., Newell, A., Rosenblom, P. S., Simon , T., & Tessler, S. G. "Soar as a Unified Theory of Cognition: Spring 1990. in the Proceedings of the...Center Brown University Dr. Michael Blackburns User Interface Institute Department of Psychology Code 943 P.O. Box 704 Proience. RI 02912 Naval Ocean

  12. Recovery and Lithologic Analysis of Sediment from Hole UT-GOM2-1-H002, Green Canyon 955, Northern Gulf of Mexico (United States)

    Kinash, N.; Cook, A.; Sawyer, D.; Heber, R.


    In May 2017 the University of Texas led a drilling and pressure coring expedition in the northern Gulf of Mexico, UT-GOM2-01. The holes were located in Green Canyon Block 955, where the Gulf of Mexico Joint Industry Project Leg II identified an approximately 100m thick hydrate-filled course-grained levee unit in 2009. Two separate wells were drilled into this unit: Holes H002 and H005. In Hole H002, a cutting shoe drill bit was used to collect the pressure cores, and only 1 of the 8 cores collected was pressurized during recovery. The core recovery in Hole H002 was generally poor, about 34%, while the only pressurized core had 45% recovery. In Hole H005, a face bit was used during pressure coring where 13 cores were collected and 9 cores remained pressurized. Core recovery in Hole H005 was much higher, at about 75%. The type of bit was not the only difference between the holes, however. Drilling mud was used throughout the drilling and pressure coring of Hole H002, while only seawater was used during the first 80m of pressure cores collected in Hole H005. Herein we focus on lithologic analysis of Hole H002 with the goal of documenting and understanding core recovery in Hole H002 to compare with Hole H005. X-ray Computed Tomography (XCT) images were collected by Geotek on pressurized cores, mostly from Hole H005, and at Ohio State on unpressurized cores, mostly from Hole H002. The XCT images of unpressurized cores show minimal sedimentary structures and layering, unlike the XCT images acquired on the pressurized, hydrate-bearing cores. Only small sections of the unpressurized cores remained intact. The unpressurized cores appear to have two prominent facies: 1) silt that did not retain original sedimentary fabric and often was loose within the core barrel, and 2) dense mud sections with some sedimentary structures and layering present. On the XCT images, drilling mud appears to be concentrated on the sides of cores, but also appears in layers and fractures within

  13. Optimization growth of Spirulina platensis in bean sprouts extract medium with urea fertilizer for phycocyanin production as antioxidant (United States)

    Dianursanti, Taurina, Zarahmaida; Indraputri, Claudia Maya


    Spirulina platensis has the potential to be developed because of essential chemical compounds in the form of phycocyanin that can be used as an antioxidant. The growth of microalgae and phycocyanin depends on the availability of nutrition contained in culture medium. The cultivation will be carried out at 1 L reactor with continuous aeration, light intensity is 3000-4000 lux, and temperature is 27-30°C. Phycocyanin is obtained by liquid-liquid extraction method using phosphate buffer pH 7. Phycocyanin test performed by using UV-Vis spectrophotometry. The result show that the highest dry biomass is obtained on bean sprouts extract medium 8% (v/v) with the addition of urea fertilizer 120 ppm. The highest content of phycocyanin is obtained on bean sprouts extract medium 8% (v/v) with the addition of urea fertilizer 100 ppm with phycocyanin concentration of 257.12 mg/L.

  14. Determination of uranium in Toxodon Platensis' teeth from Alto Ribeira region in Sao Paulo State for isotope dating

    International Nuclear Information System (INIS)

    Figueiredo, Ana M.G.; Saiki, Mitiko; Sarkis, Jorge E.S.; Kakazu, Mauricio H.; Karmann, Ivo


    In the present work, the concentration of uranium in dentine and dental enamel of a pre-molar of Toxodon platensis (kind of herbivorous) from South America Quaternary, present in the region of Alto Ribeira, Sao Paulo, was determined, in order to date this fossil by using the ESR method (Electron Spin Resonance). The analytical techniques Epithermal Neutron Activation Analysis and High Resolution Inductively Coupled Plasma Mass Spectrometry were employed. The results obtained by using the two cited analytical techniques were in good agreement. These results, together with the data of total dose of deposed ionizing radiation and of the rate dose, allowed to find a ESR age of (6,7 +/- 1,3) Ka for the dentine, and of (5,0 +/- 1,6 Ka) for the dental enamel. Considering an average age of 6 Ka, this date corresponds to the Low to Medium Holocene, which is an unprecedented datum for this species in the southeastern region of Brazil. (author)

  15. Summer feeding ecology of Great Pampa-finches, Embernagra platensis at Laguna de Guaminí, Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    Laura M. Ferman


    Full Text Available The aim of this study was to assemble data on the summer feeding ecology of the Great Pampa-finch, Embernagra platensis at the Laguna de Guaminí, Buenos Aires, Argentina, and to explore the differences related to the dietary patterns for each sex between winter and summer when possible. The stomach contents of 43 birds were analyzed. The animal fraction was composed of Hymenoptera (45.1%, Coleoptera (32.4%, Lepidoptera (6.0%, Araneae (5% and Orthoptera (3.2%. The application of the index of relative importance (IRI resulted in 1490.4 for Coleoptera, 428.5 for Hymenoptera and 162.5 for Lepidoptera caterpillars. The vegetal fraction consisted of Triticum aestivum (26.9%, Cyperaceous (25%, Poaceae (Gramineae (19.3% and Panicum sp. (11.2%. The IRI values were 893.8 for Triticum aestivum, 174.5 for Gramineae, 126.5 for Panicum sp. and 112.8 for Scirpus sp. The food niche width was 0.33 for both sexes; the diversity index resulted in 1.06 for females and 1.33 for males and specific diversity ranged from 1.87 to 2.84. A canonical component analysis (CCA was performed on environmental and morphometric variables, and a Monte Carlo test confirmed the canonical correlations. A t-test showed that some birds harmonized with a logarithmic model and some with a geometric curve. During the summer, Embernagra platensis ingests Hymenoptera and Coleoptera more often than seeds, suggesting that two biological mechanisms could be taking place in this bird.O objetivo deste estudo foi reunir dados referentes à ecologia alimentar do Sabiá-do-banhado, Embernagra platensis, na laguna de Guaminí, Buenos Aires, Argentina, e explorar as diferenças relacionadas aos padrões dietéticos para cada sexo entre inverno e verão, quando possível. O conteúdo estomacal de 43 pássaros foi analisado. A fração animal foi composta por Hymenoptera (45,1%, Coleoptera (32,4%, Lepidoptera(6,0%, Araneae (5% e Orthoptera (3,2%. A aplicação do índice de importância relativa (IRI

  16. Evaluation of fuel properties for microalgae Spirulina platensis bio-diesel and its blends with Egyptian petro-diesel

    Directory of Open Access Journals (Sweden)

    Soha S.M. Mostafa


    In this study, the feasibility of biodiesel production from microalga Spirulina platensis has been investigated. The physico–chemical characteristics of the produced biodiesel were studied according to the standards methods of analysis (ASTM and evaluated according to their fuel properties as compared to Egyptian petro-diesel. Blends of microalgae biodiesel and petro-diesel (B2, B5, B10 and B20 were prepared on a volume basis and their physico–chemical characteristics have been also studied. The obtained results showed that; with the increase of biodiesel concentration in the blends; the viscosity, density, total acid number, initial boiling point, calorific value, flash point, cetane number and diesel index increase. While the pour point, cloud point, carbon residue and sulfur, ash and water contents decrease. The observed properties of the blends were within the recommended petro-diesel standard specifications and they are in favor of better engine performance.

  17. Effect of Supercritical Carbon Dioxide Extraction Parameters on the Biological Activities and Metabolites Present in Extracts from Arthrospira platensis. (United States)

    Esquivel-Hernández, Diego A; Rodríguez-Rodríguez, José; Cuéllar-Bermúdez, Sara P; García-Pérez, J Saúl; Mancera-Andrade, Elena I; Núñez-Echevarría, Jade E; Ontiveros-Valencia, Aura; Rostro-Alanis, Magdalena; García-García, Rebeca M; Torres, J Antonio; Chen, Wei Ning; Parra-Saldívar, Roberto


    Arthrospira platensis was used to obtain functional extracts through supercritical carbon dioxide extraction (SFE-CO₂). Pressure (P), temperature (T), co-solvent (CX), static extraction (SX), dispersant (Di) and dynamic extraction (DX) were evaluated as process parameters through a Plackett-Burman design. The maximum extract yield obtained was 7.48 ± 0.15% w/w. The maximum contents of bioactive metabolites in extracts were 0.69 ± 0.09 µg/g of riboflavin, 5.49 ± 0.10 µg/g of α-tocopherol, 524.46 ± 0.10 µg/g of β-carotene, 1.44 ± 0.10 µg/g of lutein and 32.11 ± 0.12 mg/g of fatty acids with 39.38% of palmitic acid, 20.63% of linoleic acid and 30.27% of γ-linolenic acid. A. platensis extracts had an antioxidant activity of 76.47 ± 0.71 µg GAE/g by Folin-Ciocalteu assay, 0.52 ± 0.02, 0.40 ± 0.01 and 1.47 ± 0.02 µmol TE/g by DPPH, FRAP and TEAC assays, respectively. These extracts showed antimicrobial activity against Staphylococcus aureus ATCC 25923, Pseudomonas aeruginosa ATCC 27853, Escherichia coli ATCC 25922 and Candida albicans ATCC 10231. Overall, co-solvent was the most significant factor for all measured effects ( p extraction parameters P: 450 bar, CX: 11 g/min, SX: 15 min, DX: 25 min, T: 60 °C and Di: 35 g.

  18. Experimental Substantiation of the Possibility of Developing Selenium- and Iodine-Containing Pharmaceuticals Based on Blue-Green Algae Spirulina Platensis

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Khisanishvili, L A; Frontasyeva, M V; Pavlov, C C; Gundorina, S F


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using -reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loding of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  19. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis. (United States)

    Mosulishvili, L M; Kirkesali, E I; Belokobylsky, A I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p) reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in S. platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterized. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  20. Equilibrium, thermodynamic and kinetic studies for the biosorption of aqueous lead(II), cadmium(II) and nickel(II) ions on Spirulina platensis

    Energy Technology Data Exchange (ETDEWEB)

    Seker, Ayseguel [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Shahwan, Talal [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Eroglu, Ahmet E. [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Yilmaz, Sinan [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Demirel, Zeliha [Department of Biology, Ege University, Bornova 35100, Izmir (Turkey)], E-mail:; Dalay, Meltem Conk [Department of Bioengineering, Ege University, Bornova 35100, Izmir (Turkey)], E-mail:


    The biosorption of lead(II), cadmium(II) and nickel(II) ions from aqueous solution by Spirulina platensis was studied as a function of time, concentration, temperature, repetitive reactivity, and ionic competition. The kinetic results obeyed well the pseudo second-order model. Freundlich, Dubinin Radushkevich and Temkin isotherm models were applied in describing the equilibrium partition of the ions. Freundlich isotherm was applied to describe the design of a single-stage batch sorption system. According to the thermodynamic parameters such as {delta}G{sup o}, {delta}H{sup o}and {delta}S{sup o} calculated, the sorption process was endothermic and largely driven towards the products. Sorption activities in a three metal ion system were studied which indicated that there is a relative selectivity of the biosorbent towards Pb{sup 2+} ions. The measurements of the repetitive reusability of S. platensis indicated a large capacity towards the three metal ions.

  1. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pavlov, S.S.; Gundorina, S.F.


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed

  2. Valores energéticos e composição química da espirulina (Spirulina platensis) avaliada com frangos de corte


    Alvarenga, Renata Ribeiro; Rodrigues, Paulo Borges; Cantarelli, Vinícius de Souza; Zangeronimo, Márcio Gilberto; Silva Júnior, José Walter da; Silva, Leonardo Rafael da; Santos, Luziane Moreira dos; Pereira, Luciano José


    The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis), the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME) and the apparent metabolizable energy corrected for nitrogen balance (AMEn) in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metab...

  3. Rapid mutation of Spirulina platensis by a new mutagenesis system of atmospheric and room temperature plasmas (ARTP and generation of a mutant library with diverse phenotypes.

    Directory of Open Access Journals (Sweden)

    Mingyue Fang

    Full Text Available In this paper, we aimed to improve the carbohydrate productivity of Spirulina platensis by generating mutants with increased carbohydrate content and growth rate. ARTP was used as a new mutagenesis tool to generate a mutant library of S. platensis with diverse phenotypes. Protocol for rapid mutation of S. platensis by 60 s treatment with helium driven ARTP and high throughput screening method of the mutants using the 96-well microplate and microplate reader was established. A mutant library of 62 mutants was then constructed and ideal mutants were selected out. The characteristics of the mutants after the mutagenesis inclined to be stable after around 9(th subculture, where the total mutation frequency and positive mutation frequency in terms of specific growth rate reached 45% and 25%, respectively. The mutants in mutant library showed diverse phenotypes in terms of cell growth rate, carbohydrate content and flocculation intensity. The positive mutation frequency in terms of cellular carbohydrate content with the increase by more than 20% percent than the wild strain was 32.3%. Compared with the wild strain, the representative mutants 3-A10 and 3-B2 showed 40.3% and 78.0% increase in carbohydrate content, respectively, while the mutant 4-B3 showed 10.5% increase in specific growth rate. The carbohydrate contents of the representative mutants were stable during different subcultures, indicating high genetic stability. ARTP was demonstrated to be an effective and non-GMO mutagenesis tool to generate the mutant library for multicellular microalgae.

  4. Separation, identification and quantification of carotenoids and chlorophylls in dietary supplements containing Chlorella vulgaris and Spirulina platensis using High Performance Thin Layer Chromatography. (United States)

    Hynstova, Veronika; Sterbova, Dagmar; Klejdus, Borivoj; Hedbavny, Josef; Huska, Dalibor; Adam, Vojtech


    In this study, 14 commercial products (dietary supplements) containing alga Chlorella vulgaris and cyanobacteria Spirulina platensis, originated from China and Japan, were analysed. UV-vis spectrophotometric method was applied for rapid determination of chlorophylls, carotenoids and pheophytins; as degradation products of chlorophylls. High Performance Thin-Layer Chromatography (HPTLC) was used for effective separation of these compounds, and also Atomic Absorption Spectrometry for determination of heavy metals as indicator of environmental pollution. Based on the results obtained from UV-vis spectrophotometric determination of photosynthetic pigments (chlorophylls and carotenoids), it was confirmed that Chlorella vulgaris contains more of all these pigments compared to the cyanobacteria Spirulina platensis. The fastest mobility compound identified in Chlorella vulgaris and Spirulina platensis using HPTLC method was β-carotene. Spectral analysis and standard calibration curve method were used for identification and quantification of separated substances on Thin-Layer Chromatographic plate. Quantification of copper (Cu 2+ , at 324.7 nm) and zinc (Zn 2+ , at 213.9nm) was performed using Flame Atomic Absorption Spectrometry with air-acetylene flame atomization. Quantification of cadmium (Cd 2+ , at 228.8 nm), nickel (Ni 2+ , at 232.0nm) and lead (Pb 2+ , at 283.3nm) by Electrothermal Graphite Furnace Atomic Absorption Spectrometry; and quantification of mercury (Hg 2+ , at 254nm) by Cold Vapour Atomic Absorption Spectrometry. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Development of cassava cake enriched with its own bran and Spirulina platensis - doi: 10.4025/actascitechnol.v34i4.10687

    Directory of Open Access Journals (Sweden)

    Meire Franci Polonio Navacchi


    Full Text Available The cassava cake was developed enriching it with a biomass of Spirulina platensis and a type of bran made out of its own starch. This biomass, a part from being rich in protein, also contains vitamins, essential fatty acids and minerals. Around Umuarama, in the State of Paraná, there is an agricultural/industrial complex annually producing and processing tons of cassava. Baked goods can be elaborated based in cassava as a way to expand the use of this raw material and to produce food free of gluten to celiac people. In this complex a solid byproduct is generated, which is rich in starch and fibres, and because of its low commercial value it is used for animal feed or discarded. The bran was dehydrated and analysed microbiologically as well as physically and chemically so as to be used in applied research. Developed energetic food based on cassava lacks protein, but this can be supplied by adding the biomass of Spirulina platensis. Different formulations of this cassava cake were developed varying the concentration of Spirulina platensis and cassava bran. The formulation that presented the best features received chocolate before being submitted to sensory tests by children in the public education system. The results show an excellent acceptance which made viable the development of this product because of aspects like nutrition, technology and sensorial.

  6. Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Gómez G. Liliana Cecilia


    Full Text Available

    Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibit better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.


    Directory of Open Access Journals (Sweden)

    Ricardo Lafaiete Moreira


    Full Text Available This study aimed to evaluate the Spirulina platensis influence as a food supplement in Nile tilapia post-larvae grown in saline water. The experiment consisted of two treatments with three replicates. In first one the animals were fed ration containing the androgen 17 α - methyltestosterone and S. platensis, and in the other only diet with the hormone. At the end of the reversal (28 days, tilapia that received S. platensis showed average weights of 1.17 ± 0.16 g, significantly superior to the animals fed only ration, which reached an average weight of 0.62 ± 0.38 g (P < 0.05; however, survival rates showed no significant difference (P < 0.05. At the end of the experiment (78 days, fish gonadal analysis showed indices of 47.5% of males for fish reared without microalgae and 59.09% for fish reared with S. platensis. It was conclude that Nile tilapia showed good growth and survival rate in the presence of S. platensis, compared to the fish fed only diet in saline water. However, it was not possible to obtain acceptable rates of sex reversal after the administration of masculinizing hormone through the diet.

  8. Culture Conditions stimulating high γ-Linolenic Acid accumulation by Spirulina platensis Condições de cultura simulando o levado acúmulo de ácido γ-linolênico por Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Srinivasa Reddy Ronda


    Full Text Available Gamma-linolenic acid (GLA production by Spirulina platensis under different stress-inducing conditions was studied. Submerged culture studies showed that low temperature (25ºC, strong light intensity (6 klux and primrose oil supplement (0.8%w/v induced 13.2 mg/g, 14.6 mg/g and 13.5 mg linolenic acid per gram dry cell weight respectively. A careful observation of fatty acid profile of the cyanobacteria shows that, oleic acid and linoleic acid, in experiments with varying growth temperature and oil supplements respectively, helped in accumulating excess γ-linolenic acid. In addition, cultures grown at increasing light regimes maintained the γ-linolenic acid to the total fatty acid ratio(GLA/TFA constant, despite any change in γ-linolenic acid content of the cyanobacteria.Estudou-se a produção de ácido γ-linolênico por Spirulina platensis em diferentes condições de estresse. Culturas submersas indicaram que temperatura baixa (25ºC, forte intensidade de luz (6 klux e suplementação com óleo de prímula (0,8% p/v induziram a produção de ácido linolênico de 13,2 mg/g, 14,6 mg/g e 13,5 mg/g peso seco, respectivamente. Uma observação cuidadosa do perfil de ácidos graxos da cianobacteria indica que os ácidos oléico e linoléico, em experimentos com diferentes temperaturas de crescimento e suplementos de óleo, auxiliaram no acúmulo de excesso de ácido γ-linolênico. Além disso, as culturas obtidas em intensidades crescentes de luz mantiveram a relação ácido γ-linolênico/ácidos graxos totais constante, independentemente de qualquer mudança no conteúdo de ácido γ-linolênico da cianobactéria.

  9. Molecular Cloning of cpcU and Heterodimeric Bilin Lyase Activity Analysis of CpcU and CpcS for Attachment of Phycocyanobilin to Cys-82 on the β-Subunit of Phycocyanin in Arthrospira platensis FACHB314

    Directory of Open Access Journals (Sweden)

    Fei Wu


    Full Text Available A new bilin lyase gene cpcU was cloned from Arthrospira platensis FACHB314 to study the assembly of the phycocyanin β-Subunit. Two recombinant plasmids, one contained the phycocyanobilin (PCB producing genes (hoxI and pcyA, while the other contained the gene of the β-Subunit of phycobiliprotein (cpcB and the lyase gene (cpcU, cpcS, or cpcU/S were constructed and separately transferred into Escherichia coli in order to test the activities of relevant lyases for catalyzing PCB addition to CpcB during synthesizing fluorescent β-PC of A. platensis FACHB314. The fluorescence intensity examination showed that Cys-82 maybe the active site for the β-Subunit binding to PCBs and the attachment could be carried out by CpcU, CpcS, or co-expressed cpcU/S in A. platensis FACHB314.

  10. Functional Lycopene Cyclase (CruA) in Cyanobacterium, Arthrospira platensis NIES-39, and its Role in Carotenoid Synthesis. (United States)

    Sugiyama, Kenjiro; Ebisawa, Masashi; Yamada, Masaharu; Nagashima, Yoshiki; Suzuki, Hideyuki; Maoka, Takashi; Takaichi, Shinichi


    The genus Arthrospira is filamentous, non-nitrogen-fixing cyanobacteria that is commercially important. We identified the molecular structures of carotenoids in Arthrospira platensis NIES-39. The major carotenoid identified was β-carotene. In addition, the hydroxyl derivatives of β-cryptoxanthin and (3R,3'R)-zeaxanthin were also found to be present. The carotenoid glycosides were identified as (3R,2'S)-myxol 2'-methylpentoside and oscillol 2,2'-dimethylpentoside. The methylpentoside moiety was a mixture of fucoside and chinovoside in an approximate ratio of 1 : 4. Trace amounts of the ketocarotenoid 3'-hydroxyechinenone were also found. Three types of lycopene cyclases have been functionally confirmed in carotenogenesis organisms. In cyanobacteria, the functional lycopene cyclases (CrtL, CruA and CruP) have only been found in four species. In this study, we found that CruA exhibited lycopene cyclase activity in transformed Escherichia coli, which contains lycopene, but CruP exhibited no lycopene cyclase activity and crtL was absent. This is the third cyanobacterial species in which CruA activity has been confirmed. Neurosporene was not a substrate of CruA in E. coli, whereas lycopene cyclases of CrtY (bacteria), CrtL (plants) and CrtYB (fungi) have been reported to convert neurosporene to 7,8-dihydro-β-carotene. β-Carotene hydroxylase (CrtR) was found to convert β-carotene to zeaxanthin in transformed E. coli, which contains β-carotene. Among the β-carotene hydroxylases, bacterial CrtZ and eukaryotic CrtR and BCH have similarities, whereas cyanobacterial CrtR appears to belong to another clade. Based on the identification of the carotenoids and the completion of the entire nucleotide sequence of the A. platensis NIES-39 genome, we propose a biosynthetic pathway for the carotenoids as well as the corresponding genes and enzymes. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved

  11. Mutant strains of Spirulina (Arthrospira) platensis to increase the efficiency of micro-ecological life support systems (United States)

    Brown, Igor

    The European Micro-Ecological Life Support System Alternative (MELiSSA) is an advanced idea for organizing a bioregenerative system for long term space flights and extraterrestrial settlements (Hendrickx, De Wever et al., 2005). Despite the hostility of both lunar and Martian environments to unprotected life, it seems possible to cultivate photosynthetic bacteria using closed bioreactors illuminated and heated by solar energy. Such reactors might be employed in critical processes, e.g. air revitalization, foodcaloric and protein source, as well as an immunomodulators production. The MELiSSA team suggested cyanobacterium Spirulina as most appropriate agent to revitalize air and produce a simple "fast" food. This is right suggestion because Spirulina was recently shown to be an oxygenic organism with the highest level of O2 production per unit mass (Ananyev et al., 2005). Chemical composition of Spirulina includes proteins (55Aiming to make Spirulina cultivation in life support systems like MELiSSA more efficient, we selected Spirulina mutant strains with increased fraction of methionine in the biomass of this cyanobacterium and compared the effect of parental wild strain of Spirulina and its mutants on the tendency of such experimental illnesses as radiationinduced lesions and hemolythic anemia. Results: It was found that mutant strains 198B and 27G contain higher quantities of total protein, essential amino acids, c-phycocyanin, allophycocyanin and chlorophyll a than parental wild strain of S. platensis. The strain 198B is also characterized with increased content of carotenoids. Revealed biochemical peculiarities of mutant strains suggest that these strains can serve as an additional source of essential amino acids as well as phycobiliproteins and carotenoids for the astronauts. Feeding animals suffering from radiation-induced lesions, c-phycocyanin, extracted from strain 27G, led to a correction in deficient dehydrogenase activity and energy-rich phosphate levels

  12. Pressurized liquid extracts from Spirulina platensis microalga. Determination of their antioxidant activity and preliminary analysis by micellar electrokinetic chromatography. (United States)

    Herrero, Miguel; Ibáñez, Elena; Cifuentes, Alejandro; Señoráns, Javier


    In this work, different extracts from the microalga Spirulina platensis are obtained using pressurized liquid extraction (PLE) and four different solvents (hexane, light petroleum, ethanol and water). Different extraction temperatures (115 and 170 degrees C) were tested using extraction times ranging from 9 to 15 min. The antioxidant activity of the different extracts is determined by means of an in vitro assay using a free radical method. Moreover, a new and fast method is developed using micellar electrokinetic chromatography with diode array detection (MEKC-DAD) to provide a preliminary analysis on the composition of the extracts. This combined application (i.e., in vitro assays plus MEKC-DAD) allowed the fast characterization of the extracts based on their antioxidant activity and the UV-vis spectra of the different compounds found in the extracts. To our knowledge, this work shows for the first time the great possibilities of the combined use of PLE-in vitro assay-MEKC-DAD to investigate natural sources of antioxidants.

  13. Possible role of Arthrospira platensis in reversing oxidative stress-mediated liver damage in rats exposed to lead. (United States)

    Khalil, Samah R; Elhady, Walaa M; Elewa, Yaser H A; Abd El-Hameed, Noura E; Ali, Sozan A


    Environmental pollutants, particularly metallic elements, mobilized and released into the environment, eventually accumulate in the food chain and thus pose a serious threat to human and animal health. In the present study, the role of Arthrospira (Spirulina platensis; SP) as a protector against oxidative stress-mediated liver damage induced by an exposure to lead acetate (LA; as a metallic pollutant) was assessed. To achieve this aim, rats were orally administered with 300 mg/kg bw SP for 15 days, before and concurrently with an intraperitoneal injection of 50 mg/kg bw LA (6 injections throughout 15 days). As a result, co-administration of SP with LA reduced the amount of lead that accumulated in both blood and liver tissue of the exposed rats and minimized the increased levels of lipid peroxidation, protein oxidation, DNA oxidative damage, and liver enzyme endpoints. In addition, because of SP administration, the levels of depleted biomarkers of antioxidant status and total antioxidant capacity in LA-exposed rats improved. Moreover, SP protected the liver tissue against the changes caused by LA exposure and also decreased the reactivity of HSP70 in the cytoplasm of hepatocytes. Collectively, our data suggest that SP has a potential use as a food supplement in the regions highly polluted with heavy metals such as lead. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  14. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis. (United States)

    Yang, Fang; Wong, Ka-Hing; Yang, Yufeng; Li, Xiaoling; Jiang, Jie; Zheng, Wenjie; Wu, Hualian; Chen, Tianfeng


    Tellurium-containing phycocyanin (Te-PC) and allophycocyanin (Te-APC), two organic tellurium (Te) species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 μg g(-1) protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropane)dihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress.

  15. In vitro antioxidant and antiproliferative activities of selenium-containing phycocyanin from selenium-enriched Spirulina platensis. (United States)

    Chen, Tianfeng; Wong, Yum-Shing


    Both selenium and phycocyanin have been reported to show potent cancer chemopreventive activities. In this study, we investigated the in vitro antioxidant and antiproliferative activities of selenium-containing phycocyanin (Se-PC) purified from selenium-enriched Spirulina platensis. The antioxidant activity of Se-PC was evaluated by using four different free radical scavenging assays, namely, the 2,2'-azinobis-3-ethylbenzothiazolin-6-sulfonic acid (ABTS) assay, 1,1-diphenyl-2-picryhydrazyl (DPPH) assay, superoxide anion scavenging assay, and erythrocyte hemolysis assay. The results indicated that Se-PC exhibited stronger antioxidant activity than phycocyanin by scavenging ABTS, DPPH, superoxide anion, and 2,2'-azobis-(2-amidinopropane)dihydrochloride free radicals. Se-PC also showed dose-dependent protective effects on erythrocytes against H 2O 2-induced oxidative DNA damage as evaluated by the Comet assay. Moreover, Se-PC was identified as a potent antiproliferative agent against human melanoma A375 cells and human breast adenocarcinoma MCF-7 cells. Induction of apoptosis in both A375 and MCF-7 cells by Se-PC was evidenced by accumulation of sub-G1 cell populations, DNA fragmentation, and nuclear condensation. Further investigation on intracellular mechanisms indicated that depletion of mitochondrial membrane potential (DeltaPsi m) was involved in Se-PC-induced cell apoptosis. Our findings suggest that Se-PC is a promising organic Se species with potential applications in cancer chemoprevention.

  16. Value added by Spirulina platensis in two different diets on growth performance, gut microbiota, and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Mohamed S. Yusuf


    Full Text Available Aim: The growth promoting effect of the blue-green filamentous alga Spirulina platensis (SP was observed on meat type Japanese quail with antibiotic growth promoter alternative and immune enhancing power. Materials and Methods: This study was conducted on 180 Japanese quail chicks for 4 weeks to find out the effect of diet type (vegetarian protein diet [VPD] and fish meal protein diet [FMPD]- Spirulina dose interaction (1 or 2 g/kg diet on growth perfor-mance, gut microbiota, and sensory meat quality of growing Japanese quails (1-5 weeks old. Results: Data revealed improvement (p<0.05 of weight gain, feed conversion ratio and European efficiency index due to 1, 2 g (SP/kg VPD, and 2 g (SP/kg FMPD, respectively. There was a significant decrease of ileum mean pH value by 1 g (SP/kg VPD. Concerning gut microbiota, there was a trend toward an increase in Lactobacilli count in both 1; 2 g (SP/kg VPD and 2 g (SP/kg FMPD. It was concluded that 1 or 2 g (SP/kg vegetarian diet may enhance parameters of performance without obvious effect on both meat quality and gut microbiota. Moreover, 1 and/or 2 g (SP may not be invited to share fish meal based diet for growing Japanese quails. Conclusion: Using of SP will support the profitable production of Japanese quails fed vegetable protein diet.

  17. Higher adsorption capacity of Spirulina platensis alga for Cr(VI) ions removal: parameter optimisation, equilibrium, kinetic and thermodynamic predictions. (United States)

    Gunasundari, Elumalai; Senthil Kumar, Ponnusamy


    This study discusses about the biosorption of Cr(VI) ion from aqueous solution using ultrasonic assisted Spirulina platensis (UASP). The prepared UASP biosorbent was characterised by Fourier transform infrared spectroscopy, X-ray diffraction, Brunauer-Emmet-Teller, scanning electron spectroscopy and energy dispersive X-ray and thermogravimetric analyses. The optimum condition for the maximum removal of Cr(VI) ions for an initial concentration of 50 mg/l by UASP was measured as: adsorbent dose of 1 g/l, pH of 3.0, contact time of 30 min and temperature of 303 K. Adsorption isotherm, kinetics and thermodynamic parameters were calculated. Freundlich model provided the best results for the removal of Cr(VI) ions by UASP. The adsorption kinetics of Cr(VI) ions onto UASP showed that the pseudo-first-order model was well in line with the experimental data. In the thermodynamic study, the parameters like Gibb's free energy, enthalpy and entropy changes were evaluated. This result explains that the adsorption of Cr(VI) ions onto the UASP was exothermic and spontaneous in nature. Desorption of the biosorbent was done using different desorbing agents in which NaOH gave the best result. The prepared material showed higher affinity for the removal of Cr(VI) ions and this may be an alternative material to the existing commercial adsorbents.

  18. Acute toxicity of excess mercury on the photosynthetic performance of cyanobacterium, S. platensis--assessment by chlorophyll fluorescence analysis. (United States)

    Lu, C M; Chau, C W; Zhang, J H


    Measurement of chlorophyll fluorescence has been shown to be a rapid, non-invasive, and reliable method to assess photosynthetic performance in a changing environment. In this study, acute toxicity of excess Hg on the photosynthetic performance of the cyanobacterium S. platensis, was investigated by use of chlorophyll fluorescence analysis after cells were exposed to excess Hg (up to 20 microM) for 2 h. The results determined from the fast fluorescence kinetics showed that Hg induced a significant increase in the proportion of the Q(B)-non-reducing PSII reaction centers. The fluorescence parameters measured under the steady state of photosynthesis demonstrated that the increase of Hg concentration led to a decrease in the maximal efficiency of PSII photochemistry, the efficiency of excitation energy capture by the open PSII reaction centers, and the quantum yield of PSII electron transport. Mercury also resulted in a decrease in the coefficients of photochemical and non-photochemical quenching. Mercury may have an acute toxicity on cyanobacteria by inhibiting the quantum yield of photosynthesis sensitively and rapidly. Such changes occurred before any other visible damages that may be evaluated by other conventional measurements. Our results also demonstrated that chlorophyll fluorescence analysis can be used as a useful physiological tool to assess early stages of change in photosynthetic performance of algae in response to heavy metal pollution.

  19. Total bakteri asam laktat dan Coliform pada ileum dan sekum ayam broiler yang diberi Spirulina platensis dengan lama pemberian berbeda

    Directory of Open Access Journals (Sweden)

    Muhammad Irfan Sulfani


    Full Text Available This research was conducted to determine the amount of lactic acid bacteria and coliform inside the caecum and ileum of broilers. 240 days old chicks broiler (DOC with 42.015 ± 0.219 g average body weight were used in this research as an experimental objects. The chicks broiler were treated with 0.04% antibiotics and 1% Spirulina plantensis as a prebiotic under different interval ingestion. This experiment was constructed under completely random design (CRD with 4 treatments and 5 repetition. The treatment that was applied were T0 (Poultry feed + 0.04% Zinc bacitracin, T1 (Poultry feed + 1% throughout 7 days, T2 (Poultry feed + 1% throughout 21 days, and T4 (Poultry feed + 1% throughout 35 days. The parameter measurements conducted in the 32nd day with random sampling from each experiments. Total amount of lactic acid and coliform from each samples were observed and the variance was with 5% accuration. The result showed the total amout of Coliform in ileum was significantly different (P<0.05 in the other hand the total amount of Coliform and acid bacteria in caecum were not influenced (P<0.05. It can be inferred that the Spirulina platensis treatment for 3 weeks reduced the total amount of bacteria inside caecum and ileum.

  20. Selection and protein sds-page identification of a new high-producing polysaccharide strain of Spirulina platensis

    International Nuclear Information System (INIS)

    Wang Zhiping; Liu Yanhui


    The relationship between anti-radiation capacity and polysaccharide contents of ten Spirulina platensis strains were studied. The results showed that the correlation coefficient between 60 Co γ-ray half-lethal dose (LD 50 ) and polysaccharide contents of the 10 strains was 0.9873. After the single cells or spheroplasts of Sp-08 were treated by 0.6%EMS and 2.4 kGy 60 Co γ-ray irradiation, four morphological mutant named Sp-08A, Sp-08B, Sp-08C and Sp-08D, which could endure about 7.0 kGy γ-ray irradiation, were obtained. The polysaccharide contents of Sp-08A, Sp-08B, Sp-08C and Sp-08D, were 32.8%, 17.3%, 3.4% and 42.3% higher than that of their parent Sp-08, respectively. The results of protein SDS-PAGE analysis showed that the heredity of Sp-08A, Sp-08C and Sp-08D were mutated. Therefore, Sp-08A was a perfect high-producing polysaccharide strain with excellent characteristics of morphology and growth. Now, Sp-08A is applied in mass cultivation and industrialization. (authors)

  1. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    Energy Technology Data Exchange (ETDEWEB)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C., E-mail: [College of Engineering, The University of Georgia, Athens, GA (United States); Forsberg, Lennart S.; Azadi, Parastoo [Complex Carbohydrate Research Center, The University of Georgia, Athens, GA (United States)


    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

  2. Influence of Extractive Solvents on Lipid and Fatty Acids Content of Edible Freshwater Algal and Seaweed Products, the Green Microalga Chlorella kessleri and the Cyanobacterium Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Jarmila Vavra Ambrozova


    Full Text Available Total lipid contents of green (Chlorella pyrenoidosa, C, red (Porphyra tenera, N; Palmaria palmata, D, and brown (Laminaria japonica, K; Eisenia bicyclis, A; Undaria pinnatifida, W, WI; Hizikia fusiformis, H commercial edible algal and cyanobacterial (Spirulina platensis, S products, and autotrophically cultivated samples of the green microalga Chlorella kessleri (CK and the cyanobacterium Spirulina platensis (SP were determined using a solvent mixture of methanol/chloroform/water (1:2:1, v/v/v, solvent I and n-hexane (solvent II. Total lipid contents ranged from 0.64% (II to 18.02% (I by dry weight and the highest total lipid content was observed in the autotrophically cultivated cyanobacterium Spirulina platensis. Solvent mixture I was found to be more effective than solvent II. Fatty acids were determined by gas chromatography of their methyl esters (% of total FAMEs. Generally, the predominant fatty acids (all results for extractions with solvent mixture I were saturated palmitic acid (C16:0; 24.64%–65.49%, monounsaturated oleic acid (C18:1(n-9; 2.79%–26.45%, polyunsaturated linoleic acid (C18:2(n-6; 0.71%–36.38%, α-linolenic acid (C18:3(n-3; 0.00%–21.29%, γ-linolenic acid (C18:3(n-6; 1.94%–17.36%, and arachidonic acid (C20:4(n-6; 0.00%–15.37%. The highest content of ω-3 fatty acids (21.29% was determined in Chlorella pyrenoidosa using solvent I, while conversely, the highest content of ω-6 fatty acids (41.42% was observed in Chlorella kessleri using the same solvent.

  3. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    International Nuclear Information System (INIS)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C.; Forsberg, Lennart S.; Azadi, Parastoo


    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

  4. Aplicación de estrategias nutricionales y su efecto en el crecimiento en el cultivo continuo de Spirulina (Arthrospira platensis)


    Rojas,Elizabet; Ávila,Marcela; Parada,Gustavo


    Se realizó un cultivo continuo de Spirulina (Arthrospira platensis) durante 78 días en un fotobiorreactor tubular de 300 L de volumen. Durante este periodo se registró el crecimiento en biomasa y la respuesta del cultivo a la estrategia de adición del medio nutritivo. Utilizando como base el medio Zarrouk modificado, se elaboraron tres medios: medio inicial (MI), medio crecimiento (SA1+SA2) y medio mantenimiento (SB1+SB2) para las distintas etapas del cultivo. La entrega de los medios se efec...

  5. Energy values and chemical composition of spirulina (Spirulina platensis evaluated with broilers Valores energéticos e composição química da espirulina (Spirulina platensis avaliada com frangos de corte

    Directory of Open Access Journals (Sweden)

    Renata Ribeiro Alvarenga


    Full Text Available The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis, the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME and the apparent metabolizable energy corrected for nitrogen balance (AMEn in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metabolic cages for 10 days, distributed in a completely randomized design, with three treatments and six repetitions with five birds each. Diets consisted on a reference-ration based on corn and soybean meal and two test diets, one containing spirulina (30% and the other one with soybean meal (30%. Spiruline was superior to soybean meal for contents of dry matter (DM, gross energy (9.60%, crude protein (26.56%, ether extract (54.45%, mineral matter (42.77%, calcium (100% and total phosphorus (130.77% and also for most amino acids, except lysine, glutamate, histidine and proline. Nevertheless, spiruline presented lower values of gross fiber (83.95%, acid detergent fiber (85.12% and neutral detergent fiber (6.15. The AME and AMEn values (kcal/kg of DM were, respectively, 2,906 and 2,502 for the spirulina and 2,646 and 2,340 for the soybean meal and AMEn of spirulina was 6.92% higher than soybean meal.Objetivou-se determinar a composição química e energética da espirulina (Spirulina platensis, os coeficientes de metabolizabilidade dos nutrientes e os valores de energia metabolizável aparente (EMA e aparente corrigida pelo balanço de nitrogênio (EMAn em frangos de corte. Realizou-se um ensaio de digestibilidade utilizando-se a metodologia de coleta total de excretas com 90 pintos machos da linhagem Cobb 500, com peso inicial de 256 ± 5 g aos 11 dias de idade. As aves foram alojadas em gaiolas de metabolismo durante dez dias, distribuídas em delineamento

  6. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Yang F


    Full Text Available Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellurium-containing phycocyanin (Te-PC and allophycocyanin (Te-APC, two organic tellurium (Te species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 µg g-1 protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropanedihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress. Keywords: tellurium, phycocyanin, allophycocyanin, purification, antioxidant activity

  7. Characterization and pyrolysis of Chlorella vulgaris and Arthrospira platensis: potential of bio-oil and chemical production by Py-GC/MS analysis. (United States)

    Almeida, Hanna N; Calixto, Guilherme Q; Chagas, Bruna M E; Melo, Dulce M A; Resende, Fabio M; Melo, Marcus A F; Braga, Renata Martins


    Biofuels have been seen as potential sources to meet future energy demand as a renewable and sustainable energy source. Despite the fact that the production technology of first-generation biofuels is consolidated, these biofuels are produced from foods crops such as grains, sugar cane, and vegetable oils competing with food for crop use and agricultural land. In recent years, it was found that microalgae have the potential to provide a viable alternative to fossil fuels as source of biofuels without compromising food supplies or arable land. On this scenario, this paper aims to demonstrate the energetic potential to produce bio-oil and chemicals from microalgae Chlorella vulgaris and Arthrospira platensis. The potential of these biomasses was evaluated in terms of physical-chemical characterization, thermogravimetric analysis, and analytical pyrolysis interfaced with gas chromatograph (Py-GC/MS). The results show that C. vulgaris and A. platensis are biomasses with a high heating value (24.60 and 22.43 MJ/kg) and low ash content, showing a high percentage of volatile matter (72.49 and 79.42%). These characteristics confirm their energetic potential for conversion process through pyrolysis, whereby some important aromatic compounds such as toluene, styrene, and phenol were identified as pyrolysis products, which could turn these microalgae a potential for biofuels and bioproduct production through the pyrolysis.

  8. Perfil metabólico de Aegla platensis Schmitt, (Crustacea, Aeglidae, Anomura submetida a dietas ricas em carboidratos ou proteínas Metabolic profile of Aegla platensis Schmitt, (Crustacea, Anomura submitted to carbohydrate-rich or high-protein diets

    Directory of Open Access Journals (Sweden)

    Bibiana Della P. Ferreira


    Full Text Available O objetivo desse estudo foi avaliar o efeito de uma dieta rica em carboidratos e uma dieta rica em proteínas sobre o metabolismo de Aegla platensis, um caranguejo anomuro de água doce. Os animais foram coletados no Arroio do Mineiro, município de Taquara, Rio Grande do Sul, em agosto/2002 e janeiro/2003, e foram alimentados durante 15 dias com carne bovina crua e arroz branco, em aquários aerados. O fotoperíodo foi controlado: 12 horas claro - 12 horas escuro. Glicose, proteínas, lipídios e triglicerídios foram dosados na hemolinfa; glicogênio e lipídios foram dosados no hepatopâncreas, brânquias e músculo. Em Aegla platensis, mantida em condições de laboratório, em todos os tecidos estudados pode ser observado que o aporte regular de alimento, bem como o tipo de dieta administrada determinaram um perfil diferenciado de resposta metabólica entre os sexos e o período de realização dos experimentos (inverno e verão.The objective of this study was to assess the effect of a carbohydrate-rich and a high-protein diets on metabolism of Aegla platensis, a freshwater anomuram crab. The animals were collected in Mineiro Creek, Taquara city, Rio Grande do Sul, at august/2002 and january/2003, and were feed during 15 days with crude bovine meat and white rice, in an aerated aquarium. The photoperiod was controlled: 12 hours day - 12 hours night. Glucose, proteins, lipids and triglycerides were dosed in haemolymph; glycogen and lipids were dosed in hepatopancreas, gills and muscle tissues. In Aegla platensis, maintained in laboratory conditions, in all studied tissues can be seen that the regular food intake, as well as the kind of administered diet determinated a differential profile of metabolic response between sexes and the period of the experiments performance (winter and summer.

  9. Produção, aspectos nutricionais e fisiológicos de alface sob adubação foliar com Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Débora Samara Oliveira e Silva


    Full Text Available Objetivou-se avaliar a influência de concentrações do fertilizante orgânico a base de Spirulina platensis sobre a produção, crescimento, teores de N, P, K e sódio e sobre as trocas gasosas de alface cv. Elba em condições de campo. Utilizou-se o delineamento de blocos ao acaso, com seis tratamentos, constituídos das concentrações do fertilizante (0; 1,5; 3,0; 4,5; 6,0 e 7,5% com seis repetições. No ponto de colheita da cultura foram avaliadas variáveis de produção e crescimento, os teores de nitrogênio, fósforo, potássio e sódio, bem como, as trocas gasosas das plantas com o medidor de gás infravermelho (IRGA. Os resultados obtidos mostraram que as concentrações do fertilizante, não afetaram a produção, o crescimento, os teores de nutrientes avaliados, assim como não influenciaram as trocas gasosas das plantas.Production, mineral nutrition and physiological aspects of lettuce under foliar fertilization with Spirulina platensis Abstract: The objective of this study was to evaluate the influence of concentrations of organic fertilizer based on Spirulina platensis on yield, growth, in N, P, K and sodium contents and on gaseous changes of lettuce cv. Elba in field conditions. Use the design of randomized blocks, with six treatments consisting of different concentrations of fertilizer (0; 1.5; 3.0; 4.5; 6.0 and 7.5% with six replications. At the harvest point were evaluated the growth and production, nitrogen, phosphorus, potassium and sodium, as well as gas exchange plant with infrared gas meter (IRGA. The results showed that the fertilizer concentrations did not affect production, growth, levels of nutrients evaluated, and did not influence the gas exchange of plants.

  10. Study of polyethyleneimine- and amidoxime-functionalized hybrid biomass of Spirulina (Arthrospira) platensis for adsorption of uranium (VI) ion. (United States)

    Bayramoglu, Gulay; Akbulut, Aydin; Arica, M Yakup


    This study investigates the potential application of the polyethyleneimine- (PEI) and amidoxime-modified Spirulina (Arthrospira) platensis biomasses for the removal of uranium ion in batch mode using the native biomass as a control system. The uranium ion adsorption was also characterized by attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectra, zeta potential analysis, and surface area measurement studies. The effects of pH, biomass amount, contact time, initial uranium ion concentration, and ionic strength were evaluated by using native and modified algal biomass preparations. The uranium ion removal was rapid, with more than 70% of total adsorption taking place in 40 min, and equilibrium was established within 60 min. From the experimental data, it was found that the amount of adsorption uranium ion on the algal preparations decreased in the following series: amidoxime-modified algal biomass > PEI-modified algal biomass > native algal biomass. Maximum adsorption capacities of amidoxime- and PEI-modified, and native algal biomasses were found to be 366.8, 279.5, and 194.6 mg/g, respectively, in batchwise studies. The adsorption rate of U(VI) ion by amidoxime-modified algal biomass was higher than those of the native and PEI-modified counterparts. The adsorption processes on all the algal biomass preparations followed by the Dubinin-Radushkevitch (D-R) and Temkin isotherms and pseudo-second-order kinetic models. The thermodynamic parameters were determined at four different temperatures (i.e., 15, 25, 35, and 45 °C) using the thermodynamics constant of the Temkin isotherm model. The ΔH° and ΔG° values of U(VI) ion adsorption on algal preparations show endothermic heat of adsorption; higher temperatures favor the process. The native and modified algal biomass preparations were regenerated using 10 mM HNO3. These results show that amidoxime-modified algal biomass can be a potential candidate for effective removal of U(VI) ion from

  11. The effect of spirulina (Arthrospira platensis (Oscillatoriales: Cyanobacteria on the experimental breeding of Pseudosuccinea columella (Basommatophora: Lymnaeidae

    Directory of Open Access Journals (Sweden)

    Lucila Prepelitchi


    Full Text Available Snails of the family Lymnaeidae, as Pseudosuccinea columella, are the intermediate hosts of Fasciola hepatica, the causative agent of fasciolosis in human and livestock all over the world. A thorough knowledge of snail biology is essential for describing the transmission dynamics and for controlling this disease. Since food quality has had a significant effect on snail growth, fecundity and fertility, in this study we evaluated the use of spirulina (Arthrospira platensis as a food resource for the artificial breeding of P. columella, an invasive snail and the main intermediate host of F. hepatica in Northeastern Argentina. The main purpose was to measure the effect of spirulina on fitness parameters such as survival rate, growth rate, size at first reproduction, lifetime fecundity and viable offspring. A total of 20 676 newly-laid F2 eggs were used; half of them were fed with lettuce (treatment L and the other half with lettuce plus spirulina (treatment L+S. In comparison with P. columella snails fed only with lettuce, we found that P. columella fed with lettuce plus spirulina: 1 showed higher survival rates, 2 grew faster and showed higher growth increments, 3 attained sexual maturity earlier in time (L+S:60 days vs. L:120 days and at a smaller size (L+S:4.8mm vs. L:8.2mm, 4 had a longer reproductive period (L+S:150 days vs. L:90 days, 5 produced a higher number of eggs/snail (L+S:29.6 vs. L:13.3, and 6 showed a higher offspring hatching rate (L+S:70% vs. L:40%. The supplementation of P. columella diet with commercial spirulina enhances it fitness and improved the artificial breeding of this species. Spirulina may have a direct positive effect on P. columella development by consuming it, along with an indirect positive effect by improving the water quality. This rearing technique provided large number of reproducing adults and a continuous production of offspring, which are essential for developing future experimental studies in order to

  12. Comparison of Spirulina platensis microalgae and commercial activated carbon as adsorbents for the removal of Reactive Red 120 dye from aqueous effluents

    International Nuclear Information System (INIS)

    Cardoso, Natali F.; Lima, Eder C.; Royer, Betina; Bach, Marta V.; Dotto, Guilherme L.; Pinto, Luiz A.A.; Calvete, Tatiana


    Highlights: ► Spirulina platensis (SP) and activated carbon (AC) were used to remove RR-120 dye. ► The maximum adsorption capacities were found at pH 2 and 298 K. ► The values were 482.2 and 267.2 mg g −1 for SP and AC, respectively. ► Adsorption was exothermic, spontaneous and favorable. ► SP and AC were effective to treat a simulated dye-house effluent. - Abstract: Spirulina platensis microalgae (SP) and commercial activated carbon (AC) were compared as adsorbents to remove Reactive Red 120 (RR-120) textile dye from aqueous effluents. The batch adsorption system was evaluated in relation to the initial pH, contact time, initial dye concentration and temperature. An alternative kinetic model (general order kinetic model) was compared with the traditional pseudo-first order and pseudo-second order kinetic models. The equilibrium data were fitted to the Langmuir, Freundlich and Liu isotherm models, and the thermodynamic parameters were also estimated. Finally, the adsorbents were employed to treat a simulated dye-house effluent. The general order kinetic model was more appropriate to explain RR-120 adsorption by SP and AC. The equilibrium data were best fitted to the Liu isotherm model. The maximum adsorption capacities of RR-120 dye were found at pH 2 and 298 K, and the values were 482.2 and 267.2 mg g −1 for the SP and AC adsorbents, respectively. The thermodynamic study showed that the adsorption was exothermic, spontaneous and favourable. The SP and AC adsorbents presented good performance for the treatment of simulated industrial textile effluents, removing 94.4–99.0% and 93.6–97.7%, respectively, of the dye mixtures containing high saline concentrations.

  13. Comparison of Spirulina platensis microalgae and commercial activated carbon as adsorbents for the removal of Reactive Red 120 dye from aqueous effluents

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Natali F. [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Lima, Eder C., E-mail: [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Royer, Betina; Bach, Marta V. [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Dotto, Guilherme L.; Pinto, Luiz A.A. [Unit Operation Laboratory, School of Chemistry and Food, Federal University of Rio Grande, FURG, R. Engenheiro Alfredo Huch 475, 96201-900, Rio Grande, RS (Brazil); Calvete, Tatiana [Universitary Center La Salle (UNILASALLE), Av. Victor Barreto 2288, 92010-000, Canoas, RS (Brazil)


    Highlights: Black-Right-Pointing-Pointer Spirulina platensis (SP) and activated carbon (AC) were used to remove RR-120 dye. Black-Right-Pointing-Pointer The maximum adsorption capacities were found at pH 2 and 298 K. Black-Right-Pointing-Pointer The values were 482.2 and 267.2 mg g{sup -1} for SP and AC, respectively. Black-Right-Pointing-Pointer Adsorption was exothermic, spontaneous and favorable. Black-Right-Pointing-Pointer SP and AC were effective to treat a simulated dye-house effluent. - Abstract: Spirulina platensis microalgae (SP) and commercial activated carbon (AC) were compared as adsorbents to remove Reactive Red 120 (RR-120) textile dye from aqueous effluents. The batch adsorption system was evaluated in relation to the initial pH, contact time, initial dye concentration and temperature. An alternative kinetic model (general order kinetic model) was compared with the traditional pseudo-first order and pseudo-second order kinetic models. The equilibrium data were fitted to the Langmuir, Freundlich and Liu isotherm models, and the thermodynamic parameters were also estimated. Finally, the adsorbents were employed to treat a simulated dye-house effluent. The general order kinetic model was more appropriate to explain RR-120 adsorption by SP and AC. The equilibrium data were best fitted to the Liu isotherm model. The maximum adsorption capacities of RR-120 dye were found at pH 2 and 298 K, and the values were 482.2 and 267.2 mg g{sup -1} for the SP and AC adsorbents, respectively. The thermodynamic study showed that the adsorption was exothermic, spontaneous and favourable. The SP and AC adsorbents presented good performance for the treatment of simulated industrial textile effluents, removing 94.4-99.0% and 93.6-97.7%, respectively, of the dye mixtures containing high saline concentrations.

  14. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay


    Eduardo Sommella; Giulio Maria Conte; Emanuela Salviati; Giacomo Pepe; Alessia Bertamino; Carmine Ostacolo; Francesca Sansone; Francesco Del Prete; Rita Patrizia Aquino; Pietro Campiglia


    Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary sup...

  15. Spirulina platensis Improves Mitochondrial Function Impaired by Elevated Oxidative Stress in Adipose-Derived Mesenchymal Stromal Cells (ASCs) and Intestinal Epithelial Cells (IECs), and Enhances Insulin Sensitivity in Equine Metabolic Syndrome (EMS) Horses. (United States)

    Nawrocka, Daria; Kornicka, Katarzyna; Śmieszek, Agnieszka; Marycz, Krzysztof


    Equine Metabolic Syndrome (EMS) is a steadily growing life-threatening endocrine disorder linked to insulin resistance, oxidative stress, and systemic inflammation. Inflammatory microenvironment of adipose tissue constitutes the direct tissue milieu for various cell populations, including adipose-derived mesenchymal stromal cells (ASCs), widely considered as a potential therapeutic cell source in the course of the treatment of metabolic disorders. Moreover, elevated oxidative stress induces inflammation in intestinal epithelial cells (IECs)-the first-line cells exposed to dietary compounds. In the conducted research, we showed that in vitro application of Spirulina platensis contributes to the restoration of ASCs' and IECs' morphology and function through the reduction of cellular oxidative stress and inflammation. Enhanced viability, suppressed senescence, and improved proliferation of ASCs and IECs isolated from metabolic syndrome-affected individuals were evident following exposition to Spirulina. A protective effect of the investigated extract against mitochondrial dysfunction and degeneration was also observed. Moreover, our data demonstrate that Spirulina extract effectively suppressed LPS-induced inflammatory responses in macrophages. In vivo studies showed that horses fed with a diet based on Spirulina platensis supplementation lost weight and their insulin sensitivity improved. Thus, our results indicate the engagement of Spirulina platensis nourishing as an interesting alternative approach for supporting the conventional treatment of equine metabolic syndrome.

  16. GoM Coastal Biopsy Surveys - NRDA (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Small vessel surveys were conducted within estuarine and nearshore coastal waters of Barataria Bay, LA and Mississippi Sound, MS to collect tissue biopsy samples...

  17. The effects of pH in profile of lipid and ester accumulation of arthrospira platensis (spirulina) as a potential source of biodiesel

    International Nuclear Information System (INIS)

    Reyes, Patrick A.; Ybañez, Manolito G. Jr.; Avilla, Ruel A.


    This study aimed to produce biodiesel (ester-based fuel) using the extracts of microalgae Arthrospira platensis (Spirulina). Specifically, the research focused in determining effect of pH in culturing the Spirulina and its lipid accumulation; determining the constituents present in the lipid extracts; and determining the methyl esters in the transesterified lipids. The best pH condition in culturing the algal sample was found to be at pH 10 to 11. Analysis of the extracted lipid samples revealed that pH condition in culturing medium has a significant effect on the lipid accumulation in Spirulina. Perkin Elmer Claurus 500 GC-MS system elucidated that the constituents present in the experimental samples were esterified lipids. The esters were derived from butanoic, hexadeanoic and octadecanoic acid. About 19 free fatty acids out of 23 determined compounds present were from the controlled sample which suggests that these were main precursors of the esters found in the sample were butyl, allyl nonyl, propyl tetradecyl, methylpropyl, allyl dodecyl, hexyl pentadecyl, dodecyl propyl, heptyl esters with the parent chain of fatty acids enumerated above. These showed that pH manipulations could be used as a direct transesterification of fatty acids in producing biodiesels. (author)

  18. Insects found in birds' nests from Argentina. Pseudoseisura lophotes Reichenbach, 1853 and Anumbius annumbi (Vieillot, 1817) (Aves: Furnariidae), hosts of Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae: Triatominae). (United States)

    Paola, Turienzo


    The insect fauna of the nests of Pseudoseisura lophotes (Reichenbach, 1853) (Aves: Furnariidae) from Argentina was investigated. A total of 110 species (68 identified to species, 22 identified to genus, 20 identified to family) in 40 families of 10 orders of insects was found in these nests. Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae) was found again in nests of P. lophotes, corroborating after 73 years the first observations made by Mazza in 1936. The occurrence of the insects in nests of P. lophotes is compared with the previously known insect fauna in nests of A. annumbi, Furnarius rufus (Furnariidae), and Myiopsitta monachus (Psittacidae). The insect fauna in additional nests of Anumbius annumbi from the same and/or different localities is given, and used in comparisons. The first occurrence of Cuterebridae (Diptera) in birds' nests, their pupae as the overwintering stage, and the second simultaneous infestation by two species of Philornis (Diptera: Muscidae) on the same nestlings are presented. Other simultaneous infestations of different hematophagous arthropods (Hemiptera: Cimidae; Reduviidae: Triatominae, and Acari: Argasidae) are remarked and discussed.

  19. Growth and content of Spirulina platensis biomass chlorophyll cultivated at different values of light intensity and temperature using different nitrogen sources

    Directory of Open Access Journals (Sweden)

    Eliane Dalva Godoy Danesi


    Full Text Available The effects of light intensity and temperature in S. platensis cultivation with potassium nitrate or urea as nitrogen source were investigated, as well as the biomass chlorophyll contents of this cyanobacteria, through the Response Surface Methodology. Experiments were performed at temperatures from 25 to 34.5ºC and light intensities from 15 to 69 µmol photons m-2 s-1, in mineral medium. In cultivations with both sources of nitrogen, KNO3 and urea, statistic evaluation through multiple regression, no interactions of such independent variables were detected in the results of the dependent variables maximum cell concentration, chlorophyll biomass contents, cell and chlorophyll productivities, as well as in the nitrogen-cell conversion factor. In cultivation performed with both sources of nitrogen, it was possible to obtain satisfactory adjustments to relate the dependent variables to the independent variables. The best results were achieved at temperature of 30ºC, at light intensity of 60 µmol photons m-2s-1, for cell growth, with cell productivity of approximately 95 mg L-1 d-1 in cultivations with urea. For the chlorophyll biomass content, the most adequate light intensity was 24 µmol photons m-2 s-1.

  20. Structure of the ent-Copalyl Diphosphate Synthase PtmT2 from Streptomyces platensis CB00739, a Bacterial Type II Diterpene Synthase. (United States)

    Rudolf, Jeffrey D; Dong, Liao-Bin; Cao, Hongnan; Hatzos-Skintges, Catherine; Osipiuk, Jerzy; Endres, Michael; Chang, Chin-Yuan; Ma, Ming; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N; Shen, Ben


    Terpenoids are the largest and most structurally diverse family of natural products found in nature, yet their presence in bacteria is underappreciated. The carbon skeletons of terpenoids are generated through carbocation-dependent cyclization cascades catalyzed by terpene synthases (TSs). Type I and type II TSs initiate cyclization via diphosphate ionization and protonation, respectively, and protein structures of both types are known. Most plant diterpene synthases (DTSs) possess three α-helical domains (αβγ), which are thought to have arisen from the fusion of discrete, ancestral bacterial type I TSs (α) and type II TSs (βγ). Type II DTSs of bacterial origin, of which there are no structurally characterized members, are a missing piece in the structural evolution of TSs. Here, we report the first crystal structure of a type II DTS from bacteria. PtmT2 from Streptomyces platensis CB00739 was verified as an ent-copalyl diphosphate synthase involved in the biosynthesis of platensimycin and platencin. The crystal structure of PtmT2 was solved at a resolution of 1.80 Å, and docking studies suggest the catalytically active conformation of geranylgeranyl diphosphate (GGPP). Site-directed mutagenesis confirmed residues involved in binding the diphosphate moiety of GGPP and identified DxxxxE as a potential Mg(2+)-binding motif for type II DTSs of bacterial origin. Finally, both the shape and physicochemical properties of the active sites are responsible for determining specific catalytic outcomes of TSs. The structure of PtmT2 fundamentally advances the knowledge of bacterial TSs, their mechanisms, and their role in the evolution of TSs.

  1. The biomechanical role of overall-shape transformation in a primitive multicellular organism: A case study of dimorphism in the filamentous cyanobacterium Arthrospira platensis. (United States)

    Chaiyasitdhi, Atitheb; Miphonpanyatawichok, Wirat; Riehle, Mathis Oliver; Phatthanakun, Rungrueang; Surareungchai, Werasak; Kundhikanjana, Worasom; Kuntanawat, Panwong


    Morphological transformations in primitive organisms have long been observed; however, its biomechanical roles are largely unexplored. In this study, we investigate the structural advantages of dimorphism in Arthrospira platensis, a filamentous multicellular cyanobacterium. We report that helical trichomes, the default shape, have a higher persistence length (Lp), indicating a higher resistance to bending or a large value of flexural rigidity (kf), the product of the local cell stiffness (E) and the moment of inertia of the trichomes' cross-section (I). Through Atomic Force Microscopy (AFM), we determined that the E of straight and helical trichomes were the same. In contrast, our computational model shows that I is greatly dependent on helical radii, implying that trichome morphology is the major contributor to kf variation. According to our estimation, increasing the helical radii alone can increase kf by 2 orders of magnitude. We also observe that straight trichomes have improved gliding ability, due to its structure and lower kf. Our study shows that dimorphism provides mechanical adjustability to the organism and may allow it to thrive in different environmental conditions. The higher kf provides helical trichomes a better nutrient uptake through advection in aquatic environments. On the other hand, the lower kf improves the gliding ability of straight trichomes in aquatic environments, enabling it to chemotactically relocate to more favorable territories when it encounters certain environmental stresses. When more optimal conditions are encountered, straight trichomes can revert to their original helical form. Our study is one of the first to highlight the biomechanical role of an overall-shape transformation in cyanobacteria.

  2. Antioxidant Potential of Extracts Obtained from Macro- (Ascophyllum nodosum, Fucus vesiculosus and Bifurcaria bifurcata and Micro-Algae (Chlorella vulgaris and Spirulina platensis Assisted by Ultrasound

    Directory of Open Access Journals (Sweden)

    Rubén Agregán


    Full Text Available Background: Natural antioxidants, which can replace synthetic ones due to their potential implications for health problems in children, have gained significant popularity. Therefore, the antioxidant potential of extracts obtained from three brown macroalgae (Ascophyllum nodosum, Fucus vesiculosus and Bifurcaria bifurcata and two microalgae (Chlorella vulgaris and Spirulina platensis using ultrasound-extraction as an innovative and green approach was evaluated. Methods: Algal extracts were obtained by ultrasound-assisted extraction using water/ethanol (50:50, v:v as the extraction solvent. The different extracts were compared based on their antioxidant potential, measuring the extraction yield, the total phenolic content (TPC and the antioxidant activity. Results: Extracts from Ascophyllum nodosum (AN and Bifurcaria bifurcata (BB showed the highest antioxidant potential compared to the rest of the samples. In particular, BB extract presented the highest extraction (35.85 g extract/100 g dry weight (DW and total phenolic compounds (TPC (5.74 g phloroglucinol equivalents (PGE/100 g DW yields. Regarding the antioxidant activity, macroalgae showed again higher values than microalgae. BB extract had the highest antioxidant activity in the ORAC, DPPH and FRAP assays, with 556.20, 144.65 and 66.50 µmol Trolox equivalents (TE/g DW, respectively. In addition, a correlation among the antioxidant activity and the TPC was noted. Conclusions: Within the obtained extracts, macroalgae, and in particular BB, are more suitable to be used as sources of phenolic antioxidants to be included in products for human consumption. The relatively low antioxidant potential, in terms of polyphenols, of the microalgae extracts studied in the present work makes them useless for possible industrial applications compared to macroalgae, although further in vivo studies evaluating the real impact of antioxidants from both macro- and micro-algae at the cellular level should be


    Directory of Open Access Journals (Sweden)

    C. Cruz-Martínez


    Full Text Available AbstractNH4NO3 simultaneously provides a readily assimilable nitrogen source (ammonia and a reserve of nitrogen (nitrate, allowing for an increase in Arthrospira platensis biomass production while reducing the cost of the cultivation medium. In this study, a 22plus star central composite experimental design combined with response surface methodology was employed to analyze the influence of light intensity (I and the total amount of added NH4NO3 (Mt on a bench-scale tubular photobioreactor for fed-batch cultures. The maximum cell concentration (Xm, cell productivity (PX and biomass yield on nitrogen (YX/N were evaluated, as were the protein and lipid contents. Under optimized conditions (I = 148 μmol·photons·m-2·s-1 and Mt = 9.7 mM NH4NO3, Xm = 4710 ±34.4 mg·L-1, PX = 478.9 ±3.8 mg·L-1·d-1 and YX/N = 15.87 ±0.13 mg·mg-1 were obtained. The best conditions for protein content in the biomass (63.2% were not the same as those that maximized cell growth (I = 180 μmol·photons·m-2·s-1 and Mt = 22.5 mM NH4NO3. Based on these results, it is possible to conclude that ammonium nitrate is an interesting alternate nitrogen source for the cultivation of A. platensisin a fed-batch process and could be used for other photosynthetic microorganisms.

  4. Effect of dietary supplementation of spirulina (Arthrospira platensis and thyme (Thymus vulgaris on carcass composition, meat physical traits, and vitamin B12 content on growing rabbits

    Directory of Open Access Journals (Sweden)

    Antonella Dalle Zotte


    Full Text Available The aim of this study was to compare the effect and duration of dietary inclusion of 5% spirulina (Arthrospira platensis and/or 3% thyme (Thymus vulgaris on growing rabbit carcass composition, meat and bone rheological traits, and the vitamin B12 content of Longissimus dorsi (LD meat. The study involved 294 maternal line growing rabbits from the Pannon breeding programme. At weaning (5 wk, animals were randomly divided by dietary treatment into 7 groups of 42 rabbits each. A control group (C-C received a pellet with no supplementation throughout the trial (5-11 wk of age, whereas the other groups were fed diets supplemented with 5% spirulina (S, 3% thyme (T or with both ingredients (ST for either the entire growing period (5-11 wk of age; groups: S-S, T-T, ST-ST, respectively, or its final part only (8-11 wk of age; groups: C-S, C-T, C-ST, respectively. Results showed that regardless of the duration of supplementation, spirulina and thyme provided no effect on the traits examined, except for scapular fat content, whose value was higher in the S-S group than in the C-T group (P<0.05. Spirulina was confirmed as a rich source of vitamin B12 that was successfully transferred into LD meat, thus demonstrating its value as an effective natural supplement in producing food fortified with this vital element. Further studies are necessary to clarify the effect of spirulina on carcass fat deposition, bone development, and mineralisation.

  5. Efficacy of Spirulina platensis diet supplements on disease resistance and immune-related gene expression in Cyprinus carpio L. exposed to herbicide atrazine. (United States)

    Khalil, Samah R; Reda, Rasha M; Awad, Ashraf


    The present study evaluated the immunotoxicological effects of the herbicide atrazine (ATZ) at sub-lethal concentrations and the potential ameliorative influence of Spirulina platensis (SP) over a sub-chronic exposure period on Cyprinus carpio L., also known as common carp. Common carp was sampled after a 40-days exposure to ATZ (428 μg/L) and SP (1%), individually or in combination to assess the non-specific immune response, changes in mRNA expression of immune-related genes [lysozyme (LYZ), immunoglobulin M (IgM), and complement component 3 (C3)] in the spleen, and inflammatory cytokines (interleukins IL-1ß and IL-10) in the head kidney using real-time PCR. Additionally, disease resistance to Aeromonas sobria was evaluated. The results revealed that ATZ exposure caused a significant decline in most of the hematological variables, lymphocyte viability, and lysozyme and bactericidal activity. Moreover, ATZ increased the susceptibility to disease, reflected by a significantly lower post-challenge survival rate of the carp. ATZ may induce dysregulated expression of immune-related genes leading to downregulation of mRNA levels of IgM and LYZ in the spleen. However, expression of C3 remained unaffected. Of the cytokine-related genes examined, IL-1B was up-regulated in the head kidney. In contrast, the expression of IL-10 gene was down-regulated in the ATZ-exposed group. The SP supplementation resulted in a significant improvement in most indices; however, these values did not match with that of the controls. These results may conclude that ATZ affects both innate and adaptive immune responses through the negative transcriptional effect on genes involved in immunity and also due to the inflammation of the immune organs. In addition, dietary supplements with SP could be useful for modulation of the immunity in response to ATZ exposure, thereby presenting a promising feed additive for carps in aquaculture. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Cultivation of Arthrospira (spirulina platensis in desalinator wastewater and salinated synthetic medium: protein content and amino-acid profile Cultivo de Arthrospira (Spirulina platensis em rejeito de dessalinizador e meio sintético salinizado: teor protéico e perfil de aminoácidos

    Directory of Open Access Journals (Sweden)

    Harriet Volkmann


    Full Text Available Arthrospira (Spirulina platensis was cultivated in laboratory under controlled conditions (30ºC, photoperiod of 12 hours light/dark provided by fluorescent lamps at a light intensity of 140 µmol photons.m-2.s-1 and constant bubbling air in three different culture media: (1 Paoletti medium (control, (2 Paoletti supplemented with 1 g.L-1 NaCl (salinated water and (3 Paoletti medium prepared with desalinator wastewater. The effects of these treatments on growth, protein content and amino acid profile were measured. Maximum cell concentrations observed in Paoletti medium, Paoletti supplemented with salinated water or with desalinator wastewater were 2.587, 3.545 and 4.954 g.L-1, respectively. Biomass in medium 3 presented the highest protein content (56.17%, while biomass in medium 2 presented 48.59% protein. All essential amino acids, except lysine and tryptophan, were found in concentrations higher than those requiried by FAO.Arthrospira (Spirulina platensis foi cultivada em laboratório sob condições controladas (30ºC, intensidade luminosa de 140 µmol fótons.m-2.s-1, 12 horas claro/escuro e insuflação constante de ar atmosférico, em três meios de cultivo: (1 meio de Paoletti (controle, (2 meio de Paoletti suplementado com 1,0 g.L-1 de NaCl (água salinizada e (3 meio de Paoletti preparado com rejeito de dessalinizador. Foi verificado o efeito destes tratamentos no crescimento, teor de proteínas e aminoácidos. As concentrações celulares máximas obtidas foram de 2,587; 3,545 e 4,954 g.L-1 no meio controle, meio de Paoletti suplementado com água salinizada ou com rejeito de dessalinizador, respectivamente. Com relação às concentrações protéicas, estas foram maiores na biomassa cultivada no meio 3, com 56,17%, enquanto que a biomassa cultivada no meio 2 apresentou 48,59%. A maioria dos aminoácidos essenciais encontrou-se acima dos limites requeridos pela FAO, com exceção apenas de lisina e triptofano.

  7. Consumption of an aqueous cyanophyta extract derived from Arthrospira platensis is associated with reduction of chronic pain: results from two human clinical pilot studies

    Directory of Open Access Journals (Sweden)

    Jensen GS


    Full Text Available Gitte S Jensen,1 Victoria L Attridge,1 Steve G Carter,1 Jesse Guthrie,2 Axel Ehmann,2 Kathleen F Benson1 1NIS Labs, 2Cerule LLC, Klamath Falls, OR, USA Objectives: The aim of this study was to evaluate the effects of consumption of an aqueous cyanophyta extract (ACE from Arthrospira platensis on chronic pain in humans, in two clinical pilot studies. Design and interventions: The two pilot studies each involved 12 subjects experiencing chronic pain. The initial study followed an open-label 4-week study design involving consumption of 1 g ACE per day. A subsequent placebo-controlled, single-blind, crossover study involved consumption of 500 mg ACE, 250 mg ACE, or 0 mg ACE (placebo per day for 1-week duration, separated by 1-week washout period. Subjects: Adult subjects of both sexes, with chronic joint-related pain for at least 6 months prior to enrollment, were recruited after obtaining written informed consent. Outcome measures: Visual analog scales were used to score pain at rest and during physical activity for each person's primary and secondary areas of chronic pain. An activities of daily living questionnaire was used to collect data on physical functioning. Results: The data showed rapid reduction of chronic pain in people consuming ACE, where the reduction in pain scores for each person's primary pain area reached a high level of statistical significance after 2 weeks of consumption (P<0.01, both when at rest and when being physically active. Secondary pain areas when physically active showed highly significant improvements within 1 week of consumption of 1 g/d (P<0.001 and borderline significant improvements within 1 week of consuming 500 mg/d (P<0.065 and 250 mg/d (P<0.05. This was accompanied by an increased ability to perform daily activities (P<0.05. A small but significant weight loss was observed during the 4-week study, as the average body mass index dropped from 31.4 to 29.4 (P<0.01. Conclusion: Consumption of ACE was associated

  8. A lithium-sensitive and sodium-tolerant 3'-phosphoadenosine-5'-phosphatase encoded by halA from the cyanobacterium Arthrospira platensis is closely related to its counterparts from yeasts and plants. (United States)

    Zhang, Ju-Yuan; Zou, Jie; Bao, Qiyu; Chen, Wen-Li; Wang, Li; Yang, Huanming; Zhang, Cheng-Cai


    3'-Phosphoadenosine-5'-phosphatase (PAPase) is required for the removal of toxic 3'-phosphoadenosine-5'-phosphate (PAP) produced during sulfur assimilation in various eukaryotic organisms. This enzyme is a well-known target of lithium and sodium toxicity and has been used for the production of salt-resistant transgenic plants. In addition, PAPase has also been proposed as a target in the treatment of manic-depressive patients. One gene, halA, which could encode a protein closely related to the PAPases of yeasts and plants, was identified from the cyanobacterium Arthrospira (Spirulina) platensis. Phylogenic analysis indicated that proteins related to PAPases from several cyanobacteria were found in different clades, suggesting multiple origins of PAPases in cyanobacteria. The HalA polypeptide from A. platensis was overproduced in Escherichia coli and used for the characterization of its biochemical properties. HalA was dependent on Mg2+ for its activity and could use PAP or 3'-phosphoadenosine-5'-phosphosulfate as a substrate. HalA is sensitive to Li+ (50% inhibitory concentration [IC50] = 3.6 mM) but only slightly sensitive to Na+ (IC50 = 600 mM). The salt sensitivity of HalA was thus different from that of most of its eukaryotic counterparts, which are much more sensitive to both Li+ and Na+, but was comparable to the PAPase AtAHL (Hal2p-like protein) from Arabidopsis thaliana. The properties of HalA could help us to understand the structure-function relationship underlying the salt sensitivity of PAPases. The expression of halA improved the Li+ tolerance of E. coli, suggesting that the sulfur-assimilating pathway is a likely target of salt toxicity in bacteria as well.

  9. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay

    Directory of Open Access Journals (Sweden)

    Eduardo Sommella


    Full Text Available Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS and Ultra High-Performance Liquid Chromatography (UHPLC for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS and coupled to UHPLC. DIMS showed to be a very fast (4 min and accurate (mass accuracy ≤ 0.01 ppm tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  10. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay. (United States)

    Sommella, Eduardo; Conte, Giulio Maria; Salviati, Emanuela; Pepe, Giacomo; Bertamino, Alessia; Ostacolo, Carmine; Sansone, Francesca; Prete, Francesco Del; Aquino, Rita Patrizia; Campiglia, Pietro


    Arthrospira platensis , better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS) and coupled to UHPLC. DIMS showed to be a very fast (4 min) and accurate (mass accuracy ≤ 0.01 ppm) tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  11. GoM Coastal and Estuarine Biopsy Surveys (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Small vessel surveys are conducted within estuarine and nearshore coastal waters to collect tissue biopsy samples from bottlenose dolphins. Visual surveys are...

  12. GoM Estuarine Bottlenose Dolphin Photo-identification studies (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data sets include a compilation of small vessel based studies of bottlenose dolphins that reside within Mississippi Sound and nearshore coastal waters. The...

  13. GOSAILT: A hybrid of GOMS and SAILT with topography consideration (United States)

    Wu, S.; Wen, J.


    Heterogeneous terrain significantly complicated the energy, mass and momentum exchange between the atmosphere and terrestrial ecosystem. Understanding of topographic effect on the forest reflectance is critical for biophysical parameters retrieval over rugged area. In this paper, a new hybrid bidirectional reflectance distribution function (BRDF) model of geometric optical mutual shadowing and scattering-from-arbitrarily-inclined-leaves model coupled topography (GOSAILT) for sloping forest was proposed. The effects of slope, aspect, gravity field of tree crown, multiple scattering scheme, and diffuse skylight are considered. The area proportions of scene components estimated by the GOSAILT model were compared with the geometric optical model for sloping terrains (GOST) model. The 3-D discrete anisotropic radiative transfer (DART) simulations were used to evaluate the performance of GOSAILT. The results indicate that the canopy reflectance is distorted by the slopes with a maximum variation of 78.3% in the red band and 17.3% in the NIR band on a steep 60 º slope. Compared with the DART simulations, the proposed GOSAILT model can capture anisotropic reflectance well with a determine coefficient (R2) of 0.9720 and 0.6701, root-mean-square error (RMSE) of 0.0024 and 0.0393, mean absolute percentage error of 2.4% and 4.61% for the red and near-infrared (NIR) band. The comparison results indicate the GOSAIL model can accurately reproducing the angular feature of discrete canopy over rugged terrain conditions. The GOSAILT model is promising for the land surface biophysical parameters retrieval (e.g. albedo, leaf area index) over the heterogeneous terrain.

  14. Structure of the ent -Copalyl Diphosphate Synthase PtmT2 from Streptomyces platensis CB00739, a Bacterial Type II Diterpene Synthase

    Energy Technology Data Exchange (ETDEWEB)

    Rudolf, Jeffrey D.; Dong, Liao-Bin; Cao, Hongnan; Hatzos-Skintges, Catherine; Osipiuk, Jerzy; Endres, Michael; Chang, Chin-Yuan; Ma, Ming; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N.; Shen, Ben


    Terpenoids are the largest and most structurally diverse family of natural products found in nature, yet their presence in bacteria is underappreciated. The carbon skeletons of terpenoids are generated through carbocation-dependent cyclization cascades catalyzed by terpene synthases (TSs). Type I and type II TSs initiate cyclization via diphosphate ionization and protonation, respectively, and protein structures of both types are known. Most plant diterpene synthases (DTSs) possess three alpha-helical domains (alpha beta gamma), which are thought to have arisen from the fusion of discrete, ancestral bacterial type I TSs (alpha) and type II TSs (beta gamma). Type II DTSs of bacterial origin, of which there are no structurally characterized members, are a missing piece in the structural evolution of TSs. Here, we report the first crystal structure of a type II DTS from bacteria. PtnaT2 from Streptomyces platensis CB00739 was verified as an ent-copalyl diphosphate synthase involved in the biosynthesis of platensimycin and platencin. The crystal structure of PtmT2 was solved at a resolution of 1.80 angstrom, and docking studies suggest the catalytically active conformation of geranylgeranyl diphosphate (GGPP). Site-directed mutagenesis confirmed residues involved in binding the diphosphate moiety of GGPP and identified DxxxxE as a potential Mg2+-binding motif for type II DTSs of bacterial origin. Finally, both the shape and physicochemical properties of the active sites are responsible for determining specific catalytic outcomes of TSs. The structure of PtmT2 fundamentally advances the knowledge of bacterial TSs, their mechanisms, and their role in the evolution of TSs.

  15. SpirPro: A Spirulina proteome database and web-based tools for the analysis of protein-protein interactions at the metabolic level in Spirulina (Arthrospira) platensis C1. (United States)

    Senachak, Jittisak; Cheevadhanarak, Supapon; Hongsthong, Apiradee


    Spirulina (Arthrospira) platensis is the only cyanobacterium that in addition to being studied at the molecular level and subjected to gene manipulation, can also be mass cultivated in outdoor ponds for commercial use as a food supplement. Thus, encountering environmental changes, including temperature stresses, is common during the mass production of Spirulina. The use of cyanobacteria as an experimental platform, especially for photosynthetic gene manipulation in plants and bacteria, is becoming increasingly important. Understanding the mechanisms and protein-protein interaction networks that underlie low- and high-temperature responses is relevant to Spirulina mass production. To accomplish this goal, high-throughput techniques such as OMICs analyses are used. Thus, large datasets must be collected, managed and subjected to information extraction. Therefore, databases including (i) proteomic analysis and protein-protein interaction (PPI) data and (ii) domain/motif visualization tools are required for potential use in temperature response models for plant chloroplasts and photosynthetic bacteria. A web-based repository was developed including an embedded database, SpirPro, and tools for network visualization. Proteome data were analyzed integrated with protein-protein interactions and/or metabolic pathways from KEGG. The repository provides various information, ranging from raw data (2D-gel images) to associated results, such as data from interaction and/or pathway analyses. This integration allows in silico analyses of protein-protein interactions affected at the metabolic level and, particularly, analyses of interactions between and within the affected metabolic pathways under temperature stresses for comparative proteomic analysis. The developed tool, which is coded in HTML with CSS/JavaScript and depicted in Scalable Vector Graphics (SVG), is designed for interactive analysis and exploration of the constructed network. SpirPro is publicly available on the web

  16. Variación temporal de la población de la almeja Darina solenoides y del mejillón Mytilus Edulis Platensis, y su relación con la alimentación del ostrero austral

    Directory of Open Access Journals (Sweden)

    Lorenzo Javier Gallardo


    Full Text Available Resumen. El presente trabajo de investigación se ha planteado en el marco de una beca para alumnos avanzados de la UNPA, Unidad Académica Río Gallegos. Tiene como objetivo analizar las variaciones temporales de la población del mejillón Mytilus edulis platensis y de la almeja Darina solenoides y se inserta en un Proyecto de Investigación (29A/227 dirigido por Dra. Z. Lizarralde que tiene como objeto estudiar la ecología trófica del Ostrero Austral (Haematopus leucopodus en el estuario del río Gallegos (Santa Cruz. Durante el 2010 se efectuaron muestreos mensuales (abril a diciembre en un banco de mejillones y otro de almejas, con el objeto de analizar la variación temporal de la densidad y biomasa, y la estructura de tallas poblacional. Se analizó la granulometría y porcentaje de materia orgánica de los sedimentos. El sedimento del banco de mejillones se encuentra constituido en su mayoría por la fracción correspondiente a los gránulos; en el banco de almejas por arenas muy finas (43% y finas (39%. En ambos casos la materia orgánica no supera el 3 %. La densidad de mejillones alcanzó un valor máximo de 2255 individuos/m2 en abril y un mínimo de 497 en noviembre. La biomasa máxima se encontró en abril (110 g/m 2. La densidad de Darina solenoides alcanzó un valor máximo de 565 en junio y un mínimo de 282 individuos/m2 en el mes de octubre. La biomasa máxima ocurrió en diciembre (132 g/m2. No se detectó el período de reclutamiento de nuevos individuos en los bancos de las especies estudiadas.

  17. Changes of the delayed fluorescence characteristics in Spirulina, Anabaena and Chlorella in response to chromatic adaptation and irradiance

    International Nuclear Information System (INIS)

    Znak, N.Y.; Morgun, V.N.


    Efficiency of the energy transformation for CO2 fixation (E), and kinetics of the initial O-2-mediated electron transport of Spirulina platensis (Gem. ) Geitl, and Chlorella vulgaris Beijerinck cells were measured after adaptation to various growth irradiances (I) by means of the delayed fluorescence (DF) induction curves. Maxima of the membrane potential expenses during induction period were observed at I half saturating oxygen evolution; they were shifted according to growth I remaining higher in Spirulina than in Chlorella. The alterations of absorbance and fluorescence spectra at 25 degrees C after adaptation to I demonstrated changes in composition of pigments of algae, created to compensate for the imbalance in radiation absorption between the two photosystems. For Spirulina cells, the value of E was higher after growing under low I, or under blue radiation absorbed mainly by photosystem (PS) 1 (400-500 nm) with excitation by yellow (570 nm) radiation. For Chlorella cells, it was also higher after growing under low I. Under such conditions the half-rise time for DP-phase of DF induction curve decreased, which reflected an acceleration of kinetics of the initial electron transport between photosystems. An opposite situation was observed with Spirulina cells grown under high I or yellow radiation, and Chlorella cells from high I. Enhancement of effective PS2/PS1 ratio associated with decrease of reaction centre (RC) 2/RC1 stoichiometry may because of the increase of E and high membrane energization under saturating I in algae adapted to low I

  18. GoM Estuarine Bottlenose Dolphin Photo-identification studies - NRDA (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data sets include a compilation of small vessel based studies of bottlenose dolphins that reside within Barataria Bay, LA, Mississippi Sound, MS and nearshore...

  19. Designing a reservoir flow rate experiment for the GOM hydrate JIP leg 2 LWD drilling

    Energy Technology Data Exchange (ETDEWEB)

    Gullapalli, I.; Silpngarmlert, S.; Reik, B.; Kamal, M.; Jones, E. [Chevron Energy Technology Co., San Ramon, CA (United States); Moridis, G. [Lawrence Berkeley National Laboratories, CA (United States); Collett, T. [United States Geological Survey, Reston, VA (United States)


    Studies have indicated that the Gulf of Mexico may contain large deep sea hydrate deposits. This paper provided details of short-term production profiles obtained from a geological model of hydrate deposits located in the Gulf area. A well test analysis tool was used to obtain the production parameters. Pressure transients from numerical simulations of various well test designs were used to provide estimates of important flow parameters. The aim of the study was to determine the type and duration of a well test capable of providing data to support the accurate modeling of gas hydrate deposits. Parameters studied in the test included the effects of permeability and hydrate saturation as a function of the duration of the flow test. Results indicated that production using a constant bottom hole pressure is an appropriate method of impacting hydrate dissociation by depressurization. However, changes in transient pressure plots could not be characterized in order to identify regions of varying saturation levels. Results suggested that the rate of effective water to effective gas was higher than rates obtained from relative permeability relations due to low gas saturation levels. Fluid saturation regions were in areas of low confidence in relative permeability curves. However, it was not possible to calculate absolute permeability of the reservoir for systems with short production periods. Further studies are needed to determine effective permeability using history matching and a hydrate simulator. 8 refs., 4 tabs., 27 figs.

  20. Empowerment et diversité culturelle : quelques prolégomènes


    Gagnon, Alain G.; May, Paul


    Le présent texte explore l’articulation entre l’empowerment et la diversité culturelle, et notamment les voies prometteuses du jumelage entre ces deux termes. L’apport de la philosophie de Charles Taylor conjuguée aux récentes théories du fédéralisme permet de porter un regard nouveau sur la thématique des revendications identitaires en milieu urbain et d’esquisser des solutions institutionnelles pour répondre au double défi posé par le pluralisme culturel et de la nouvelle configuration écon...

  1. Empowerment et diversité culturelle : quelques prolégomènes

    Directory of Open Access Journals (Sweden)

    Alain G. Gagnon


    Full Text Available Le présent texte explore l’articulation entre l’empowerment et la diversité culturelle, et notamment les voies prometteuses du jumelage entre ces deux termes. L’apport de la philosophie de Charles Taylor conjuguée aux récentes théories du fédéralisme permet de porter un regard nouveau sur la thématique des revendications identitaires en milieu urbain et d’esquisser des solutions institutionnelles pour répondre au double défi posé par le pluralisme culturel et de la nouvelle configuration économico-politique sous-tendant la mondialisation. Malgré ses aspects positifs, cet article entend montrer, dans le sillon des travaux de Bernard Jouve, les limites et l’utilisation équivoque que l’on peut faire de l’empowerment, qui sert parfois à justifier un désengagement de l’État-providence en faveur des populations les plus démunies, et qui ne présente pas toujours les garanties nécessaires pour lutter contre les discriminations survenant au sein des Minorities within Minorities.This article explores linkages between empowerment and cultural diversity largely defined, and at times a promising convergence between the two notions. Charles Taylor’s contribution to current theories of federalism allows us to cast a rejuvenated  look on cultural claims in urban centers and to sketch institutional avenues to face the dual challenge posed by cultural pluralism and the new socio-political configuration underlying globalization. In spite of some very positive aspects, and following Bernard Jouve’s intellectual insights, this text illustrates the extent to which the notion of empowerment can also be deceiving as it might add limitations for weaker communities, and create new hurdles as the undermining of the welfare state has showned. In addition, empowerment does not always provide guarantees to counter discrimation as the case of «Minorities witin Minorities» reveal.

  2. Usability engineering of "In Vehicle Information Systems" with multi-tasking GOMS


    Urbas, L.; Leuchter, S.


    The developments in vehicle electronics and new services are supposed to promise more convenience in driving. The offers and ideas range from vehicle-related installations, such as accident alert, petrol station assistance, dynamic navigation and travel guide, to communication and entertainment services. There is one central design problem that is essential for achieving the main objective "safe motor vehicle driving", i.e. the use of the new service must not unduly distract the driver. In th...

  3. Protein (Cyanobacteria): 422295 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  4. Evaluation of the cosmetic potential of the Cyanobacterium Spirulina platensis


    Novak, Alessandra Cristine


    Abstract: Toiletry, Perfumery and Cosmetics Sector (TPCS) occupies a prominent place in modern society. The search for beauty and wellness, combined with increased life expectancy of the population, causes the intensive search to products that improve appearance, hygiene and health. Thus, the development of cosmetics is very stimulated. Another important feature is the continuously pressure from consumers and companies to this development of new and innovative products, raising competitivenes...

  5. Production of Spirulina platensis by adding sodium bicarbonate and ...

    African Journals Online (AJOL)



    Apr 2, 2014 ... consumption of carbohydrates for respiration and this resulted in a decrease ... crease of cell took place in the type II nutrition due to the rates of urea and .... the best cellular increase and the best protein ratio. In this case, we ...

  6. Prolégomènes à une théorie des modes de formation des dispositions politiques

    Directory of Open Access Journals (Sweden)

    Fabienne Federini


    Full Text Available À partir de la critique des analyses menées par Pierre Bourdieu sur le politique, il s’agit de comprendre la diversité des dispositions politiques des acteurs en focalisant plus particulièrement notre attention sur les conditions sociales de leur formation, tout en laissant de côté la variété des contextes de leur actualisation, de leur mise en œuvre ou de leur mise en veille. Acquérir une culture politique précocement au sein de sa famille, ce n’est pas la même chose que l’acquérir plus tardivement à la suite d’un déclassement social, d’une rupture professionnelle ou lors d’une guerre par exemple. On considère ainsi que les différents temps de la socialisation politique sur des acteurs ayant une formation scolaire équivalente ont des effets sur la formation de leurs dispositions politiques, dont le registre de politisation et les pratiques qu’elles engendrent sont autant d’indices.From the review of analysis by Pierre Bourdieu on politics, diversity of political aptitudes of the actors has to be understood by particularly focusing attention on the social conditions in which these aptitudes are produced. Acquiring early political knowledge within family is different from acquiring it later following loss of social position, professional disruption or during war. We thus believe that different moments of political socialization have different effects on the means of production of political aptitudes of actors ; the plurality of their politization degrees and the variety of political practices are the sign of it.A partir de la crítica de los análisis efectuados por Pierre Bourdieu sobre la política se intenta aprehender la diversidad de las disposiciones hacia lo político, focalizándose en particular en las condiciones sociales de la formación de esas disposiciones, dejando al lado la variedad de contextos que ayudan a actualizarlas, la aplicación de esas disposiciones o al contrario, su olvido. Adquirir precozmente en el seno de la familia una cultura política no es lo mismo que adquirirla mas tarde al descender de categoría social, de una ruptura profesional o por una guerra. Puede considerarse que los diferentes momentos de la socialización política en las personas que poseen una formación escolar equivalente pueden tener consecuencias sobre la formación de sus disposiciones políticas de las cuales el modo de politización y la práctica consecuente son sus índices.

  7. 78 FR 14116 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Eastern Planning Area (EPA) Lease Sale 225... (United States)


    ... a limited number of paper copies. In keeping with the Department of the Interior's mission to.... However, if you require a paper copy, BOEM will provide one upon request if copies are still available. 1...:00 p.m. EDT; Panama City Beach, Florida: Wednesday, March 27, 2013, Wyndham Bay Point Resort, 4114...

  8. 76 FR 22139 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA), Oil and Gas... (United States)


    ... EIS and the 2009-2012 SEIS and to consider the Deepwater Horizon event. This Draft SEIS provides... activities and accidental events, including a possible large-scale event, associated with the proposed WPA...

  9. 77 FR 2991 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Central Planning Area (CPA), Oil and Gas... (United States)


    ... circumstances and information arising from, among other things, the Deepwater Horizon event. This Final... Supplemental EIS and in consideration of the Deepwater Horizon event, including scientific journals; interviews... resources and socioeconomic factors. This analysis considers both routine activities and accidental events...

  10. 77 FR 67394 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA) Lease Sale 233... (United States)


    ... information in light of the Deepwater Horizon event. This Draft Supplemental EIS provides updates on the... consideration of the Deepwater Horizon event, reviewing scientific journals, available scientific data, and... impacts of routine activities and accidental events, and the proposed lease sales' incremental...

  11. 78 FR 52562 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning... (United States)


    ... Prepare a Supplemental Environmental Impact Statement (EIS). SUMMARY: Consistent with the regulations... Supplemental EIS will update the environmental and socioeconomic analyses in the Gulf of Mexico OCS Oil and Gas... Area Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact Statement (OCS EIS/EA BOEM...

  12. 78 FR 64242 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning... (United States)


    ... (NOA) of the Draft Supplemental Environmental Impact Statement (EIS) and Public Meetings. SUMMARY: BOEM... Impact Statement (OCS EIS/EA BOEM 2012-019) (2012- 2017 WPA/CPA Multisale EIS) and in the Gulf of Mexico... Lease Sale 231, Final Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233...

  13. 78 FR 21969 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA) Lease Sale 233... (United States)


    .... ACTION: Notice of Availability (NOA) of the Final Supplemental Environmental Impact Statement (EIS... Environmental Impact Statement (OCS EIS/EA BOEM 2012-019) (2012-2017 Multisale EIS), completed in July 2012, in... to the cumulative impacts on environmental and socioeconomic resources. The oil and gas resource...

  14. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning... (United States)


    ... Prepare a Supplemental Environmental Impact Statement (EIS) SUMMARY: Consistent with the regulations... 248; Central Planning Area (CPA) Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact... Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233/CPA 231 Supplemental EIS). The...

  15. 75 FR 69122 - Outer Continental Shelf (OCS), Western and Central Planning Areas, Gulf of Mexico (GOM) Oil and... (United States)


    ... focus on updating the baseline conditions and potential environmental effects of oil and natural gas.... Comments Public meetings will be held in locations near these areas in early to mid November 2010. The...

  16. Quantitative Risk Assessment (QRA) for an Underground Blowout Scenario in the Gulf of Mexico (GoM) Well (United States)

    Tyagi, M.; Zulqarnain, M.


    Offshore oil and gas exploration and production operations, involve the use of some of the cutting edge and challenging technologies of the modern time. These technological complex operations involves the risk of major accidents as well, which have been demonstrated by disasters such as the explosion and fire on the UK production platform piper alpha, the Canadian semi-submersible drilling rig Ocean Ranger and the explosion and capsizing of Deepwater horizon rig in the Gulf of Mexico. By conducting Quantitative Risk Assessment (QRA), safety of various operations as well as their associated risks and significance during the entire life phase of an offshore project can be quantitatively estimated. In an underground blowout, the uncontrolled formation fluids from higher pressure formation may charge up shallower overlying low pressure formations or may migrate to sea floor. Consequences of such underground blowouts range from no visible damage at the surface to the complete loss of well, loss of drilling rig, seafloor subsidence or hydrocarbons discharged to the environment. These blowouts might go unnoticed until the over pressured sands, which are the result of charging from higher pressure reservoir due to an underground blowout. Further, engineering formulas used to estimate the fault permeability and thickness are very simple in nature and may add to uncertainty in the estimated parameters. In this study the potential of a deepwater underground blowout are assessed during drilling life phase of a well in Popeye-Genesis field reservoir in the Gulf of Mexico to estimate the time taken to charge a shallower zone to its leak-off test (LOT) value. Parametric simulation results for selected field case show that for relatively high permeability (k = 40mD) fault connecting a deep over-pressured zone to a shallower low-pressure zone of similar reservoir volumes, the time to recharge the shallower zone up to its threshold LOT value is about 135 years. If the ratio of the reservoir volumes for shallower to deeper zone is about 0.1, the recharging time significantly decreased to 24 years. Also, the hydrocarbons might possibly migrate through casing-wellbore annulus due to delamination fractures between cement interfaces with rock/casing and any other micro annulus gap not isolated by cement.

  17. 77 FR 65408 - Outer Continental Shelf (OCS) Western Planning Area (WPA) Gulf of Mexico (GOM) Oil and Gas Lease... (United States)


    ... leases in depths less than 400 meters with an initial period longer than 5 years, royalty rates, minimum... $25.00 per acre or fraction thereof for blocks in water depths of less than 400 meters. $100.00 per acre or fraction thereof for blocks in water depths of 400 meters or deeper. Rental Rates Annual rental...

  18. 76 FR 70473 - Outer Continental Shelf (OCS) Western Planning Area (WPA) Gulf of Mexico (GOM) Oil and Gas Lease... (United States)


    ... period of the lease term for blocks in water depths of 400 meters to less than 1,600 meters, (2) the minimum bonus bid has increased for blocks in water depths of 400 meters or deeper, (3) no deepwater... meters and (2) 400 meters or more. Successful Bidders: The BOEM requires each company that has been...

  19. 75 FR 6874 - Outer Continental Shelf (OCS) Central Planning Area (CPA) Gulf of Mexico (GOM) Oil and Gas Lease... (United States)


    ... for blocks in water depths of 400 meters to less than 1,600 meters. Blocks in 400 to less than 800... resulting from this lease sale. Leases in water depths of 400 meters to less than 800 meters will be offered... still may require the full 10-year term. In both the 400-800 and 800-1,600 meter cases, the lease...

  20. Spirulina platensis Extract Supplementation Attenuates Diabetic Complication in Gamma Irradiated Rats

    International Nuclear Information System (INIS)

    Ibrahim, R.M.; Sherif, N.H


    Diabetes mellitus, a metabolic disorder, is becoming a major health problem. Although there are a number of drugs available on the market, long time use may cause a number of side effects. Spirulina is a microscopic and filamentous cyanobacterium that contains essential amino acids, essential fatty acids, vitamins, minerals and anti-oxidative components. The objective of this study was to analyze the possible hypo glycemic and hypolipidaemic effects of Spirulina intake against streptozotocin and/or radiation induced diabetes in male albino rats. In the experiment, a total of 60 rats were used and the rats were divided into six groups of ten rats each: group I, normal untreated rats (control) ; group II, animals of this group received only Spirulina (15 mg/kg) for 30 consecutive days; group III, animals were injected intraperitoneally with a freshly prepared solution of streptozotocin(STZ) (45 mg/kg i.p.) in 0.1 M citrate buffer, ph 4.5 for 30 consecutive days ; group IV, as group II then given Spirulina for 30 days , group V, same as group III then exposed to 6 Gy gamma radiation as a single dose shot ; and group VI, Spirulina + diabetic irradiated group, rats were given orally Spirulina (15 mg/kg) then injected in - traperitoneally with (STZ) followed by irradiation at a dose level of 6 Gy as a single dose shot. The results revealed that animal treated with STZ or/and exposed to gamma radiation showed an increase in fasting blood sugar (FBS), glycosylated haemoglobin (HbA1c), total cholesterol (TC), triglyceride (Tg), low density lipoprotein (LDL), plasma insulin and C- peptide in compared to control. Also, a marked increase in the liver tissue of thiobarbituric acid reactive substance (TBARS) and a decrease in glutathione (GSH) and catalase (CAT) was observed. Oral pretreatment of rats with aqueous extract of Spirulina (SPE) counteracted STZ or/and radiation induced lipid peroxidation and encouraging hypoglycemic and hypolipidaemic properties of the treated animals. On the basis of these results, one could conclude that (SPE) could be considered a promising agent as a functional food for diabetes management

  1. In vitro antioxidant activity assessment on alcoholic extract of cyanobacteria cultures from Spirulina platensis


    Senthilkumaran Jagadeesh J, Jaiganesh K, Somasundaram G


    The antioxidant supplementation such as vitamin C, E, A and beta carotene etc, has proven to prevent the process of ageing caused by free radicals. Antioxidants either prevent free radical production or counteract the impeding damage by doing so they are involved in the protection and prevention of cellular damage which is the common pathway for cancer, aging and much disease. The cyanobacteria is a blue green micro algae believed to be a rich antioxidant source, found in abundance in Spiruli...

  2. Photodynamic effect and mechanism study of selenium-enriched phycocyanin from Spirulina platensis against liver tumours. (United States)

    Liu, Zijian; Fu, Xiang; Huang, Wei; Li, Chunxia; Wang, Xinyan; Huang, Bei


    Selenium-containing phycocyanin (Se-PC) has been proved to have many biological effects, including anti-inflammatory and antioxidant. In this study, we investigated the photodynamic therapy (PDT) effects of Se-PC against liver tumour in vitro and in vivo experiment. Our results demonstrated that the half lethal dose of Se-PC PDT on HepG2 cells was 100μg/ml PC containing 20% selenium. Se-PC location migration from lysosomes to mitochondria was time dependent. In in vivo experiments, the tumour inhibition rate was 75.4% in the Se-PC PDT group, compared to 52.6% in PC PDT group. Histological observations revealed that the tumour cells outside the tissue showed cellular necrosis, and those inside the tissue exhibited apoptotic nuclei and digested vacuoles in the cytoplasm after Se-PC PDT treatment. Antioxidant enzyme analysis indicated that GSH-Px activity was linked to the selenium content of Se-PC, and SOD activity was affected by PC PDT. Therefore, Se-PC PDT could induce cell death through free radical production of PDT in tumours and enhance the activity of antioxidant enzymes with selenium in vivo. The mechanism of Se-PC PDT against liver tumour involves hematocyte damage and mitochondria-mediated apoptosis accompanied with autophagy inhibition during early stage of tumour development, which displayed new prospect and offered relatively safe way for cancer therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Bioethanol Production by Carbohydrate-Enriched Biomass of Arthrospira (Spirulina) platensis

    DEFF Research Database (Denmark)

    Markou, Giorgos; Angelidaki, Irini; Nerantzis, Elias


    at four concentrations, 2.5 N, 1 N, 0.5 N and 0.25 N, and for each acid concentration the saccharification was conducted under four temperatures (40 °C, 60 °C, 80 °C and 100 °C). Higher acid concentrations gave in general higher reducing sugars (RS) yields (%, gRS/gTotal sugars) with higher rates, while...... the increase in temperature lead to higher rates at lower acid concentration. The hydrolysates then were used as substrate for ethanolic fermentation by a salt stress-adapted Saccharomyces cerevisiae strain. The bioethanol yield (%, gEtOH/gBiomass) was significantly affected by the acid concentration used...

  4. First description of a cyanophage infecting the cyanobacterium Arthrospira platensis (Spirulina)

    Digital Repository Service at National Institute of Oceanography (India)

    Jacquet, S.; Zhong, X.; Parvathi, A.; Ram, A.S.P.

    Cyanobacteria constitute a versatile group of photosynthetic bacteria of immense commercial and ecological importance. Some species of this group are cultivated and sold as food because of their high nutritional value. This is typically the case...

  5. Improvement of lipid yield from microalgae Spirulina platensis using ultrasound assisted osmotic shock extraction method (United States)

    Adetya, NP; Hadiyanto, H.


    Microalgae Spirulina sp. has been identified as potential source of natural food supplement and food colorant. The high water content of microalgae (70-90%) causes an obstacle in biomass dehydration which requires large amounts of energy, eventually damaging the lipid in the microalgae. Therefore, the lipid must be extracted by using a suitable method which complies to wet biomass conditions. One of the methods is applying osmotic shock. This study was aimed to investigate the influence of osmotic agent (NaCl) concentration (10-30%) and extraction time (20-50 min) on yield of lipid and also to determine the optimal conditions in the extraction process through response surface methodology. The extraction was conducted at a temperature of 40°C under ultrasound frequency of 40 kHz. The result showed that the optimum yield lipid obtained was 6.39% in 16.98% NaCl concentration for 36 minutes 10 seconds.

  6. The Effect of Temperature on Protein and Amino Acid Composition of Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Leyla Hızarcı Uslu


    Full Text Available Sıcaklığın Spirulina platensis’in protein ve amino asit kompozisyonu üzerine etkisi. Bu çalışma, mevsime bağlı iklim değişikliğinin yaz ve kış mevsimlerinde kültüre alınan Spirulina platensis’in protein içeriği ve amino asit kompozisyonuna etkilerini incelemek amacıyla yürütülmüştür. Çalışma boyunca ışık yoğunluğu, pH ve tuzluluk günlük olarak ölçülmüş, sıcaklık ve çözünmüş oksijen gün boyunca ve gece ölçülmüştür. Yaz ve kış mevsiminde ortalama gündüz sıcaklığı sırasıyla 33,9±0,4 ºC ve 18,6±0,5 ºC olarak belirlenirken, gece sıcaklığı 29,9±0,2 °C ve 14.4±0.2°C olarak belirlenmiştir. Ortalama ışık yoğunluğu yaz mevsiminde 848,3 µmol m-2s-1 iken kışın 506,26±48 µmol m-2s-1 olmuştur. Yaz büyüme döneminde protein miktarı (72,9±03 % ve amino asit konsantrasyonu kış dönemine göre daha yüksek bulunmuştur. Amino asitlerden Prolin, Sistin ve Arjinin sadece kış mevsiminde gözlenmiştir

  7. Kandungan Minyak Botryococcus Braunii, Nannochloropsis sp., dan Spirulina Platensis pada Umur yang Berbeda

    Directory of Open Access Journals (Sweden)

    Sri Amini


    cell density was reached by S. platensiswith 8.46 log cell/mL on day 13, while the highest growth rate was shown by S. platensiswith growth rate (k = 9.40 on day 3. The highest yield of oil was obtained from B. brauniion day 9 which was 14.90%.

  8. Le rapport métropolisation – régionalisation : prolégomènes pour un renouvellement paradigmatique

    Directory of Open Access Journals (Sweden)

    Jean-Marc Fontan


    Full Text Available L’idée de consacrer une réflexion à l’analyse du lien s’établissant entre des métropoles et leurs régions périphériques émerge des travaux réalisés et présentés au colloque 1998 de l’Association d’économie politique (Fontan, Klein, Tremblay, 1999. Plusieurs conférenciers, dont Veltz et Jalabert, posaient alors un constat de fond : l’analyse de la réalité socio-économique métropolitaine ne peut se limiter au cadre référentiel du paradigme du développement régional. Cet article répond à trois objectifs. Dans un premier temps, j’invoque les motifs qui nous ont guidé dans la réalisation de ce numéro d’Interventions économiques. Dans un deuxième temps, je soulève, à partir de quelques constats empiriques et théoriques, quelques questions sur la nature des liens passés et à venir entre la Grande région de Montréal et les autres régions du Québec. Dans un troisième temps, je présente les contributions des différents auteurs à ce numéro.I am pursuing tree goals in this article. First of all, I present the reasons underlying the production of this first edition of the new electronic format of Interventions Économiques. In second time, from empirical observations and theorithecal new developments, I reconsider the nature of past and present links between the Great Montreal Region and others Quebec’s sub regions. In the last part of the article, I introduce the articles of the others contributors.

  9. Occurrence of 210Po in periwinkle (Littorina undulata, Gray, 1839) collected from Kudankulam (Gulf of Mannar (GOM), Southeast coast of India)

    International Nuclear Information System (INIS)

    Sunith Shine, S.R.; Feroz Khan, M.; Godwin Wesley, S.


    Highlights: • Polonium-210 was quantified in the periwinkle Littorina undulata. • Smaller-sized periwinkles displayed higher Polonium-210. • Marked variation in 210 Po activity between season and sampling site. • The internal dose rate estimated using ERICA Assessment Tool. • The daily intake and committed effective dose estimated. -- Abstract: Polonium-210 activity concentration was analysed in the whole body tissue of periwinkle Littorina undulata collected from intertidal rocky shore along Kudankulam coast. We carried out the study for a period of 12 months (2011–2012) focusing on three seasons. 210 Po was found non-uniformly distributed among the periwinkles depending on the allometry. The 210 Po accumulation showed a significant difference between seasons (p 210 Po compared to larger ones (p 210 Po varied from 13.5 to 58.9 Bq/kg (wet). The activity of 210 Po was also quantified in seawater and intertidal sediments to calculate the biological concentration factor (BCF) and radiation dose rate. The dose rate to the winkles was performed using ERICA Assessment Tool and it was within the prescribed limit. The intake of 210 Po through periwinkles delivered an effective dose in the range of 2.2–9.6 μSv/y to human beings

  10. Protein (Cyanobacteria): 161200 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  11. Protein (Cyanobacteria): 479132100 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  12. Protein (Cyanobacteria): 479132040 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  13. Protein (Cyanobacteria): 479132036 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  14. Protein (Cyanobacteria): 454073 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  15. Acute phase and transport protein synthesis in simulated infection in undernourished men using uniformly labelled Spirulina Platensis

    International Nuclear Information System (INIS)

    Reeds, P.J.; Opekun, A.; Jahoor, F.; Wong, W.W.; Klein, P.D.


    Although it has been known for many years that injury and infection lead to body nitrogen loss, the reason has remained obscure. In this paper, we develop the argument that the processes that are activated during infection demand the provision of specific amino acids which have to be supplied from body protein. In particular, we show that the positive acute phase proteins are very rich in the aromatic amino acids and the exaggerated use of these amino acids (phenylalanine, tryptophan and tyrosine) in acute phase protein synthesis lead to an endogenous ''amino acid imbalance'' which restricts the use of other amino acids for tissue protein synthesis. Minimally invasive protocols, involving the administration of 15 N and 13 C-labelled amino acids for studying whole body nitrogen turnover, amino acid oxidation and plasma protein synthesis are described. (author). 22 refs, 3 tabs

  16. Capacidade antioxidante da microalga Spirulina platensis em células da levedura Saccharomyces cerevisiae submetidas ao estressor paraquat


    Guarienti, Cíntia; Bertolin, Telma Elita; Costa, Jorge Alberto Vieira


    Em virtude de várias publicações terem mostrado a alta associação entre a geração de radicais livres e as doenças crônico-degenerativas, tem havido grande interesse por alimentos funcionais antioxidantes. O excesso de espécies reativas no organismo resulta em estresse oxidativo que provoca danos celulares e teciduais. A microalga Spirulina tem sido pesquisada em função de suas propriedades nutricionais e antioxidantes. O objetivo desse trabalho foi de avaliar a atividade antioxidante da mi...

  17. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis


    Chen, Tianfeng; Yang,Fang; Wong,Ka-Hing; Yang,Yufeng; Li,Xiaoling; Jiang,Jie; Wu,Hualian; Zheng,Wenjie


    Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellu...

  18. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals


    Radhakrishnan Ammu; Lim Yen-Wei; Chu Wan-Loy; Lim Phaik-Eem


    Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protectiv...

  19. Análisis de la cadena del café y estrategia de mejoras para el sector caficultor en la Provincia de Manabí Cantón Jipijapa Parroquia Pedro Pablo Goméz


    Medina Micolta, Martha; Luna Merchán, Rómulo


    El presente trabajo de tesis se realizó con el objetivo de analizar los actores de la cadena del café para establecer estrategias de mejoras promoviendo la productividad, competitividad y sostenibilidad del sector caficultor en la provincia de Manabí cantón Jipijapa parroquia Pedro Pablo Gómez, la metodología utilizada se basa en el método inductivo, tras una primera etapa de observación, análisis y clasificación de los hechos del sector cafetalero obtendremos la solución del problema plante...

  20. Historic Shipwrecks as Ecosystem Monitoring Platforms in the Wake of Deepwater Horizon? Results of the Gulf of Mexico Shipwreck Corrosion, Hydrocarbon Exposure, Microbiology, and Archaeology (GOM-SCHEMA) Project (United States)

    Damour, M.; Hamdan, L. J.; Salerno, J. L.; McGown, C.; Blackwell, C. A.; Church, R.; Warren, D.; Horrell, C.; Jordan, B.; Moore, J.


    Historic shipwrecks and other archaeological sites are protected by a well-established body of historic preservation laws intended to preserve these sensitive, non-renewable resources. While the cultural, historical, and archaeological value of historic shipwrecks is unequivocal, their function and value as ecosystem monitoring platforms following a major environmental disaster is becoming apparent. Shipwrecks have been found in previous studies to serve as artificial reefs and hotspots of biodiversity, essentially providing the basis for an intact ecosystem. This is especially true in the deepwater marine environment where natural hard-bottom is sparse. Micro- and macro-infaunal diversity on shipwrecks and their sensitivity to environmental change demonstrates the suitability of these platforms for monitoring ecosystem impact and recovery. After the 2010 Deepwater Horizon oil spill, the Bureau of Ocean Energy Management (BOEM) and partners initiated a multidisciplinary study to examine spill effects on shipwrecks and their associated microbial communities. To assess these impacts and to perform comparative analyses, the team collected microbiological, geochemical, and archaeological data at wooden- and metal-hulled shipwrecks within and outside of the subsurface spill-impacted area. Microbial community biodiversity informs us of micro-scale changes while 3D laser and sonar data reveal macro-scale changes. A multidisciplinary approach informs us of the roles microorganisms have in shipwreck degradation and corrosion as well as their response to ecosystem impacts. Results of the study identified multiple lines of evidence that sites were impacted by exposure to spill-related contaminants. Future multidisciplinary studies at these sites, as part of a long-term monitoring program, should inform on ecosystem recovery.

  1. Isolation, characterization and localization of extracellular polymeric substances from the cyanobacterium

    NARCIS (Netherlands)

    Ahmed, M.; Wijnholds, A.; Stal, L.J.; Hasnain, S.


    Arthrospira platensis is a cyanobacterium known for its nutritional value and secondary metabolites. Extracellular polymeric substances (EPS) are an important trait of most cyanobacteria, including A. platensis. Here, we extracted and analysed different fractions of EPS from a locally isolated

  2. Protein (Cyanobacteria): 479132094 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  3. Offshore Pipeline Locations in the Gulf of Mexico, Geographic NAD27, MMS (2007) [pipelines_vectors_mms_2007 (United States)

    Louisiana Geographic Information Center — Offshore Minerals Management Pipeline Locations for the Gulf of Mexico (GOM). Contains the lines of the pipeline in the GOM. All pipelines existing in the databases...

  4. Offshore Pipeline Locations in the Gulf of Mexico, Geographic NAD27, MMS (2007) [pipelines_points_mms_2007 (United States)

    Louisiana Geographic Information Center — Offshore Minerals Management Pipeline Locations for the Gulf of Mexico (GOM). Contains the points of the pipeline in the GOM. All pipelines existing in the databases...

  5. Isolation and characterization of oxygen-evolving photosystem II particles and photosystem II core complex from the filamentous cyanobacterium Spirulina platensis

    Czech Academy of Sciences Publication Activity Database

    Šetlíková, Eva; Sofrová, D.; Kovář, V.; Budáč, Petr


    Roč. 51, č. 4 (2013), s. 517-530 ISSN 0300-3604 R&D Projects: GA ČR GA206/08/1683; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : antibodies * fluorescence spectra * IMAC chromatography Subject RIV: EE - Microbiology, Virology Impact factor: 1.007, year: 2013

  6. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis

    DEFF Research Database (Denmark)

    Løbner, Morten; Walsted, Anette; Larsen, Rune


    administration for 3 days (P production persisted after 56 days (P ... production of the Th1 cytokines tumor necrosis factor (TNF)-alpha, interleukin (IL)-2, and interferon (IFN)-gamma was increased after Immunlina...

  7. The effects of nitrogen deficiencies on the lipid and protein contents ...

    African Journals Online (AJOL)

    Nitrogen deficiencies were studied in Spirulina platensis (Cyanophyceae) with the aim of determining the effects of the 50 and 100% deficient nitrogen on the lipid and protein contents of the cell under laboratory conditions. S. platensis cultures were grown in Spirulina medium and kept at the constant room temperature of ...

  8. Studies on the water quality and biota of a tidal eutrophic creek ...

    African Journals Online (AJOL)

    ... E.monodon, Navicula gracilis, N. mutica, Ulnariaulna, Nitzschia palea, Pinnularia braunii, P. gibba, Microcystis aeruginosa and Spirulina platensis. Of the 15 mudflat algae Nitzschia palea, Pinnularia braunii, P. gibba and Spirulina platensis were environmentally important species. The population of the benthic fauna was ...

  9. Characterization of phytoplankton pigments and functional community structure in the Gulf of Mannar and the Palk Bay using HPLC–CHEMTAX analysis.

    Digital Repository Service at National Institute of Oceanography (India)

    Madhu, N.V.; Ullas, N.; Ashwini, R.; Meenu, P.; Rehitha, T.V.; Lallu, K.R.

    Phytoplankton marker pigments and their functional groups were identified for the first time in the Gulf of Mannar (GoM) and the Palk Bay (PB), located in the southeast coast of India using HPLC–CHEMTAX analytical techniques. The GoM generally...

  10. Malaysia and the Knowledge Economy: Building a World-Class Higher Education System. Human Development Sector Reports (United States)

    Regel, Omporn; Salmi, Jamil; Watkins, Alfred; Tan, Hong; Dawkins, John; Saroyan, Alenoush; Vestergaard, Jakob


    This report was prepared at the request of the Government of Malaysia (GOM) as a contribution to the long term development objectives for the university sector under the Ninth Malaysia Plan. The GOM is considering new policy directions to make the country a more competitive player in the world economy. Such a strategy will require bold innovations…

  11. Gaseous Oxidized Mercury Dry Deposition Measurements in the Southwestern USA: A Comparison between Texas, Eastern Oklahoma, and the Four Corners Area

    Directory of Open Access Journals (Sweden)

    Mark E. Sather


    Full Text Available Gaseous oxidized mercury (GOM dry deposition measurements using aerodynamic surrogate surface passive samplers were collected in central and eastern Texas and eastern Oklahoma, from September 2011 to September 2012. The purpose of this study was to provide an initial characterization of the magnitude and spatial extent of ambient GOM dry deposition in central and eastern Texas for a 12-month period which contained statistically average annual results for precipitation totals, temperature, and wind speed. The research objective was to investigate GOM dry deposition in areas of Texas impacted by emissions from coal-fired utility boilers and compare it with GOM dry deposition measurements previously observed in eastern Oklahoma and the Four Corners area. Annual GOM dry deposition rate estimates were relatively low in Texas, ranging from 0.1 to 0.3 ng/m2h at the four Texas monitoring sites, similar to the 0.2 ng/m2h annual GOM dry deposition rate estimate recorded at the eastern Oklahoma monitoring site. The Texas and eastern Oklahoma annual GOM dry deposition rate estimates were at least four times lower than the highest annual GOM dry deposition rate estimate previously measured in the more arid bordering western states of New Mexico and Colorado in the Four Corners area.

  12. Alternative futures of dissolved inorganic nitrogen export from the Mississippi River Basin: influence of crop management, atmospheric deposition, and population growth (United States)

    Nitrogen (N) export from the Mississippi River Basin contributes to seasonal hypoxia in the Gulf of Mexico (GOM). We explored monthly dissolved inorganic N (DIN) export to the GOM for a historical year (2002) and two future scenarios (year 2022) by linking macroeonomic energy, ag...

  13. Why do satellite imageries show exceptionally high chlorophyll in the Gulf of mannar and the Palk bay during the norteast monsoon?.

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothibabu, R.; Madhu, N.V.; Jagadeesan, L.; Anjusha, A.; Mohan, A.P.; Ullas, N.; Sudheesh, K.; Karnan, C.

    in the Indian sector of the GoM and the PB in January 2011 showed significant overestimations in the satellite data. This error was much higher in the PB (60–80 %) as compared to the GoM (18–28 %). The multivariate analyses evidenced that the exceptionally high...

  14. Comparison of gaseous oxidized Hg measured by KCl-coated denuders, and nylon and cation exchange membranes. (United States)

    Huang, Jiaoyan; Miller, Matthieu B; Weiss-Penzias, Peter; Gustin, Mae Sexauer


    The chemical compounds that make up gaseous oxidized mercury (GOM) in the atmosphere, and the reactions responsible for their formation, are not well understood. The limitations and uncertainties associated with the current method applied to measure these compounds, the KCl-coated denuder, are not known due to lack of calibration and testing. This study systematically compared the uptake of specific GOM compounds by KCl-coated denuders with that collected using nylon and cation exchange membranes in the laboratory and field. In addition, a new method for identifying different GOM compounds using thermal desorption is presented. Different GOM compounds (HgCl2, HgBr2, and HgO) were found to have different affinities for the denuder surface and the denuder underestimated each of these compounds. Membranes measured 1.3 to 3.7 times higher GOM than denuders in laboratory and field experiments. Cation exchange membranes had the highest collection efficiency. Thermodesorption profiles for the release of GOM compounds from the nylon membrane were different for HgO versus HgBr2 and HgCl2. Application of the new field method for collection and identification of GOM compounds demonstrated these vary as a function of location and time of year. Understanding the chemistry of GOM across space and time has important implications for those developing policy regarding this environmental contaminant.

  15. A Lithium-Sensitive and Sodium-Tolerant 3′-Phosphoadenosine-5′-Phosphatase Encoded by halA from the Cyanobacterium Arthrospira platensis Is Closely Related to Its Counterparts from Yeasts and Plants


    Zhang, Ju-Yuan; Zou, Jie; Bao, Qiyu; Chen, Wen-Li; Wang, Li; Yang, Huanming; Zhang, Cheng-Cai


    3′-Phosphoadenosine-5′-phosphatase (PAPase) is required for the removal of toxic 3′-phosphoadenosine-5′-phosphate (PAP) produced during sulfur assimilation in various eukaryotic organisms. This enzyme is a well-known target of lithium and sodium toxicity and has been used for the production of salt-resistant transgenic plants. In addition, PAPase has also been proposed as a target in the treatment of manic-depressive patients. One gene, halA, which could encode a protein closely related to th...

  16. İki Farklı Spirulina platensis Suşunun Büyüme Özelliklerinin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Cenker Kılıç


    Full Text Available Mikroalgal biyoteknoloji kapsamında sıklıkla kullanılan türlerden Spirulina platensis’in üretimi son yıllarda ülkemizde de başarıyla gerçekleştirilmektedir. Bu çalışmada, düz ve spiral formda olan iki farklı Spirulina suşunun büyüme karakteristikleri incelendi. Ayrıca, klorofil ve kuru ağırlık ölçümlerinde pratiklik sağlayacak spektrofotometrik ölçümler çalışıldı. Deneme süresince, hücre sayıları haricinde tüm parametrelerin birbirine benzerlik gösterdiği saptandı. Denemenin başında spiral/düz form oranı 2.43 iken bu oran deneme sonunda 5.53’e yükseldi. Spektrofotometrik ölçümler, kültürlerde büyümenin izlenmesinde pratiklik sağlaması bakımından önemlidir. Bu kapsamda, 680 nm’de ölçülen absorbans değeri ile kuru ağırlık ve klorofil a miktarları arasında önemli bir ilişki olduğu saptandı (p

  17. Dry deposition of gaseous oxidized mercury in Western Maryland. (United States)

    Castro, Mark S; Moore, Chris; Sherwell, John; Brooks, Steve B


    The purpose of this study was to directly measure the dry deposition of gaseous oxidized mercury (GOM) in western Maryland. Annual estimates were made using passive ion-exchange surrogate surfaces and a resistance model. Surrogate surfaces were deployed for seventeen weekly sampling periods between September 2009 and October 2010. Dry deposition rates from surrogate surfaces ranged from 80 to 1512 pgm(-2)h(-1). GOM dry deposition rates were strongly correlated (r(2)=0.75) with the weekly average atmospheric GOM concentrations, which ranged from 2.3 to 34.1 pgm(-3). Dry deposition of GOM could be predicted from the ambient air concentrations of GOM using this equation: GOM dry deposition (pgm(-2)h(-1))=43.2 × GOM concentration-80.3. Dry deposition velocities computed using GOM concentrations and surrogate surface GOM dry deposition rates, ranged from 0.2 to 1.7 cms(-1). Modeled dry deposition rates were highly correlated (r(2)=0.80) with surrogate surface dry deposition rates. Using the overall weekly average surrogate surface dry deposition rate (369 ± 340 pg m(-2)h(-1)), we estimated an annual GOM dry deposition rate of 3.2 μg m(-2)year(-1). Using the resistance model, we estimated an annual GOM dry deposition rate of 3.5 μg m(-2)year(-1). Our annual GOM dry deposition rates were similar to the dry deposition (3.3 μg m(-2)h(-1)) of gaseous elemental mercury (GEM) at our site. In addition, annual GOM dry deposition was approximately 1/2 of the average annual wet deposition of total mercury (7.7 ± 1.9 μg m(-2)year(-1)) at our site. Total annual mercury deposition from dry deposition of GOM and GEM and wet deposition was approximately 14.4 μg m(-2)year(-1), which was similar to the average annual litterfall deposition (15 ± 2.1 μg m(-2)year(-1)) of mercury, which was also measured at our site. Copyright © 2012 Elsevier B.V. All rights reserved.

  18. Uncertainties of Gaseous Oxidized Mercury Measurements Using KCl-Coated Denuders, Cation-Exchange Membranes, and Nylon Membranes: Humidity Influences. (United States)

    Huang, Jiaoyan; Gustin, Mae Sexauer


    Quantifying the concentration of gaseous oxidized mercury (GOM) and identifying the chemical compounds in the atmosphere are important for developing accurate local, regional, and global biogeochemical cycles. The major hypothesis driving this work was that relative humidity affects collection of GOM on KCl-coated denuders and nylon membranes, both currently being applied to measure GOM. Using a laboratory manifold system and ambient air, GOM capture efficiency on 3 different collection surfaces, including KCl-coated denuders, nylon membranes, and cation-exchange membranes, was investigated at relative humidity ranging from 25 to 75%. Recovery of permeated HgBr2 on KCl-coated denuders declined by 4-60% during spikes of relative humidity (25 to 75%). When spikes were turned off GOM recoveries returned to 60 ± 19% of permeated levels. In some cases, KCl-coated denuders were gradually passivated over time after additional humidity was applied. In this study, GOM recovery on nylon membranes decreased with high humidity and ozone concentrations. However, additional humidity enhanced GOM recovery on cation-exchange membranes. In addition, reduction and oxidation of elemental mercury during experiments was observed. The findings in this study can help to explain field observations in previous studies.

  19. Toward a quantitative and empirical dissolved organic carbon budget for the Gulf of Maine, a semienclosed shelf sea (United States)

    Balch, William; Huntington, Thomas; Aiken, George; Drapeau, David; Bowler, Bruce; Lubelczyk, Laura; Butler, Kenna


    A time series of organic carbon export from Gulf of Maine (GoM) watersheds was compared to a time series of biological, chemical, bio-optical, and hydrographic properties, measured across the GoM between Yarmouth, NS, Canada, and Portland, ME, U.S. Optical proxies were used to quantify the dissolved organic carbon (DOC) and particulate organic carbon in the GoM. The Load Estimator regression model applied to river discharge data demonstrated that riverine DOC export (and its decadal variance) has increased over the last 80 years. Several extraordinarily wet years (2006-2010) resulted in a massive pulse of chromophoric dissolved organic matter (CDOM; proxy for DOC) into the western GoM along with unidentified optically scattering material (DOC in the GoM and Scotian Shelf showed the strong influence of the Gulf of Saint Lawrence on the DOC that enters the GoM. A deep plume of CDOM-rich water was observed near the coast of Maine which decreased in concentration eastward. The Forel-Ule color scale was derived and compared to the same measurements made in 1912-1913 by Henry Bigelow. Results show that the GoM has yellowed in the last century, particularly in the region of the extension of the Eastern Maine Coastal Current. Time lags between DOC discharge and its appearance in the GoM increased with distance from the river mouths. Algae were also a significant source of DOC but not CDOM. Gulf-wide algal primary production has decreased. Increases in precipitation and DOC discharge to the GoM are predicted over the next century.

  20. Mercury Speciation at a Coastal Site in the Northern Gulf of Mexico: Results from the Grand Bay Intensive Studies in Summer 2010 and Spring 2011

    Directory of Open Access Journals (Sweden)

    Xinrong Ren


    Full Text Available During two intensive studies in summer 2010 and spring 2011, measurements of mercury species including gaseous elemental mercury (GEM, gaseous oxidized mercury (GOM, and particulate-bound mercury (PBM, trace chemical species including O3, SO2, CO, NO, NOY, and black carbon, and meteorological parameters were made at an Atmospheric Mercury Network (AMNet site at the Grand Bay National Estuarine Research Reserve (NERR in Moss Point, Mississippi. Surface measurements indicate that the mean mercury concentrations were 1.42 ± 0.12 ng∙m−3 for GEM, 5.4 ± 10.2 pg∙m−3 for GOM, and 3.1 ± 1.9 pg∙m−3 for PBM during the summer 2010 intensive and 1.53 ± 0.11 ng∙m−3 for GEM, 5.3 ± 10.2 pg∙m−3 for GOM, and 5.7 ± 6.2 pg∙m−3 for PBM during the spring 2011 intensive. Elevated daytime GOM levels (>20 pg∙m−3 were observed on a few days in each study and were usually associated with either elevated O3 (>50 ppbv, BrO, and solar radiation or elevated SO2 (>a few ppbv but lower O3 (~20–40 ppbv. This behavior suggests two potential sources of GOM: photochemical oxidation of GEM and direct emissions of GOM from nearby local sources. Lack of correlation between GOM and Beryllium-7 (7Be suggests little influence on surface GOM from downward mixing of GOM from the upper troposphere. These data were analyzed using the HYSPLIT back trajectory model and principal component analysis in order to develop source-receptor relationships for mercury species in this coastal environment. Trajectory frequency analysis shows that high GOM events were generally associated with high frequencies of the trajectories passing through the areas with high mercury emissions, while low GOM levels were largely associated the trajectories passing through relatively clean areas. Principal component analysis also reveals two main factors: direct emission and photochemical processes that were clustered with high GOM and PBM. This study indicates that the receptor site

  1. Gulf of Mexico development

    International Nuclear Information System (INIS)

    Krenz, D.


    In recent years, the Gulf of Mexico (GOM) has seen significant deepwater growth. An overview of the GOM deepwater leaseholds by Shell and developments by competing companies is presented. Deepwater GOM developments, total production from the shelf and from deepwater wells, new offshore pipeline capacity and ownership, and processing plant capacity are also discussed. Significant deepwater growth in the Gulf is anticipated. Despite significant economic and technological challenges, the area is judged to be the prime exploration and production opportunity in the lower 48 states of the USA. tabs., figs

  2. Use of criteria pollutants, active and passive mercury sampling, and receptor modeling to understand the chemical forms of gaseous oxidized mercury in Florida (United States)

    Huang, J.; Miller, M. B.; Edgerton, E.; Gustin, M. S.


    The highest mercury (Hg) wet deposition in the United States (US) occurs along the Gulf of Mexico, and in the southern and central Mississippi River Valley. Gaseous oxidized Hg (GOM) is thought to be a major contributor due to its high water solubility and reactivity. Therefore, it is critical to understand the concentrations, potential for wet and dry deposition, and GOM compounds present in the air. Concentrations and dry deposition fluxes of GOM were measured at Outlying Landing Field (OLF), Florida, using a Tekran® 2537/1130/1135, and active and passive samplers using cation-exchange and nylon membranes. Relationships with Tekran® derived data must be interpreted with caution, since GOM concentrations can be biased low depending on the chemical compounds in air, and interferences with water vapor and ozone. Only gaseous elemental Hg and GOM are discussed here since the PBM measurement uncertainties are higher. Criteria air pollutants were concurrently measured and Tekran® data were assessed along with these using Principal Component Analysis to identify associations among air pollutants. Based on the diel pattern, high GOM concentrations at this site were associated with fossil fuel combustion and gas phase oxidation during the day, and gas phase oxidation and transport in the free troposphere. The ratio of GEM/CO at OLF (0.008 ng m-3 ppbv-1) was much higher than the numbers reported for the Western United States and central New York for domestic emissions or biomass burning (0.001 ng m-3 ppbv-1), which we suggest is indicative of a marine boundary layer source. Results from nylon membranes with thermal desorption analyses suggest five potential GOM compounds exist in this area, including HgBr2, HgO, Hg(NO3)2, HgSO4, and an unknown compound. This indicates that the site is influenced by different gaseous phase reactions and sources. A~high GOM event related to high CO but average SO2 suggests the air parcels moved from the free troposphere and across

  3. Chlorophyll concentration assays

    African Journals Online (AJOL)



    May 10, 2012 ... compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, ... Key words: Algae isolation, scanning electron microscope, ..... Antibacterial properties of extracts from selected planktonic fresh.

  4. Isolation and antibacterial activity of anabaena phycocyanin

    African Journals Online (AJOL)



    Apr 10, 2013 ... (Yoshida et al., 1996) due to their antioxidant and anti- inflammatory ... studies indicated that phycocyanin from spirulina have obvious curative effect on .... phycocyanin from spirulina platensis using expanded bed adsorption.

  5. 1750-IJBCS-Article-Henri Gautier

    African Journals Online (AJOL)



    Jan 2, 2012 ... Effects of spirulina supplementation on selected anthropometric, biochemical, and ... up periods will be necessary to test these assumptions. ... platensis), an edible microalgae, is naturally ..... biliprotein with antioxidant, anti- ...

  6. [Pb(NO3)2 and Pb(CH3COO)2] on growth, biomass and proline in ...

    African Journals Online (AJOL)



    Dec 14, 2011 ... Spirulina platensis growth parameters [chlorophyll a (chl a) and dry-wet weight] effects on proline ... between lead accumulation in the test algae and low pH which ... vitamins, antioxidants and immunositimulants for both.

  7. Research Article Special Issue

    African Journals Online (AJOL)


    Jun 15, 2016 ... rats were accidentally divided into the control, sham and test group ... cadmium chloride due to abundant antioxidant property. ..... Karadeniz A, Cemek M, Simsek N. The effects of Panax ginseng and Spirulina platensis on.

  8. Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

    African Journals Online (AJOL)



    Oct 11, 2012 ... capacity of each sample to scavenge the ABTS radical cation, we revealed that the EPS aqueous ... evaluated using the brine shrimp Artemia salina, as test organism. ..... released by cyanobacterium Arthrospira platensis.

  9. Protein (Cyanobacteria): 479131140 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available xylamine reductase Arthrospira platensis NIES-39 MFCEQCEQTASGQGCHQWGACGKGPDVNAVQDLL... YP_005071100.1 NC_016640 1117:23174 ... 1150:27534 1301283:45982 ... 35823:1467 118562:2804 696747:2804 ... hydro

  10. Impact of physico-chemical parameters on the physiological growth ...

    African Journals Online (AJOL)

    Impact of physico-chemical parameters on the physiological growth of Arthrospira (Spirulina platensis) exogenous strain UTEXLB2340. Yahia Mustafa A Fagiri, Aisha Salleh, Saifeldin Ahmed F El-Nagerabi ...

  11. African Journal of Biotechnology - Vol 13, No 14 (2014)

    African Journals Online (AJOL)

    Production of Spirulina platensis by adding sodium bicarbonate and urea into chicken manure medium · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Hilal Kargin Yilmaz, Ozlem Sezgin ...

  12. Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

    NARCIS (Netherlands)

    Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.


    We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

  13. Protein (Cyanobacteria): 479130489 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_005070449.1 NC_016640 1117:22154 ... 1150:29420 1301283:48078 ... 35823:3164 118562:2384 696747:2384 ... creat...ininase Arthrospira platensis NIES-39 MHNFIPPHRFFPYLTWTEIAEMPDRENTVIIQPIGAIEQHGPHLP

  14. La Familia Gomphotheriidae en América del Sur: evidencia de molares al norte de la Patagonia chilena

    Directory of Open Access Journals (Sweden)

    Recabarren, Omar P.


    Full Text Available We present statistical studies made with ten molars M3 and m3 of south-central Chile, we compared material of gomphotheres Stegomastodon platensis, Stegomastodon waringi and Cuvieronius hyodon of South America. Also we analyze three fragments defense of the Chilean sites of Monte Verde, Mulpulmo and Nochaco. In the statistical analysis it is clear that the molars are very variable in shape, also in size and have a great dispersion, however in bivariate diagrams the molars of Chile were grouped with the molars large (genus Stegomastodon. The discriminant analysis indicates that five m3 are associated with Stegomastodon platensis and two with Cuvieronius hyodon, two M3 are associated with Stegomastodon platensis and one with Stegomastodon waringi. We discuss the sympatric between species S. platensis and C. hyodon in southern Chile.Damos a conocer los estudios estadísticos hechos con diez molares M3 y m3 del centro-sur de Chile, comparados con material de gonfoterios Stegomastodon platensis, Stegomastodon waringi y Cuvieronius hyodon de América del Sur. Además se analizan tres fragmentos de defensa provenientes de los sitios chilenos de Monte Verde, Mulpulmo y Nochaco. En el análisis estadístico es claro que los molares son muy variables en forma, así como en tamaño y presentan una gran dispersión, sin embargo en los diagramas bivariantes la mayoría de los molares de Chile se agrupan con los molares de talla grande (del género Stegomastodon. Los análisis discriminantes indican que de los siete m3, cinco se asocian a Stegomastodon platensis y dos a Cuvieronius hyodon. De los tres M3, dos se asocian con la especie Stegomastodon platensis y uno con Stegomastodon waringi. Se discute la probable simpatría de las especies S. Platensis y C. hyodon en el sur de Chile.

  15. Evaluation of the Influence of Nitrogen and Phosphorus Nutrients in the Culture and Production ofbiosurfactants by MicroalgaSpirulina


    Lisiane Fernandes De Carvalho; Mariana Souza De Oliveira


    The aim of this study was to verify the influence of phosphorus and nitrogen nutrients in the culture and production of biosurfactants by Spirulina platensis LEB 52,Spirulina platensisParacas and Spirulina sp. LEB 18. For this, experiments were performed using Full Factorial Design 22 to evaluate the influence of phosphorus and nitrogen nutrients on the maximum biomass concentration and maximum productivity in the cultures, as well as in production biosurfactant by extracts...

  16. Epithermal neutron activation analysis in applied microbiology

    International Nuclear Information System (INIS)

    Marina Frontasyeva


    Some results from applying epithermal neutron activation analysis at FLNP JINR, Dubna, Russia, in medical biotechnology, environmental biotechnology and industrial biotechnology are reviewed. In the biomedical experiments biomass from the blue-green alga Spirulina platensis (S. platensis) has been used as a matrix for the development of pharmaceutical substances containing such essential trace elements as selenium, chromium and iodine. The feasibility of target-oriented introduction of these elements into S. platensis biocomplexes retaining its protein composition and natural beneficial properties was shown. The absorption of mercury on growth dynamics of S. platensis and other bacterial strains was observed. Detoxification of Cr and Hg by Arthrobacter globiformis 151B was demonstrated. Microbial synthesis of technologically important silver nanoparticles by the novel actinomycete strain Streptomyces glaucus 71 MD and blue-green alga S. platensis were characterized by a combined use of transmission electron microscopy, scanning electron microscopy and energy-dispersive analysis of X-rays. It was established that the tested actinomycete S. glaucus 71 MD produces silver nanoparticles extracellularly when acted upon by the silver nitrate solution, which offers a great advantage over an intracellular process of synthesis from the point of view of applications. The synthesis of silver nanoparticles by S. platensis proceeded differently under the short-term and long-term silver action. (author)

  17. Environmental contaminants in fillets of sea-run Atlantic salmon (Salmo salar) from the Gulf of Maine Distinct Population Segment (United States)

    Department of the Interior — Between 2008 and 2010, skin‐on fillets from seven dead adult sea‐run Atlantic salmon from the Gulf of Maine Distinct Population Segment (GOM DPS) were analyzed for...

  18. Educational game models: conceptualization and evaluation ...

    African Journals Online (AJOL)

    Educational game models: conceptualization and evaluation. ... The Game Object Model (GOM), that marries educational theory and game design, forms the basis for the development of the Persona Outlining ... AJOL African Journals Online.

  19. 4 km NODC/RSMAS AVHRR Pathfinder v5 Seasonal and Annual Day-Night Sea Surface Temperature Climatologies for 1982-2009 for the Gulf of Mexico (NODC Accession 0072888) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a set of sea surface temperature climatologies for the Gulf of Mexico (GOM), derived from the AVHRR Pathfinder Version 5 sea surface...

  20. Federal Mineral Lease Blocks Protractions from MMS source data, Geographic NAD83, LOSCO (2004) [offshore_blocks_protraction_MMS_2004 (United States)

    Louisiana Geographic Information Center — Federal lease blocks protractions for the Gulf of Mexico (GOM) Outer Continental Shelf (OCS) Region. Based on the OCS Marine Survey Group Official Protraction...

  1. Gaseous Oxidized Mercury Dry Deposition Measurements in Southwestern USA: Comparison between texas, Eastern Oklahoma, and the Four Corners Area (United States)

    Gaseous oxidized mercury (GOM) dry deposition measurements using aerodynamic surrogate surface passive samplers were collected in central and eastern Texas and eastern Oklahoma, from September 2011 to September 2012.The purpose of this study was to provide an initial characteriza...

  2. MMSReefish Study Databases from 1993-1999 field collections (SEC7-95-11 Fish Mortalities From Explosive Removal of Petroleum Platforms) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Impacts of the Explosive Removal of Offshore Oil and Gas Structureson Fish Stocks in the Gulf of MexicoOffshore oil and gas platforms in the Gulf of Mexico (GOM)...

  3. EPA GOMEX Wild Goose Lagoon 2006 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — We compared nekton use of prominent habitat types within a lagoonal system of the northeastern Gulf of Mexico (GoM). These habitat types were defined by combinations...

  4. 75 FR 64955 - Fisheries of the Northeastern United States; Northeast Multispecies Fishery; Correction to Cod... (United States)


    ... GOM cod. By an administrative error, the inseason action published on September 27, 2010, reduced the... effectiveness would further disadvantage vessels subject to the lower trip limits implemented on September 27...

  5. Speciated atmospheric mercury on haze and non-haze days in an inland city in China

    Directory of Open Access Journals (Sweden)

    Q. Hong


    Full Text Available Long-term continuous measurements of speciated atmospheric mercury were conducted from July 2013 to June 2014 in Hefei, a midlatitude inland city in eastern central China that experiences frequent haze pollution. The mean concentrations (±standard deviation of gaseous elemental mercury (GEM, gaseous oxidized mercury (GOM and particle-bound mercury (PBM were 3.95 ± 1.93 ng m−3, 2.49 ± 2.41 and 23.3 ± 90.8 pg m−3, respectively, on non-haze days, and 4.74 ± 1.62 ng m−3, 4.32 ± 8.36 and 60.2 ± 131.4 pg m−3, respectively, on haze days. Potential source contribution function (PSCF analysis suggested that atmospheric mercury pollution on haze days was caused primarily by local emissions, instead of via long-range transport. The poorer mixing conditions on haze days also favored the accumulation of atmospheric mercury. Compared to GEM and GOM, PBM was especially sensitive to haze pollution. The mean PBM concentration on haze days was 2.5 times that on non-haze days due to elevated concentrations of particulate matter. PBM also showed a clear seasonal trend; its concentration was the highest in fall and winter, decreased rapidly in spring and was the lowest in summer, following the same order in the frequency of haze days in different seasons. On both non-haze and haze days, GOM concentrations remained low at night, but increased rapidly just before sunrise, which could be due to diurnal variation in air exchange between the boundary layer and free troposphere. However, non-haze and haze days showed different trends in daytime GEM and GOM concentrations. On non-haze days, GEM and GOM declined synchronously through the afternoon, probably due to the retreat of the free tropospheric air as the height of the atmospheric boundary layer increases. In contrast, on haze days, GOM and GEM showed opposite trends with the highest GOM and lowest GEM observed in the afternoon, suggesting the occurrence of

  6. Producing Distribution Maps for a Spatially-Explicit Ecosystem Model Using Large Monitoring and Environmental Databases and a Combination of Interpolation and Extrapolation

    Directory of Open Access Journals (Sweden)

    Arnaud Grüss


    Full Text Available To be able to simulate spatial patterns of predator-prey interactions, many spatially-explicit ecosystem modeling platforms, including Atlantis, need to be provided with distribution maps defining the annual or seasonal spatial distributions of functional groups and life stages. We developed a methodology combining extrapolation and interpolation of the predictions made by statistical habitat models to produce distribution maps for the fish and invertebrates represented in the Atlantis model of the Gulf of Mexico (GOM Large Marine Ecosystem (LME (“Atlantis-GOM”. This methodology consists of: (1 compiling a large monitoring database, gathering all the fisheries-independent and fisheries-dependent data collected in the northern (U.S. GOM since 2000; (2 compiling a large environmental database, storing all the environmental parameters known to influence the spatial distribution patterns of fish and invertebrates of the GOM; (3 fitting binomial generalized additive models (GAMs to the large monitoring and environmental databases, and geostatistical binomial generalized linear mixed models (GLMMs to the large monitoring database; and (4 employing GAM predictions to infer spatial distributions in the southern GOM, and GLMM predictions to infer spatial distributions in the U.S. GOM. Thus, our methodology allows for reasonable extrapolation in the southern GOM based on a large amount of monitoring and environmental data, and for interpolation in the U.S. GOM accurately reflecting the probability of encountering fish and invertebrates in that region. We used an iterative cross-validation procedure to validate GAMs. When a GAM did not pass the validation test, we employed a GAM for a related functional group/life stage to generate distribution maps for the southern GOM. In addition, no geostatistical GLMMs were fit for the functional groups and life stages whose depth, longitudinal and latitudinal ranges within the U.S. GOM are not entirely covered by

  7. How do en route events around the Gulf of Mexico influence landbird populations (United States)

    Cohen, Emily B.; Barrow, Wylie C.; Buler, Jeffrey J.; Deppe, Jill L.; Farnsworth, Andrew; Marra, Peter P.; McWilliams, Scott R.; Mehlman, David W; Wilson, R. Randy; Woodrey, Mark S; Moore, Frank R.


    Habitats around the Gulf of Mexico (GOM) provide critical resources for Nearctic–Neotropical migratory landbirds, the majority of which travel across or around the GOM every spring and fall as they migrate between temperate breeding grounds in North America and tropical wintering grounds in the Caribbean and Central and South America. At the same time, ecosystems in the GOM are changing rapidly, with unknown consequences for migratory landbird populations, many of which are experiencing population declines. In general, the extent to which events encountered en route limit migratory bird populations is not well understood. At the same time, information from weather surveillance radar, stable isotopes, tracking, eBird, and genetic datasets is increasingly available to address many of the unanswered questions about bird populations that migrate through stopover and airspace habitats in the GOM. We review the state of the science and identify key research needs to understand the impacts of en route events around the GOM region on populations of intercontinental landbird migrants that breed in North America, including: (1) distribution, timing, and habitat associations; (2) habitat characteristics and quality; (3) migratory connectivity; and (4) threats to and current conservation status of airspace and stopover habitats. Finally, we also call for the development of unified and comprehensive long-term monitoring guidelines and international partnerships to advance our understanding of the role of habitats around the GOM in supporting migratory landbird populations moving between temperate breeding grounds and wintering grounds in Mexico, Central and South America, and the Caribbean.

  8. Toward a quantitative and empirical dissolved organic carbon budget for the Gulf of Maine, a semienclosed shelf sea (United States)

    Balch, William; Huntington, Thomas G.; Aiken, George R.; Drapeau, David; Bowler, Bruce; Lubelczyk, Laura; Butler, Kenna D.


    A time series of organic carbon export from Gulf of Maine (GoM) watersheds was compared to a time series of biological, chemical, bio-optical, and hydrographic properties, measured across the GoM between Yarmouth, NS, Canada, and Portland, ME, U.S. Optical proxies were used to quantify the dissolved organic carbon (DOC) and particulate organic carbon in the GoM. The Load Estimator regression model applied to river discharge data demonstrated that riverine DOC export (and its decadal variance) has increased over the last 80 years. Several extraordinarily wet years (2006–2010) resulted in a massive pulse of chromophoric dissolved organic matter (CDOM; proxy for DOC) into the western GoM along with unidentified optically scattering material (Time lags between DOC discharge and its appearance in the GoM increased with distance from the river mouths. Algae were also a significant source of DOC but not CDOM. Gulf-wide algal primary production has decreased. Increases in precipitation and DOC discharge to the GoM are predicted over the next century.

  9. Respons Imunoglobulin-G dan Imunoglobulin-M Mencit yang Diberi Ekstrak Methanol Alga Biru Hijau dan Diinfeksi Dengan Takizoit

    Directory of Open Access Journals (Sweden)

    Sorta Basar Ida Simanjuntak


    Full Text Available Toxoplasmosis is an infectious disease caused by Toxoplasma gondii. This disease could severelyaffect humans and animals. Up to now there has been no simple treatment to fight toxoplasmosis. Aprospective alternative treatment to overcome this problem is by increasing immunity of the body using animmunostimulant such as Spirulina platensis. The aims of this research were to observe the potency of S.platensis as an immunostimulant and to find the most potential fraction of S. Platensis that can increasethe responses of IgG and IgM antibodies againts toxoplasma. The responses of these antibodies weremeasured using ELISA method. The isolation of compounds from S. platensis using Preparative ThinLayer Chromatography (PTLC found three fractions which were a top fraction (I, a middle fraction (II,and a lower fraction (III. Forty-eight mice used in this research were divided into four different groupswith 12 mice in each group and treated differently. The top, middle, and lower fractions of S. platensis wereadministered orally to three groups of mice respectively at dose of 3mg/ml for each mouse while the micein the fourth group were kept as untreated controls. The treatment was conducted for 14 days consecutivelyand on the next day, all mice, including the controls, were challenged with tachizoit. The effect of S.platensisfractions on the responses of IgG and IgM antibodies were then measured at various time intervals, i.e. day0 (before infection and day 1, 2, and 3 after infection. The results showed that IgG response increased inthe day 0 (2.504 OD and the day 3 after infection (2.608 OD while IgM response increased in day 1 afterinfection (2.898 OD. In conclusion, S. platensis was an immunostimulant and the middle fraction (II of S.Platensis was the most potential fraction to increase immunity againts toxoplasma .

  10. Electrohydraulic drive system with planetary superposed PS 16 gears

    Energy Technology Data Exchange (ETDEWEB)

    Graetz, A.; Klimek, K.H.; Welz, H.


    During the nine-month period of use of the electrohydraulic drive system with PS 16 superposed planetary gear and hydrostatic support advance of 800 m was achieved on the 250 m long face in the Geitling 2 seam at the Niederberg colliery. No appreciable difficulties occurred in the hydraulic system and with the PS 16 superposed planetary gear in the entire period. Uniform load distribution between the two drives was proved until the end of the working even with a chain elongation difference up to 3% observed during the final phase of operation. In contrast to normal operation thermal disconnections and motor failures no longer occurred. After accurate adjustment of the pressures the system operated successfully. The time utilisation of the equipment was improved by 15% to 65.7%. The quick and reliable response of the hydraulics in the event of overloading ensured that no chain cracks occurred. The four connector fractures were attributable to fatigue failures. The material-protecting method of operation was proved by the quiet running of the chain and substantially longer operating time, e.g. of the chain and sprocket. To prove the efficiency of the new drive system, comprehensive measurements were undertaken. It emerged during these measurements that in contrast to the conventional drives the load equalisation ensures that the total installed power is available if required. However, the freeing capacity of the plough could not be fully utilised because of the missing conveyor cross-section.

  11. Agronomic Biofortification of Amaranthus dubius with Macro Nutrients and Vitamin A (United States)

    Mala, R.; Celsia, A. S. Ruby; Mahalakshmi, R.; Rajeswari, S.


    Agronomic biofortification of Amaranthus dubius with carbohydrates, proteins and Vitamin A using Spirulina platensis is reported in the present preliminary study. S. platensis was applied basally to field and its influence on germination, concentration of proteins, carbohydrates, chlorophyll, carotenoids and antioxidant activity of leaves were assessed in CO1 variety of A. dubius. Biofortification of the nutrients were evaluated on 5th and 20th day. Germination was optimum at 0.005 % of S. platensis as a fertilizer and the agronomic fortifying agent. Germination in control was 82 % and 95 % in 0.005 % of S. platensis fortification. The concentration of total chlorophyll in control and biofortified leaf on 20th day were 85.6 mg/g and 325 mg/g of dried leaf. The concentration of proteins was 71.93 mg/g and 450 mg/g on 20th day in control and fortified leaves. S. platensis applied field produced leaves fortified with 1.27 % of vitamin A aldehyde. Antioxidant activity of control leaf was 34.85 % and it was significantly increased in fortified leaves to 87 %. Thus the study confirms the fortification of leaf with proteins, carbohydrates and vitamin A.

  12. Demographic clusters identified within the northern Gulf of Mexico common bottlenose dolphin (Tursiops truncates unusual mortality event: January 2010-June 2013.

    Directory of Open Access Journals (Sweden)

    Stephanie Venn-Watson

    Full Text Available A multi-year unusual mortality event (UME involving primarily common bottlenose dolphins (Tursiops truncates was declared in the northern Gulf of Mexico (GoM with an initial start date of February 2010 and remains ongoing as of August 2014. To examine potential changing characteristics of the UME over time, we compared the number and demographics of dolphin strandings from January 2010 through June 2013 across the entire GoM as well as against baseline (1990-2009 GoM stranding patterns. Years 2010 and 2011 had the highest annual number of stranded dolphins since Louisiana's record began, and 2011 was one of the years with the highest strandings for both Mississippi and Alabama. Statewide, annual numbers of stranded dolphins were not elevated for GoM coasts of Florida or Texas during the UME period. Demographic, spatial, and temporal clusters identified within this UME included increased strandings in northern coastal Louisiana and Mississippi (March-May 2010; Barataria Bay, Louisiana (August 2010-December 2011; Mississippi and Alabama (2011, including a high prevalence and number of stranded perinates; and multiple GoM states during early 2013. While the causes of the GoM UME have not been determined, the location and magnitude of dolphin strandings during and the year following the 2010 Deepwater Horizon oil spill, including the Barataria Bay cluster from August 2010 to December 2011, overlap in time and space with locations that received heavy and prolonged oiling. There are, however, multiple known causes of previous GoM dolphin UMEs, including brevetoxicosis and dolphin morbillivirus. Additionally, increased dolphin strandings occurred in northern Louisiana and Mississippi before the Deepwater Horizon oil spill. Identification of spatial, temporal, and demographic clusters within the UME suggest that this mortality event may involve different contributing factors varying by location, time, and bottlenose dolphin populations that will be

  13. Estudio de la Microestructura y de las propiedades reológicas de geles de concentrado proteico de sabalo (prochilodus platensis en relación a la etapa de lavado con soluciones de H3PO4 y NaHCO

    Directory of Open Access Journals (Sweden)

    María Agustina Reinheimer


    Full Text Available El concentrado de proteínas de pescado (CPP es el músculo del pescado desmenuzado y exento de huesos, piel,carne oscura y de espinas, que es lavado varias veces con agua y escurrido hasta la proporción de agua original.Aquí se estudió el efecto en la composición físico-química, sobre la microestructura y las propiedades reológicas degeles de CPP utilizando diferentes soluciones de agua de lavado en la obtención de CPP de sábalo (Prochilodusplatensis. Al mismo tiempo se evaluó la extracción de proteínas durante el lavado, y el análisis de las propiedadesreológicas de los geles obtenidos. Los geles de CPP de sábalo obtenidos mediante el método de lavado (0.05%H3PO4, 0.2% NaHCO3 y 0.2% NaCl presentaron un contenido aceptable de proteínas, el menor contenido demateria grasa, y la textura más aceptable, confirmada por la reología y la microestructura, mostrando mejorasrespecto de los obtenidos por el método convencional.

  14. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensisTumor necrosis factor-alpha binding capacity and anti-infliximab antibodies measured by fluid-phase radioimmunoassays as predictors

    DEFF Research Database (Denmark)

    Lobner, M.; Walsted, A.; Larsen, R.


    tumor necrosis factor (TNF)-alpha, interleukin (IL)-2, and interferon (IFN)-gamma was increased after Immunlina...... administration for 3 days (P alpha, IFN-gamma, and IL-6 responses to TT were enhanced after 8 and 14 days (P ...) and fell below baseline levels after 14 days (P alpha...

  15. Del hecho al dicho hay un poético trecho.Prolegómenos para una investigación social literaria(The poetics of the gap between facts and writings. Preambles for literary social research(Du fait au dire il y a un écart poétique. Prolégomènes pour une recherche sociale littéraire(Do fato ao dito há um poético trecho. Prolegômenos para uma investigação social literária

    Directory of Open Access Journals (Sweden)

    Jairo Hernando Gómez-Esteban


    Full Text Available ResumenEste artículo constituye uno de los núcleos teóricos y metodo- lógicos de mi tesis doctoral Testigos de sí mismos: narrativas políticas de jóvenes bogotanos. En él se proporcionan los argumentos teóricos y epistemológicos para transitar de una escritura teórica a una escritura literaria como estrate- gia para acceder a los pliegues más ocultos de la subjetividad tanto del investigador como de los informantes y, sobre todo, para desvanecer las fronteras de dos tipos de escritura (o, si se quiere, de dos géneros discursivos: el científico y el literario. El texto está dividido en cinco partes. En la primera se discute la relación entre metáfora y concepto; en la segunda, el lugar que ocupan la autobiografía y el testimonio en esta discusión; en la tercera, se debate el agotamiento de las categorías socia- les y el papel que eventualmente juega aquí la escritura literaria; en la cuarta se describen y establecen las limitaciones del pa- pel de la antropología poética chilena como precursora de este planteamiento; y finalmente, se discuten las implicacio- nes metodológicas de la propuesta.AbstractThis paper contains one of the theoretical and methodological cores of the author's disserta- tion: Witnesses of themselves: political narratives of young people in Bogotá, providing theoretical and epistemological arguments for the transition of theoretical writing to literary writing as a stra- tegy to explore the hidden aspects of subjectivity of both scholars and informers, and to erase the borders between two types of writing (or discourse genres: scientific and literary. The text is organized in five parts. First, the relation between metaphor and concept is discussed; second, the place of the autobiography and the testimonial in this discus- sion; third, the exhaustion of social categories and the possible role of literary writing; fourth, the limi- tations of the Chilean Poetical Anthropology as a pioneer tendency; and finally, the methodological implications of the proposal.RésuméCet article constitue un de focus théoriques et mé- thodologiques de la thèse doctorale de l'auteur: Témoins d'eux-mêmes: narratives politiques de jeunes de Bogota. L'article nous donne les argu- ments théoriques et épistémologiques pour transi- ter d'une écriture théorique à une écriture littéraire en tant qu'une stratégie pour accéder aux plis les plus cachés de la subjectivité tantôt du chercheur que de ses témoins et, surtout, pour effacer les frontières de deux types d'écriture (ou, si l'on veut, de deux genres discursives: le scientifique et le lit- téraire. Le texte a été divisé en cinq parties. Dans la première partie, on discute le rapport entre la méta- phore et le concept; dans la deuxième le lieu qui oc- cupent l'autobiographie et le témoignage dans ce débat; dans la troisième, on débat sur l'achèvement des catégories sociales et le rôle qui y joue l'écriture littéraire; dans la quatrième on décrit et on établit les limitations du rôle de l'Anthropologie Poétique au Chili en tant que pays précurseur de ce type de rapport; et finalement, on discute les implications méthodologiques du rapport.ResumoEste artigo constitui um dos núcleos teóricos e me- todológicos da tese doutoral do autor: Testemun- has de si mesmos: Narrativas políticas de jovens bogotanos. Nele são propostos os argumentos teóricos e epistemológicos para transitar de uma escrita teórica a uma escrita literária como estra- tégia para se chegar aos espaços mais ocultos da subjetividade tanto do pesquisador como dos in- formantes e, sobretudo, para dissipar as fronteiras de dois tipos de escrita (ou, se se quer, de dois gê- neros discursivos: a científica e a literária. O texto está dividido em cinco partes. Na primeira se discu- te a relação entre metáfora e conceito; na segunda, o lugar que ocupam nesta discussão a autobiografia e o depoimento; na terceira, debate-se o esgota- mento das categorias sociais e o papel que even- tualmente tem aqui a escritura literária; na quarta se descrevem e se estabelecem as limitações do papel da Antropologia Poética Chilena como pre- cursora desta proposta; e finalmente, discutem-se as implicações metodológicas da proposta.

  16. Evaluation of glass leaching as nutrient source for microalgae growth; Evaluacion del comportamiento de vidrios lixiviados como nutrientes de algas

    Energy Technology Data Exchange (ETDEWEB)

    Grabska, N.; Tamayo, A.; Mazo, M. A.; Pascual, L.; Rubio, J.


    Three glasses with an elemental composition similar to the nutrient ratio required for Spirulina platensis growth and with different SiO{sub 2} content have been prepared. The glasses were crushed and sieved into 2 different fractions and the effect of the particle size has been studied in terms of the leaching kinetics of each element. The chemical analysis of the leaching water was used for obtaining the dissolution rate curves for each element taking part of the glass composition. From the calculation of the leaching rate constant and the exponential constant of the lixiviation reaction, it has been evaluated the Spirulina platensis growth in ambient normal conditions of light, temperature and pH of the growing media. It has been concluded that, either from the modification of the chemical composition of the glass or its particle size, it is possible to tune the delivery of the nutrients to match the growth rate of Spirulina platensis. (Author)

  17. Evaluation of glass leaching as nutrient source for microalgae growth

    International Nuclear Information System (INIS)

    Grabska, N.; Tamayo, A.; Mazo, M. A.; Pascual, L.; Rubio, J.


    Three glasses with an elemental composition similar to the nutrient ratio required for Spirulina platensis growth and with different SiO 2 content have been prepared. The glasses were crushed and sieved into 2 different fractions and the effect of the particle size has been studied in terms of the leaching kinetics of each element. The chemical analysis of the leaching water was used for obtaining the dissolution rate curves for each element taking part of the glass composition. From the calculation of the leaching rate constant and the exponential constant of the lixiviation reaction, it has been evaluated the Spirulina platensis growth in ambient normal conditions of light, temperature and pH of the growing media. It has been concluded that, either from the modification of the chemical composition of the glass or its particle size, it is possible to tune the delivery of the nutrients to match the growth rate of Spirulina platensis. (Author)

  18. Millennial- to century-scale variability in Gulf of Mexico Holocene climate records (United States)

    Poore, R.Z.; Dowsett, H.J.; Verardo, S.; Quinn, T.M.


    Proxy records from two piston cores in the Gulf of Mexico (GOM) provide a detailed (50-100 year resolution) record of climate variability over the last 14,000 years. Long-term (millennial-scale) trends and changes are related to the transition from glacial to interglacial conditions and movement of the average position of the Intertropical Convergence Zone (ITCZ) related to orbital forcing. The ??18O of the surface-dwelling planktic foraminifer Globigerinoides ruber show negative excursions between 14 and 10.2 ka (radiocarbon years) that reflect influx of meltwater into the western GOM during melting of the Laurentide Ice Sheet. The relative abundance of the planktic foraminifer Globigerinoides sacculifer is related to transport of Caribbean water into the GOM. Maximum transport of Caribbean surface waters and moisture into the GOM associated with a northward migration of the average position of the ITCZ occurs between about 6.5 and 4.5 ka. In addition, abundance variations of G. sacculifer show century-scale variability throughout most of the Holocene. The GOM record is consistent with records from other areas, suggesting that century-scale variability is a pervasive feature of Holocene climate. The frequency of several cycles in the climate records is similar to cycles identified in proxy records of solar variability, indicating that at least some of the century-scale climate variability during the Holocene is due to external (solar) forcing.

  19. Species boundaries of Gulf of Mexico vestimentiferans (Polychaeta, Siboglinidae) inferred from mitochondrial genes (United States)

    Pia Miglietta, Maria; Hourdez, Stephane; Cowart, Dominique A.; Schaeffer, Stephen W.; Fisher, Charles


    At least six morphospecies of vestimentiferan tubeworms are associated with cold seeps in the Gulf of Mexico (GOM). The physiology and ecology of the two best-studied species from depths above 1000 m in the upper Louisiana slope (Lamellibrachia luymesi and Seepiophila jonesi) are relatively well understood. The biology of one rare species from the upper slope (escarpiid sp. nov.) and three morphospecies found at greater depths in the GOM (Lamellibrachia sp. 1, L. sp. 2, and Escarpia laminata) are not as well understood. Here we address species distributions and boundaries of cold-seep tubeworms using phylogenetic hypotheses based on two mitochondrial genes. Fragments of the mitochondrial large ribosomal subunit rDNA (16S) and cytochrome oxidase subunit I (COI) genes were sequenced for 167 vestimentiferans collected from the GOM and analyzed in the context of other seep vestimentiferans for which sequence data were available. The analysis supported five monophyletic clades of vestimentiferans in the GOM. Intra-clade variation in both genes was very low, and there was no apparent correlation between the within-clade diversity and collection depth or location. Two of the morphospecies of Lamellibrachia from different depths in the GOM could not be distinguished by either mitochondrial gene. Similarly, E. laminata could not be distinguished from other described species of Escarpia from either the west coast of Africa or the eastern Pacific using COI. We suggest that the mitochondrial COI and 16S genes have little utility as barcoding markers for seep vestimentiferan tubeworms.

  20. Observation and analysis of speciated atmospheric mercury in Shangri-La, Tibetan Plateau, China (United States)

    Zhang, H.; Fu, X. W.; Lin, C.-J.; Wang, X.; Feng, X. B.


    This study reports the concentrations and potential sources of speciated atmospheric mercury at the Shangri-La Atmosphere Watch Regional Station (SAWRS), a pristine high-altitude site (3580 m a.s.l.) in Tibetan Plateau, China. Total gaseous mercury (TGM, defined as the sum of gaseous elemental mercury, GEM, and gaseous oxidized mercury, GOM), GOM and particulate-bound mercury (PBM) were monitored from November 2009 to November 2010 to investigate the characteristics and potential influence of the Indian summer monsoon (ISM) and the Westerlies on atmospheric transport of mercury. The mean concentrations (± standard deviation) of TGM, PBM and GOM were 2.55 ± 0.73 ng m-3, 38.82 ± 31.26 pg m-3 and 8.22 ± 7.90 pg m-3, respectively. A notable seasonal pattern of TGM concentrations was observed with higher concentrations at the beginning and the end of the ISM season. High TGM concentrations (> 2.5 ng m-3) were associated with the transport of dry air that carried regional anthropogenic emissions from both Chinese domestic and foreign (e.g., Myanmar, Bay of Bengal, and northern India) sources based on analysis of HYSPLIT4 back trajectories. Somewhat lower PBM and GOM levels during the ISM period were attributed to the enhanced wet scavenging. The high GOM and PBM were likely caused by local photo-chemical transformation under low RH and the domestic biofuel burning in cold seasons.

  1. Graphene oxide membrane as an efficient extraction and ionization substrate for spray-mass spectrometric analysis of malachite green and its metabolite in fish samples. (United States)

    Wei, Shih-Chun; Fan, Shen; Lien, Chia-Wen; Unnikrishnan, Binesh; Wang, Yi-Sheng; Chu, Han-Wei; Huang, Chih-Ching; Hsu, Pang-Hung; Chang, Huan-Tsung


    A graphene oxide (GO) nanosheet-modified N + -nylon membrane (GOM) has been prepared and used as an extraction and spray-ionization substrate for robust mass spectrometric detection of malachite green (MG), a highly toxic disinfectant in liquid samples and fish meat. The GOM is prepared by self-deposition of GO thin film onto an N + -nylon membrane, which has been used for efficient extraction of MG in aquaculture water samples or homogenized fish meat samples. Having a dissociation constant of 2.17 × 10 -9  M -1 , the GOM allows extraction of approximately 98% of 100 nM MG. Coupling of the GOM-spray with an ion-trap mass spectrometer allows quantitation of MG in aquaculture freshwater and seawater samples down to nanomolar levels. Furthermore, the system possesses high selectivity and sensitivity for the quantitation of MG and its metabolite (leucomalachite green) in fish meat samples. With easy extraction and efficient spray ionization properties of GOM, this membrane spray-mass spectrometry technique is relatively simple and fast in comparison to the traditional LC-MS/MS methods for the quantitation of MG and its metabolite in aquaculture products. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. The areal extent of brown shrimp habitat suitability in Mobile Bay, Alabama, USA: Targeting vegetated habitat restoration (United States)

    Smith, L.M.; Nestlerode, J.A.; Harwell, L.C.; Bourgeois, P.


    The availability of wetlands and shallow water habitats significantly influences Gulf of Mexico (GOM) penaeid shrimp fishery productivity. However, the GOM region has the highest rate of wetland loss in the USA. Protection and management of these vital GOM habitats are critical to sustainable shrimp fisheries. Brown shrimp (Farfantepenaeus aztecus) are a major component of GOM fisheries. We present an approach for estimating the areal extent of suitable habitat for post-larval and juvenile brown shrimp in Mobile Bay, Alabama, using an existing habitat suitability index model for the northern GOM calculated from probabilistic survey of water quality and sediment data, land cover data, and submerged aquatic vegetation coverages. This estuarine scale approach is intended to support targeted protection and restoration of these habitats. These analyses indicate that approximately 60% of the area of Mobile Bay is categorized as suitable to near optimal for post-larval and juvenile shrimp and 38% of the area is marginally to minimally suitable. We identify potential units within Mobile Bay for targeted restoration to improve habitat suitability. ?? 2010 Springer Science+Business Media B.V.

  3. Trophic ecology of Atlantic Bluefin Tuna (Thunnus thynnus [corrected] larvae from the Gulf of Mexico and NW Mediterranean spawning grounds: A Comparative Stable Isotope Study.

    Directory of Open Access Journals (Sweden)

    Raúl Laiz-Carrión

    Full Text Available The present study uses stable isotopes of nitrogen and carbon (δ15Nandδ13C as trophic indicators for Atlantic bluefin tuna larvae (BFT (6-10 mm standard length in the highly contrasting environmental conditions of the Gulf of Mexico (GOM and the Balearic Sea (MED. These regions are differentiated by their temperature regime and relative productivity, with the GOM being significantly warmer and more productive. MED BFT larvae showed the highest δ15N signatures, implying an elevated trophic position above the underlying microzooplankton baseline. Ontogenetic dietary shifts were observed in the BFT larvae from the GOM and MED which indicates early life trophodynamics differences between these spawning habitats. Significant trophic differences between the GOM and MED larvae were observed in relation to δ15N signatures in favour of the MED larvae, which may have important implications in their growth during their early life stages.These low δ15N levels in the zooplankton from the GOM may be an indication of a shifting isotopic baseline in pelagic food webs due to diatrophic inputs by cyanobacteria. Lack of enrichment for δ15N in BFT larvae compared to zooplankton implies an alternative grazing pathway from the traditional food chain of phytoplankton-zooplankton-larval fish. Results provide insight for a comparative characterization of the trophic pathways variability of the two main spawning grounds for BFT larvae.

  4. Modifying Geometric-Optical Bidirectional Reflectance Model for Direct Inversion of Forest Canopy Leaf Area Index

    Directory of Open Access Journals (Sweden)

    Congrong Li


    Full Text Available Forest canopy leaf area index (LAI inversion based on remote sensing data is an important method to obtain LAI. Currently, the most widely-used model to achieve forest canopy structure parameters is the Li-Strahler geometric-optical bidirectional reflectance model, by considering the effect of crown shape and mutual shadowing, which is referred to as the GOMS model. However, it is difficult to retrieve LAI through the GOMS model directly because LAI is not a fundamental parameter of the model. In this study, a gap probability model was used to obtain the relationship between the canopy structure parameter nR2 and LAI. Thus, LAI was introduced into the GOMS model as an independent variable by replacing nR2 The modified GOMS (MGOMS model was validated by application to Dayekou in the Heihe River Basin of China. The LAI retrieved using the MGOMS model with optical multi-angle remote sensing data, high spatial resolution images and field-measured data was in good agreement with the field-measured LAI, with an R-square (R2 of 0.64, and an RMSE of 0.67. The results demonstrate that the MGOMS model obtained by replacing the canopy structure parameter nR2 of the GOMS model with LAI can be used to invert LAI directly and precisely.

  5. Algal autolysate medium to label proteins for NMR in mammalian cells. (United States)

    Fuccio, Carmelo; Luchinat, Enrico; Barbieri, Letizia; Neri, Sara; Fragai, Marco


    In-cell NMR provides structural and functional information on proteins directly inside living cells. At present, the high costs of the labeled media for mammalian cells represent a limiting factor for the development of this methodology. Here we report a protocol to prepare a homemade growth medium from Spirulina platensis autolysate, suitable to express uniformly labeled proteins inside mammalian cells at a reduced cost-per-sample. The human proteins SOD1 and Mia40 were overexpressed in human cells grown in (15)N-enriched S. platensis algal-derived medium, and high quality in-cell NMR spectra were obtained.

  6. Process for sewage biological treatment from uranium

    International Nuclear Information System (INIS)

    Popa, K.; Cecal, A.; Craciun, I.


    The invention relates to the sewage treatment, in particular to the sewage biological treatmen from radioactive waste, namely from uranium. The process dor sewage biological treatment from uranium includes cultivation in the sewage of the aquatic plants Lemna minor and Spirulina platensis. The plants cultivation is carried out in two stages. In the first stage for cultivation is used Lemna minor in the second stage - Spirulina platensis . After finishing the plant cultivation it is carried out separation of their biomass. The result of the invention consists in increasing the uranyl ions by the biomass of plants cultivated in the sewage

  7. Process for sewage biological treatment from uranium

    International Nuclear Information System (INIS)

    Popa, Karin; Cecal, Alexandru; Craciun, Iftimie Ionel; Rudic, Valeriu; Gulea, Aurelian; Cepoi, Liliana


    The invention relates to the sewage treatment, in particular to the sewage biological treatment from radioactive waste, namely from uranium. The process for sewage biological treatment from uranium includes cultivation in the sewage of the aquatic plants Lemna minor and Spirulina platensis. The plant cultivation is carried out in two stages. In the first stage for cultivation is used Lemna minor and in the second stage - Spirulina platensis. After finishing the plant cultivation it is carried out separation of their biomass. The result of the invention consists in increasing the uranyl ions accumulation by the biomass of plants cultivated in the sewage.

  8. Algal autolysate medium to label proteins for NMR in mammalian cells

    Energy Technology Data Exchange (ETDEWEB)

    Fuccio, Carmelo; Luchinat, Enrico; Barbieri, Letizia [University of Florence, Magnetic Resonance Center (CERM) (Italy); Neri, Sara [Giotto Biotech S.R.L. (Italy); Fragai, Marco, E-mail: [University of Florence, Magnetic Resonance Center (CERM) (Italy)


    In-cell NMR provides structural and functional information on proteins directly inside living cells. At present, the high costs of the labeled media for mammalian cells represent a limiting factor for the development of this methodology. Here we report a protocol to prepare a homemade growth medium from Spirulina platensis autolysate, suitable to express uniformly labeled proteins inside mammalian cells at a reduced cost-per-sample. The human proteins SOD1 and Mia40 were overexpressed in human cells grown in {sup 15}N-enriched S. platensis algal-derived medium, and high quality in-cell NMR spectra were obtained.

  9. The Post-polyketide Synthase Steps in iso-Migrastatin Biosynthesis Featuring Tailoring Enzymes with Broad Substrate Specificity (United States)

    Ma, Ming; Kwong, Thomas; Lim, Si-Kyu; Ju, Jianhua; Lohman, Jeremy R.; Shen, Ben


    The iso-migrastatin (iso-MGS) biosynthetic gene cluster from Streptomyces platensis NRRL 18993 consists of 11 genes, featuring an acyltransferase (AT)-less type I polyketide synthase (PKS) and three tailoring enzymes MgsIJK. Systematic inactivation of mgsIJK in S. platensis enabled us to (i) identify two nascent products (10 and 13) of the iso-MGS AT-less type I PKS, establishing an unprecedented novel feature for AT-less type I PKSs, and (ii) account for the formation of all known post-PKS biosynthetic intermediates (10-17) generated by the three tailoring enzymes MgsIJK, which possessed significant substrate promiscuities. PMID:23394593

  10. Estimating the basilar-membrane input-output function in normal-hearing and hearing-impaired listeners

    DEFF Research Database (Denmark)

    Jepsen, Morten Løve; Dau, Torsten

    To partly characterize the function of cochlear processing in humans, the basilar membrane (BM) input-output function can be estimated. In recent studies, forward masking has been used to estimate BM compression. If an on-frequency masker is processed compressively, while an off-frequency masker...... is transformed more linearly, the ratio between the slopes of growth of masking (GOM) functions provides an estimate of BM compression at the signal frequency. In this study, this paradigm is extended to also estimate the knee-point of the I/O-function between linear rocessing at low levels and compressive...... processing at medium levels. If a signal can be masked by a low-level on-frequency masker such that signal and masker fall in the linear region of the I/O-function, then a steeper GOM function is expected. The knee-point can then be estimated in the input level region where the GOM changes significantly...

  11. Deepwater Gulf of Mexico more profitable than previously thought

    International Nuclear Information System (INIS)

    Craig, M.J.K.; Hyde, S.T.


    Economic evaluations and recent experience show that the deepwater Gulf of Mexico (GOM) is much more profitable than previously thought. Four factors contributing to the changed viewpoint are: First, deepwater reservoirs have proved to have excellent productive capacity, distribution, and continuity when compared to correlative-age shelf deltaic sands. Second, improved technologies and lower perceived risks have lowered the cost of floating production systems (FPSs). Third, projects now get on-line quicker. Fourth, a collection of other important factors are: Reduced geologic risk and associated high success rates for deepwater GOM wells due primarily to improved seismic imaging and processing tools (3D, AVO, etc.); absence of any political risk in the deepwater GOM (common overseas, and very significant in some international areas); and positive impact of deepwater federal royalty relief. This article uses hypothetical reserve distributions and price forecasts to illustrate indicative economics of deepwater prospects. Economics of Shell Oil Co.'s three deepwater projects are also discussed

  12. Can We Measure the Transition to Reading? General Outcome Measures and Early Literacy Development From Preschool to Early Elementary Grades

    Directory of Open Access Journals (Sweden)

    Scott McConnell


    Full Text Available This study evaluated the extent to which existing measures met standards for a continuous suite of general outcome measures (GOMs assessing children’s early literacy from preschool through early elementary school. The study assessed 316 children from age 3 years (2 years prekindergarten through Grade 2, with 8 to 10 measures of language, alphabetic principle, phonological awareness, and beginning reading. We evaluated measures at each grade group against six standards for GOMs extracted from earlier work. We found that one measure of oral language met five or six standards at all grade levels, and several measures of phonological awareness and alphabetic principle showed promise across all five grade levels. Results are discussed in relation to ongoing research and development of a flexible and seamless system to assess children’s academic progress across time for effective prevention and remediation, as well as theoretical and empirical analyses in early literacy, early reading, and GOMs.

  13. Seasonal and diurnal variations of atmospheric mercury across the US determined from AMNet monitoring data

    Directory of Open Access Journals (Sweden)

    X. Lan


    Full Text Available Speciated atmospheric mercury observations collected over the period from 2008 to 2010 at the Environmental Protection Agency and National Atmospheric Deposition Program Atmospheric Mercury Network sites (AMNet were analyzed for its spatial, seasonal, and diurnal characteristics across the US. Median values of gaseous elemental mercury (GEM, gaseous oxidized mercury (GOM and particulate bound mercury (PBM at 11 different AMNet sites ranged from 148–226 ppqv (1.32–2.02 ng m−3, 0.05–1.4 ppqv (0.47–12.4 pg m−3 and 0.18–1.5 ppqv (1.61–13.7 pg m−3, respectively. Common characteristics of these sites were the similar median levels of GEM as well as its seasonality, with the highest mixing ratios occurring in winter and spring and the lowest in fall. However, discernible differences in monthly average GEM were as large as 30 ppqv, which may be caused by sporadic influence from local emission sources. The largest diurnal variation amplitude of GEM occurred in the summer. Seven rural sites displayed similar GEM summer diurnal patterns, in that the lowest levels appeared in the early morning, and then the GEM mixing ratio increased after sunrise and reached its maxima at noon or in the early afternoon. Unlike GEM, GOM exhibited higher mixing ratios in spring and summer. The largest diurnal variation amplitude of GOM occurred in spring for most AMNet sites. The GOM diurnal minima appeared before sunrise and maxima appeared in the afternoon. The increased GOM mixing ratio in the afternoon indicated a photochemically driven oxidation of GEM resulting in GOM formation. PBM exhibited diurnal fluctuations in summertime. The summertime PBM diurnal pattern displayed daily maxima in the early afternoon and lower mixing ratios at night, implying photochemical production of PBM in summer.

  14. Preparation of graphene oxide-manganese dioxide for highly efficient adsorption and separation of Th(IV)/U(VI). (United States)

    Pan, Ning; Li, Long; Ding, Jie; Li, Shengke; Wang, Ruibing; Jin, Yongdong; Wang, Xiangke; Xia, Chuanqin


    Manganese dioxide decorated graphene oxide (GOM) was prepared via fixation of crystallographic MnO2 (α, γ) on the surface of graphene oxide (GO) and was explored as an adsorbent material for simultaneous removal of thorium/uranium ions from aqueous solutions. In single component systems (Th(IV) or U(VI)), the α-GOM2 (the weight ratio of GO/α-MnO2 of 2) exhibited higher maximum adsorption capacities toward both Th(IV) (497.5mg/g) and U(VI) (185.2 mg/g) than those of GO. In the binary component system (Th(IV)/U(VI)), the saturated adsorption capacity of Th(IV) (408.8 mg/g)/U(VI) (66.8 mg/g) on α-GOM2 was also higher than those on GO. Based on the analysis of various data, it was proposed that the adsorption process may involve four types of molecular interactions including coordination, electrostatic interaction, cation-pi interaction, and Lewis acid-base interaction between Th(IV)/U(VI) and α-GOM2. Finally, the Th(IV)/U(VI) ions on α-GOM2 can be separated by a two-stage desorption process with Na2CO3/EDTA. Those results displayed that the α-GOM2 may be utilized as an potential adsorbent for removing and separating Th(IV)/U(VI) ions from aqueous solutions. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Airborne Vertical Profiling of Mercury Speciation near Tullahoma, TN, USA

    Directory of Open Access Journals (Sweden)

    Steve Brooks


    Full Text Available Atmospheric transport and in situ oxidation are important factors influencing mercury concentrations at the surface and wet and dry deposition rates. Contributions of both natural and anthropogenic processes can significantly impact burdens of mercury on local, regional and global scales. To address these key issues in atmospheric mercury research, airborne measurements of mercury speciation and ancillary parameters were conducted over a region near Tullahoma, Tennessee, USA, from August 2012 to June 2013. Here, for the first time, we present vertical profiles of Hg speciation from aircraft for an annual cycle over the same location. These airborne measurements included gaseous elemental mercury (GEM, gaseous oxidized mercury (GOM and particulate bound mercury (PBM, as well as ozone (O3, sulfur dioxide (SO2, condensation nuclei (CN and meteorological parameters. The flights, each lasting ~3 h, were conducted typically one week out of each month to characterize seasonality in mercury concentrations. Data obtained from 0 to 6 km altitudes show that GEM exhibited a relatively constant vertical profile for all seasons with an average concentration of 1.38 ± 0.17 ng∙m−3. A pronounced seasonality of GOM was observed, with the highest GOM concentrations up to 120 pg∙m−3 in the summer flights and lowest (0–20 pg∙m−3 in the winter flights. Vertical profiles of GOM show the maximum levels at altitudes between 2 and 4 km. Limited PBM measurements exhibit similar levels to GOM at all altitudes. HYSPLIT back trajectories showed that the trajectories for elevated GOM (>70 pg∙m−3 or PBM concentrations (>30 pg∙m−3 were largely associated with air masses coming from west/northwest, while events with low GOM (<20 pg∙m−3 or PBM concentrations (<5 pg∙m−3 were generally associated with winds from a wider range of wind directions. This is the first set of speciated mercury vertical profiles collected in a single location over the course

  16. Reprint of - Deep-sea coral and hardbottom habitats on the west Florida slope, eastern Gulf of Mexico (United States)

    Ross, Steve W.; Rhode, Mike; Brooke, Sandra


    Until recently, benthic habitats dominated by deep-sea corals (DSC) appeared to be less extensive on the slope of the Gulf of Mexico (GOM) than in the northeast Atlantic Ocean or off the southeastern US. There are relatively few bioherms (i.e., coral-built mounds) in the northern GOM, and most DSCs are attached to existing hard substrata (e.g., authigenically formed carbonate). The primary structure-forming, DSC in the GOM is Lophelia pertusa, but structure is also provided by other living and dead scleractinians, antipatharians (black corals), octocorals (gorgonians, soft corals), hydrocorals and sponges, as well as abundant rocky substrata. The best development of DSCs in the GOM was previously documented within Viosca Knoll oil and gas lease blocks 826 and 862/906 (north-central GOM) and on the Campeche Bank (southern GOM in Mexican waters). This paper documents extensive deep reef ecosystems composed of DSC and rocky hard-bottom recently surveyed on the West Florida Slope (WFS, eastern GOM) during six research cruises (2008-2012). Using multibeam sonar, CTD casts, and video from underwater vehicles, we describe the physical and oceanographic characteristics of these deep reefs and provide size or area estimates of deep coral and hardground habitats. The multibeam sonar analyses revealed hundreds of mounds and ridges, some of which were subsequently surveyed using underwater vehicles. Mounds and ridges in <525 m depths were usually capped with living coral colonies, dominated by L. pertusa. An extensive rocky scarp, running roughly north-south for at least 229 km, supported lower abundances of scleractinian corals than the mounds and ridges, despite an abundance of settlement substrata. Areal comparisons suggested that the WFS may exceed other parts of the GOM slope in extent of living deep coral coverage and other deep-reef habitat (dead coral and rock). The complex WFS region warrants additional studies to better understand the influences of oceanography and

  17. Seasonal changes on radionuclide concentration in Krusadai Island Mangrove

    International Nuclear Information System (INIS)

    Valan, I. Inigo; Stephen, A.; Vijayalakshmi, I.; Mathiyarasu, R.; Jose, M.T.


    Krusadai Island: The Biologist's Paradise, is situated in Gulf of Mannar (GOM) near Rameswaram of Tamil Nadu, India. It is an ecological sensitive area and act as the breeding zone for a variety of marine species, most of which are consumed by human population. Govt. of India and Govt. of Tamil Nadu jointly declared GOM as Marine National Park under Wildlife (Protection) Act 1972. So it is essential to have a periodic radiological survey in this area in order to check the concentrations of various radionuclide. Current study is radioactive report on various seasons of 2013 in Krusadai Island Mangrove

  18. Research

    African Journals Online (AJOL)


    11 août 2015 ... La numération plaquettaire a été réalisée sur automate Sysmex XE. 5000. Agrégométrie. L'étude de l'agrégation plaquettaire a été réalisée sur un thrombo- agrégomètre TA 4V (SD Medical, France) dans l'intervalle de 2 heures suivant le prélèvement. Ce test a été effectué sur plasma riche en plaquettes ...

  19. 2716-IJBCS-Article-Laurencia Toulsoumde SONGRE-OUATTARA

    African Journals Online (AJOL)


    Use of the moringa, spirulina, orange-fleshed sweet potato and a multivitamin complex in the manufacture ... spiruline (Spirulina platensis) et la patate douce à chair .... utilisant le test d'acceptabilité avec l'épreuve ...... Antioxidant properties of ...

  20. Dietary vitamin E (α-tocopheryl acetate) and organic selenium ...

    African Journals Online (AJOL)


    performance and antioxidant status of broilers fed n-3 PUFA-enriched feeds ..... plastic bags in dry ice and stored at -80 oC for assay of SOD. At the end of the trial ...... Biomass nutrient profiles of three microalgae: Spirulina Platensis, Chlorella.

  1. Antibacterial activities of the extracts of cyanobacteria and green ...

    African Journals Online (AJOL)

    In compliance to the recent surveys on algal species and their potentials to produce biologically active compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, Nostoc linckia, Phormidium autumnale, Tolypothrix distorta and Microcystis aeruginosa and green algae such as Chlorella vulgaris, ...

  2. The phenomenon of social conversion among farmers in France ...

    African Journals Online (AJOL)

    Le but de cet article est de faire la lumière sur le phénomène de la conversion sociale qui se produit lorsque les agriculteurs changent de pratiques agricoles traditionnelles vers une forme moins connue de l'aquaculture : la production de la spiruline super (Arthrospira platensis) . Certains agriculteurs du sud-est France ont ...

  3. Thermostable phycocyanin from the red microalga Cyanidioschyzon merolae, a new natural blue food colorant

    NARCIS (Netherlands)

    Rahman, D. Y.; Sarian, F. D.; van Wijk, A.; Martinez-Garcia, M.; van der Maarel, M. J. E. C.

    The demand for natural food colorants is growing as consumers question the use of artificial colorants more and more. The phycobiliprotein C-phycocyanin of Arthospira platensis is used as a natural blue colorant in certain food products. The thermoacidophilic red microalga Cyanidioschyzon merolae

  4. Author Details

    African Journals Online (AJOL)

    Antihyperglycemic activity of Phyllanthus amarus (Schum & Thonn) in rats. Abstract · Vol 16, No 3 (2014) - Articles Effet anti-ulcereux de l'extrait hydroalcoolique D'ecorce de tronc et de racine de Ficus polita vahl. (Moraceae) Abstract · Vol 17, No 2 (2015) - Articles Effect of Spirulina platensis powder on metabolic syndrome ...

  5. Author Details

    African Journals Online (AJOL)

    Sugiharto, S. Vol 48, No 1 (2018) - Articles Effect of feeding duration of Spirulina platensis on growth performance, haematological parameters, intestinal microbial population and carcass traits of broiler chicks. Abstract PDF. ISSN: 2221-4062. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  6. The effect of ultrasound at 256 KHz on Microcystis aeruginosa, with ...

    African Journals Online (AJOL)


    Oct 31, 2012 ... for 5 min inhibits the growth of the cyanobacterium Spirulina platensis for 3 d, while a sonication with 20 kHz showed no constant effect (Hao et al., 2004). Several mechanisms were discovered by which ultrasonic treatment affects the cells, of which the collapsing of gas vacu- oles during cavitation was ...

  7. One-Week Antihypertensive Effect of Ile-Gln-Pro in Spontaneously Hypertensive Rats

    NARCIS (Netherlands)

    Lu, Jun; Sawano, Yoriko; Miyakawa, Takuya; Xue, You-Lin; Cai, Mu-Yi; Egashira, Yukari; Ren, Di-Feng; Tanokura, Masaru


    The antihypertensive effect of an angiotensin I-converting enzyme (ACE) inhibitory peptide lie-Gin-Pro (IQP), whose sequence was derived from Spirulina platensis, was investigated in spontaneously hypertensive rats (SHRs) for 1 week. The weighted systolic blood pressure (SBP) and diastolic blood


    African Journals Online (AJOL)

    Philippe Stéfanini and. Samuel Ravatua-Smith attempt to shed light on the phenomenon of social conversion that occurs when farmers change from traditional agricultural practices towards a less well-known form of aquaculture; in this case, the production of the Spirulina superfood. (Arthrospira platensis). Though the focus ...

  9. Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

    NARCIS (Netherlands)

    Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.


    We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

  10. Enhancement of natural killer cell activity in healthy subjects by Immulina®, a Spirulina extract enriched for Braun-type lipoproteins

    DEFF Research Database (Denmark)

    Nielsen, Claus Henrik; Balachandran, Premalatha; Christensen, Ole


    Immulina®, a commercial extract of Arthrospira (Spirulina) platensis is a potent activator of THP-1 monocytes and CD4+ T cells IN VITRO and enhances several immunological functions in mice. We further characterized Immulina® by determining that Braun-type lipoproteins are responsible for a major...

  11. Oral administration of a Spirulina extract enriched for Braun-type lipoproteins protects mice against influenza A(H1N1) virus infection (United States)

    Previous studies indicate that Immulina, a commercial extract of Arthrospira (Spirulina) platensis, is a potent activator of innate immune cells and that Braun-type lipoproteins (a principal toll-like receptor (TLR) 2 ligand) are the main active components within this product. In the present study, ...

  12. 78 FR 34039 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for... (United States)


    ...) Georges Bank winter flounder. Sec. 648.86(l) Zero retention of Atlantic wolffish. Sec. 648.86(o..., fecundity, bioelectrical impedance analysis (BIA), food habits, and genetic research. The yellowtail... (GOM), Georges Bank (GB), Southern New England/Mid-Atlantic (SNE/MA)), or 1,200 fish total from each...

  13. 78 FR 12085 - Environmental Documents Prepared for Oil, Gas, and Mineral Operations by the Gulf of Mexico Outer... (United States)


    ... the Central Planning Area of the Gulf of Mexico. Energy Resource Technology GOM, Green Canyon, Block... on the Federal OCS. These SEAs examine the potential environmental effects of proposed activities and present BOEM conclusions regarding the significance of those effects. The SEAs are used as a basis for...

  14. 30 CFR 250.468 - What well records am I required to submit? (United States)


    ... OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Oil and Gas Drilling Operations...) You must submit copies of logs or charts of electrical, radioactive, sonic, and other well-logging... drilling operations in the GOM OCS Region, you must submit form MMS-133, Well Activity Report, to the...

  15. 76 FR 12715 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for... (United States)


    ... and marketing evaluation and strategies; and outreach and implementation of the project results. The... devise strategies and means to efficiently harvest the redfish resource in the Gulf of Maine (GOM) while... in terms of their potential effects on results. Sources of variability include: Area fished; seasonal...

  16. Microbial respiration and extracellular enzyme activity in sediments from the Gulf of Mexico hypoxic zone (United States)

    This study explores the relationship between sediment chemistry (TC, TN, TP) and microbial respiration (DHA) and extracellular enzyme activity (EEA) across the Gulf of Mexico (GOM) hypoxic zone. TC, TN, and TP were all positively correlated with each other (r=0.19-0.68). DHA was ...

  17. 77 FR 65326 - Magnuson-Stevens Fishery Conservation and Management Act Provisions; Fisheries of the... (United States)


    ... to reduce overfishing occurring on Gulf of Maine cod in anticipation of further action to end overfishing in the 2013 fishing year. DATES: The expiration date of the temporary rule published May 1, 2012..., overfishing of GOM cod while the Council developed a rebuilding plan. In response to the Council request and...

  18. 77 FR 7000 - Fisheries of the Northeastern United States; Northeast Multispecies Fishery; Gulf of Maine Winter... (United States)


    ... 2010, 2011, and 2012. A new peer reviewed benchmark stock assessment review (SARC 52) was completed for... opportunity that otherwise might be foregone. The new information from the GOM winter flounder benchmark stock... Conservation and Management Act (Magnuson-Stevens Act). This action implements new stock status determination...

  19. Variation in wind and piscivorous predator fields affecting the survival of Atlantic salmon, Salmo salar, in the Gulf of Maine (United States)

    Friedland, K.D.; Manning, J.P.; Link, Jason S.; Gilbert, J.R.; Gilbert, A.T.; O'Connell, A.F.


    Observations relevant to the North American stock complex of Atlantic salmon, Salmo salar L., suggest that marine mortality is influenced by variation in predation pressure affecting post-smolts during the first months at sea. This hypothesis was tested for Gulf of Maine (GOM) stocks by examining wind pseudostress and the distribution of piscivorous predator fields potentially affecting post-smolts. Marine survival has declined over recent decades with a change in the direction of spring winds, which is likely extending the migration of post-smolts by favouring routes using the western GOM. In addition to changes in spring wind patterns, higher spring sea surface temperatures have been associated with shifting distributions of a range of fish species. The abundance of several pelagic piscivores, which based on their feeding habits may predate on salmon post-smolts, has increased in the areas that serve as migration corridors for post-smolts. In particular, populations of silver hake, Merluccius bilinearis (Mitchell), red hake, Urophycis chuss (Walbaum), and spiny dogfish, Squalus acanthias L., increased in size in the portion of the GOM used by post-smolts. Climate variation and shifting predator distributions in the GOM are consistent with the predator hypothesis of recruitment control suggested for the stock complex.

  20. Gaseous Oxidized Mercury Dry Deposition Measurements in the FourCorners Area and Eastern Oklahoma, U.S.A. (United States)

    Gaseous oxidized mercury (GOM) dry deposition measurements using surrogate surface passive samplers were collected in the Four Corners area and eastern Oklahoma from August, 2009–August, 2011. Using data from a six site area network, a characterization of the magnitude and spatia...

  1. Trophic efficiency of plankton food webs: Observations from the Gulf of Mannar and the Palk Bay, Southeast Coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Anjusha, A.; Jyothibabu, R; Jagadeesan, L.; Mohan, A.P.; Sudheesh, K.; Krishna, K.; Ullas, N.; Deepak, M.P.

    This paper introduces the structure and trophic efficiency of plankton food webs in the Gulf of Mannar (GoM) and the Palk Bay (PB) - two least studied marine environments located between India and Sri Lanka. The study is based on the results...

  2. Ecology and trophic preference of picoplankton and nanoplankton in the Gulf of Mannar and the Palk Bay, southeast coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothibabu, R; Mohan, A.P.; Jagadeesan, L.; Anjusha, A.; Muraleedharan, K.R; KrishnaKiran, L.; Ullas, N.

    (November-February) are presented in this paper. Coastal currents during the study period was from the east to west and as a result, the PB had Bay of Bengal (BoB) waters, which was low saline (av. 28.98 plus or minus 1.34) as compared to the GoM (av. 31...

  3. Time-domain incomplete Gauss-Newton full-waveform inversion of Gulf of Mexico data

    KAUST Repository

    AlTheyab, Abdullah; Wang, Xin; Schuster, Gerard T.


    We apply the incomplete Gauss-Newton full-waveform inversion (TDIGN-FWI) to Gulf of Mexico (GOM) data in the space-time domain. In our application, iterative least-squares reverse-time migration (LSRTM) is used to estimate the model update at each

  4. Gestational diabetes

    African Journals Online (AJOL)

    recognition of diabetes during pregnancy.1D.n However, GOM has sufficient .... If the plasma glucose value at 1 hour is over 7.8 mmolll, the ..... OeFronzo RA Pathogenesis of type 2 (non-insulin dependent) diabetes: a balanced overview.

  5. Organic matter in surface sediments from the Gulf of Mexico and South China Sea: Compositions, distributions and sources. (United States)

    Wang, Cuiping; Jia, Weili; Wang, Dong; Song, Zhiguang


    Sediments from the Gulf of Mexico (GOM) and the South China Sea (SCS) were analyzed. The low δ 13 C values of pentamethylicosane (PMIs) and fatty acids (-81.3 to -85.2‰) were found in only the S-1 sample collected from the GOM, indicating that methanogenic archaea associated with gas hydrate formation contributed to the sediment organic matter. Principle component analysis of fatty acids suggested that similar microbial biomass was found in the S-1, S-9, O-3 and O-5 samples. However, a comparison of the alkanes, fatty acids, and alcohols indicated that the percentage of n-alkan-2-ols in the S-1 sample from the GOM was the highest, while n-alkanes and n-fatty acids were the highest percentages in other samples from the GOM and SCS. This finding suggests that microbial species or the oxidation/reduction environment of the sample site of S-1 were different from those of the other samples. The present study provides a basis for detecting gas hydrate sites on the seafloor of the SCS. Copyright © 2017. Published by Elsevier Ltd.

  6. 77 FR 41448 - Notice of Availability of the Proposed Final Five Year Outer Continental Shelf (OCS) Oil and Gas... (United States)


    ... President and Congress. After a period of at least 60 days from the date it was submitted to the President... (3 areas off Alaska and 3 areas in the Gulf of Mexico (GOM)). Maps A and B show the areas proposed... not under congressional moratorium pursuant to the Gulf of Mexico Energy Security Act of 2006 (GOMESA...

  7. 75 FR 44276 - Bureau of Ocean Energy Management, Regulation, and Enforcement (BOEMRE); Cancellation of Oil and... (United States)


    ... (OCS) in the Gulf of Mexico (GOM) AGENCY: Bureau of Ocean Energy Management, Regulation, and Enforcement, Interior. ACTION: Cancellation of WPA Gulf of Mexico Lease Sale 215. SUMMARY: On May 27, 2010, the President announced the Secretary of the Interior's decision to cancel WPA Sale 215 that was...

  8. 76 FR 34023 - Endangered and Threatened Species; Proposed Protective Regulations for the Gulf of Maine Distinct... (United States)


    ... stressors impeding recovery of the DPS. DATES: Comments on this proposal must be received by August 9, 2011... primary stressors for the GOM DPS of Atlantic sturgeon (ASSRT, 2007). As described in the proposed rule... considerably from 1977-2000 (1977 B 1981 CPUE = 0.30 versus 1998 B 2000 CPUE = 7.43) while the CPUE of adult...

  9. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar). (United States)


    ... Distinct Population Segment of Atlantic Salmon (Salmo salar). 226.217 Section 226.217 Wildlife and... Distinct Population Segment of Atlantic Salmon (Salmo salar). Critical habitat is designated to include all... the Gulf of Maine Distinct Population Segment of Atlantic Salmon (GOM DPS), except for those...

  10. 77 FR 34405 - Environmental Documents Prepared for Oil, Gas, and Mineral Operations by the Gulf of Mexico Outer... (United States)


    ... Geophysical Survey, SEA M09- Planning Area of the 013. Gulf of Mexico. Energy Resource Technology GOM, South... Oil, Gas, and Mineral Operations by the Gulf of Mexico Outer Continental Shelf (OCS) Region AGENCY... documents prepared for OCS mineral proposals by the Gulf of Mexico OCS Region SUMMARY: BOEM, in accordance...

  11. 76 FR 38673 - Environmental Documents Prepared for Proposed Oil, Gas, and Mineral Operations by the Gulf of... (United States)


    ... the Survey, SEA M10-008. Gulf of Mexico. Coastal Technology Corporation, Located on the Atlantic 2/1.... Planning Areas of the Gulf of Mexico. Energy Resource Technology GOM, Matagorda Island, Block 2/3/2011 Inc... Environmental Documents Prepared for Proposed Oil, Gas, and Mineral Operations by the Gulf of Mexico Outer...

  12. Nitrogen delivery from the Mississippi-Atchafalaya River Basin to the Gulf of Mexico: magnitude, attribution, and uncertainty (United States)

    Tian, H.; Xu, R.; Yang, J.; Zhang, B.; Yao, Y.; Pan, S.; Cai, W. J.; Lohrenz, S. E.


    The northern Gulf of Mexico (GOM), as one of the largest hypoxic zone in the world, is near the outlet of the Mississippi-Atchafalaya River Basin (MARB) that contributed to the increased fluxes of agriculturally derived nitrogen (N) since the 1950s. This increase of N exports could be primarily attributed to anthropogenic N inputs into the MARB (e.g., N fertilizer application), climate (e.g., precipitation), and land use change. A long-term data of monthly/annual dissolved inorganic nitrogen (DIN) exports from the MARB to the GOM had been released by the United States Geological Survey (USGS) since the 1970s. However, on one hand, dissolved organic nitrogen (DON) also plays an active role in supplying N for phytoplankton and bacteria in aquatic ecosystems; on the other hand, monitoring data provided by the USGS could not attribute the contributions of various factors to this N increase in the northern GOM. Here, we used a coupled hydrological-biogeochemical model, the Dynamic Land Ecosystem Model, to examine changes in DIN (ammonium and nitrate) and DON exports from the MARB to the GOM during 1901 2014. Meanwhile, we investigated how climate variability, land use change, land management, and atmospheric chemistry affected the annual and seasonal patterns of N export in the study area.

  13. 30 CFR 203.86 - What is in a G&G report? (United States)


    ...-interpreted 2D/3D survey lines reflecting any available state-of-the-art processing technique in a format... prospective pay horizons, wells, and fault cuts; (3) Digital velocity surveys in the format of the GOM region... horizons. (b) Well data which includes: (1) Hard copies of all well logs in which— (i) The 1-inch electric...

  14. 78 FR 20717 - Endangered and Threatened Wildlife and Plants; Proposed Endangered, Threatened, and Not Warranted... (United States)


    ...). Although indirect age validation studies for S. lewini are still inconclusive, bomb radiocarbon and calcein... the ESA: Northwest Atlantic and Gulf of Mexico (NW Atlantic & GOM DPS); Central and Southwest Atlantic... States (from New Jersey to Florida) to Brazil, including the Gulf of Mexico and Caribbean Sea. In the...

  15. 77 FR 4366 - North American Agreement on Labor Cooperation Notice of Determination Regarding Review of... (United States)


    ... GOM's subsequent actions or lack thereof denied these workers their rights under Mexican law related to freedom of association, the right to organize, the right to bargain collectively, and the... de Electricistas (SME), a Mexican union, filed the submission with OTLA on November 14, 2011. The SME...

  16. 78 FR 27427 - Outer Continental Shelf (OCS) Geological and Geophysical Exploration Activities in the Gulf of... (United States)


    ... timeframe. The activities considered within this PEIS are associated with GOM OCS oil and gas exploration... and NMFS as the PEIS is developed. Background: A variety of G&G techniques are used to characterize... surveys are conducted to: (1) Obtain data for hydrocarbon exploration and production; (2) aid in siting...

  17. Developing a General Outcome Measure Off Growth in Social Skills for Infants and Toddlers (United States)

    Carta, Judith; Greenwood, Charles; Luze, Gayle; Cline, Gabriel; Kuntz, Susan


    Proficiency in social interaction with adults and peers is an important outcome in early childhood. The development of an experimental measure for assessing growth in social skills in children birth to 3 years is described. Based on the general outcome measurement (GOM) approach (e.g., Deno, 1997), the measure is intended for use by early…

  18. Developing a General Outcome Measure of Growth in Social Skills for Infants and Toddlers (United States)

    Carta, Judith; Greenwood, Charles; Luze, Gayle; Cline, Gabriel; Kuntz, Susan


    Proficiency in social interaction with adults and peers is an important outcome in early childhood. The development of an experimental measure for assessing growth in social skills in children birth to 3 years is described. Based on the general outcome measurement (GOM) approach (e.g., Deno, 1997), the measure is intended for use by early…

  19. 76 FR 18653 - Atlantic Highly Migratory Species; Bluefin Tuna Bycatch Reduction in the Gulf of Mexico Pelagic... (United States)


    ..., including BFT. This final action is not expected to change fishing effort or behavior beyond that already... substantial negative social and economic impacts and cannot be implemented in short time frames, these...- economic benefits of normal operation of directed fisheries in the GOM with minimal short-term negative...

  20. The Influences of Riverine Dissolved Organic Matter in the Gulf of Maine (United States)

    Aiken, G.; Cao, X.; Mao, J.; Spencer, R. G.; Balch, W. M.; Huntington, T. G.


    Dissolved organic matter (DOM) exported from the Gulf of St. Lawrence and by rivers in Maine, Nova Scotia, and New Brunswick is being studied to quantify and characterize optical proxies in the receiving waters of the Gulf of Maine (GoM). Measurements of DOC concentrations, absorption coefficients (254nm, 350 nm and 412 nm), specific ultraviolet absorbance (SUVA254), spectral slope, and fluorescence, and DOC fractionation and isotopic analyses were used to determine the amount and nature of DOM from major inflowing rivers, marine waters, and the GoM. In addition, lignin phenols, 14C-age, 13C-NMR and FTICR-MS analyses were performed on the hydrophobic (HPOA) and transphilic organic acid fractions of the DOM isolated using XAD resins for a smaller subset of samples from the Penobscot River, Penobscot Bay, GoM waters in the Eastern Maine Coastal Current (EMCC), a sample from the eastern portion of the GoM (Scotian Shelf waters), and the Pacific Ocean. These samples provide detailed DOM compositional data in support of the more easily collected concentration and optical data obtained from discrete samples, optical data obtained by in situ glider, and remotely sensed satellite observations. Optical measurements, 13C-NMR, and lignin phenol analyses showed that DOM associated with inflowing rivers to the GoM is rich in aromatic compounds resulting in a large flux of terrestrially derived chromophoric DOM (CDOM). As a result, GoM DOM is more aromatic and younger than open ocean samples collected from the Sargasso Sea and from the Pacific Ocean near Hawaii. This observation is consistent with isotopic data that indicated δ 13C values for the HPOA fractions from the Gulf samples (δ 13C= -27‰ and -25‰) were considerably depleted in comparison to the whole DOM sample (δ 13C = -19‰; which also includes algal-produced DOM) and are more similar to those from the terrestrial sources. Samples from the EMCC were the most heavily influenced by terrestrial sources. While NMR

  1. Knowledge gained from analyzing mercury speciation data monitored in North America (United States)

    Zhang, L.; Cheng, I.; Gay, D. A.; Xu, X.; Wu, Z.


    This presentation summarizes knowledge gained in several recent studies through analysis and application of mercury (Hg) speciation data monitored in North America. Annual Hg dry deposition to vegetated surfaces in the rural or remote environment in North America was dominated by leaf uptake of gaseous elemental mercury (GEM), contrary to what was commonly assumed in earlier studies which frequently omitted GEM dry deposition as an important process (Zhang et al., EST, 2016). Dry deposition exceeded wet deposition by a large margin in all of the seasons except in the summer at the majority of the sites. Based on the gaseous oxidized mercury (GOM) concentrations predicted from measured Hg wet deposition using a scavenging ratio method, multi-year average GOM concentrations collected using Tekran speciation instrument were likely biased low by a factor of 2 at about half of the studied sites (Cheng and Zhang, EST, 2017). A decline in the number of source regions impacting ambient GEM and GOM was found from 2005-2014 at an eastern U.S. site through concentration-weighted trajectory (CWT) analysis (Cheng et al., JAS, 2017). Source contributions decreased by up to 20% for GEM, greater than 60% for GOM, and 20-60% for PBM in 2011-2014 than in 2006-2008, largely due to power plant Hg emission reductions since 2009. A study comparing Positive Matrix Factorization (PMF) and Principal Components Analysis (PCA) receptor methods identified similar sources impacting Kejimkujik National Park, Canada, including combustion, industrial sulfur, photochemistry and re-emissions, and oceanic sea-salt emissions. Improving the quality of the Hg data used in receptor methods by imputation did not improve the PMF results, but reducing the fraction of below detection limit data was effective (Xu et al., ACP, 2017). PCA results using reactive mercury (RM=GOM+PBM) or excluding low GOM values were similar to those using the original data. Source contributions from CWT analysis were more

  2. Current understanding of the driving mechanisms for spatiotemporal variations of atmospheric speciated mercury: a review

    Directory of Open Access Journals (Sweden)

    H. Mao


    Full Text Available Atmospheric mercury (Hg is a global pollutant and thought to be the main source of mercury in oceanic and remote terrestrial systems, where it becomes methylated and bioavailable; hence, atmospheric mercury pollution has global consequences for both human and ecosystem health. Understanding of spatial and temporal variations of atmospheric speciated mercury can advance our knowledge of mercury cycling in various environments. This review summarized spatiotemporal variations of total gaseous mercury or gaseous elemental mercury (TGM/GEM, gaseous oxidized mercury (GOM, and particulate-bound mercury (PBM in various environments including oceans, continents, high elevation, the free troposphere, and low to high latitudes. In the marine boundary layer (MBL, the oxidation of GEM was generally thought to drive the diurnal and seasonal variations of TGM/GEM and GOM in most oceanic regions, leading to lower GEM and higher GOM from noon to afternoon and higher GEM during winter and higher GOM during spring–summer. At continental sites, the driving mechanisms of TGM/GEM diurnal patterns included surface and local emissions, boundary layer dynamics, GEM oxidation, and for high-elevation sites mountain–valley winds, while oxidation of GEM and entrainment of free tropospheric air appeared to control the diurnal patterns of GOM. No pronounced diurnal variation was found for Tekran measured PBM at MBL and continental sites. Seasonal variations in TGM/GEM at continental sites were attributed to increased winter combustion and summertime surface emissions, and monsoons in Asia, while those in GOM were controlled by GEM oxidation, free tropospheric transport, anthropogenic emissions, and wet deposition. Increased PBM at continental sites during winter was primarily due to local/regional coal and wood combustion emissions. Long-term TGM measurements from the MBL and continental sites indicated an overall declining trend. Limited measurements suggested TGM

  3. Subsurface gas hydrates in the northern Gulf of Mexico (United States)

    Boswell, Ray; Collett, Timothy S.; Frye, Matthew; Shedd, William; McConnell, Daniel R.; Shelander, Dianna


    The northernGulf of Mexico (GoM) has long been a focus area for the study of gashydrates. Throughout the 1980s and 1990s, work focused on massive gashydrates deposits that were found to form at and near the seafloor in association with hydrocarbon seeps. However, as global scientific and industrial interest in assessment of the drilling hazards and resource implications of gashydrate accelerated, focus shifted to understanding the nature and abundance of "buried" gashydrates. Through 2005, despite the drilling of more than 1200 oil and gas industry wells through the gashydrate stability zone, published evidence of significant sub-seafloor gashydrate in the GoM was lacking. A 2005 drilling program by the GoM GasHydrate Joint Industry Project (the JIP) provided an initial confirmation of the occurrence of gashydrates below the GoM seafloor. In 2006, release of data from a 2003 industry well in Alaminos Canyon 818 provided initial documentation of gashydrate occurrence at high concentrations in sand reservoirs in the GoM. From 2006 to 2008, the JIP facilitated the integration of geophysical and geological data to identify sites prospective for gashydrate-bearing sands, culminating in the recommendation of numerous drilling targets within four sites spanning a range of typical deepwater settings. Concurrent with, but independent of, the JIP prospecting effort, the Bureau of Ocean Energy Management (BOEM) conducted a preliminary assessment of the GoM gashydratepetroleum system, resulting in an estimate of 607 trillion cubic meters (21,444 trillion cubic feet) gas-in-place of which roughly one-third occurs at expected high concentrations in sand reservoirs. In 2009, the JIP drilled seven wells at three sites, discovering gashydrate at high saturation in sand reservoirs in four wells and suspected gashydrate at low to moderate saturations in two other wells. These results provide an initial confirmation of the complex nature and occurrence of gashydrate-bearing sands in

  4. Current understanding of the driving mechanisms for spatiotemporal variations of atmospheric speciated mercury: a review (United States)

    Mao, Huiting; Cheng, Irene; Zhang, Leiming


    Atmospheric mercury (Hg) is a global pollutant and thought to be the main source of mercury in oceanic and remote terrestrial systems, where it becomes methylated and bioavailable; hence, atmospheric mercury pollution has global consequences for both human and ecosystem health. Understanding of spatial and temporal variations of atmospheric speciated mercury can advance our knowledge of mercury cycling in various environments. This review summarized spatiotemporal variations of total gaseous mercury or gaseous elemental mercury (TGM/GEM), gaseous oxidized mercury (GOM), and particulate-bound mercury (PBM) in various environments including oceans, continents, high elevation, the free troposphere, and low to high latitudes. In the marine boundary layer (MBL), the oxidation of GEM was generally thought to drive the diurnal and seasonal variations of TGM/GEM and GOM in most oceanic regions, leading to lower GEM and higher GOM from noon to afternoon and higher GEM during winter and higher GOM during spring-summer. At continental sites, the driving mechanisms of TGM/GEM diurnal patterns included surface and local emissions, boundary layer dynamics, GEM oxidation, and for high-elevation sites mountain-valley winds, while oxidation of GEM and entrainment of free tropospheric air appeared to control the diurnal patterns of GOM. No pronounced diurnal variation was found for Tekran measured PBM at MBL and continental sites. Seasonal variations in TGM/GEM at continental sites were attributed to increased winter combustion and summertime surface emissions, and monsoons in Asia, while those in GOM were controlled by GEM oxidation, free tropospheric transport, anthropogenic emissions, and wet deposition. Increased PBM at continental sites during winter was primarily due to local/regional coal and wood combustion emissions. Long-term TGM measurements from the MBL and continental sites indicated an overall declining trend. Limited measurements suggested TGM/GEM increasing from the

  5. The Role of Transforms in Gulf of Mexico Opening (United States)

    Lundin, E.; Doré, A. G.


    The curious pie-shaped Gulf of Mexico (GoM) may be considered a high-angle back-arc basin to the Pacific Ocean. Opening was strongly facilitated by transforms, including a terminal transform on its Pacific side. GoM also formed synchronously with the nearby Central Atlantic when Gondwanaland pulled away from Laurasia in the Jurassic. Notably, GoM's oceanic crust never connected with that of the Atlantic, and the isolated nature of this small ocean led to periodically confined conditions that influenced the petroleum system. Of particular importance are the deposition of Callovian age salt and Tithonian age source rocks. The central part of GoM is generally accepted as underlain by oceanic crust, but the position of the continent-ocean boundaries (COB) is debated, as well as the nature of intervening crust. We favor an interpretation of the COBs marked by the regional scale, large-amplitude Houston, Florida, and Campeche magnetic anomalies, in turn probably reflecting seaward dipping reflectors of magma-rich margins. GoM's unusual shape may indirectly represent utilization of pre-existing transforms during the break-up of Pangea. Transforms represent long, linear weaknesses where the crust and lithosphere is already broken. Transforms seem to have governed the break-up of several oceanic segments in the North Atlantic and Arctic. The Suwanne suture of the Rheic Ocean is a pronounced magnetic anomaly that crosses Georgia-Florida and becomes aligned with the Houston magnetic anomaly, which here is interpreted as the northern COB to GoM. The Suwanne suture is oriented at high angle to the rest of the Rheic suture along the Appalachians and probably experienced lateral motion during the transpressional closure of the Rheic Ocean. This transform arguably represents a weak element in the Ouachita-Marathon orogen that allowed the Yucatan microcontinent to easily be plucked from the North American margin during the dispersal of Pangea, forming the GoM in the process. This

  6. Multidimensional profiles of health status: an application of the grade of membership model to the world health survey.

    Directory of Open Access Journals (Sweden)

    Alessandra Andreotti

    Full Text Available BACKGROUND: The World Health Organization (WHO conducted the World Health Survey (WHS between 2002 and 2004 in 70 countries to provide cross-population comparable data on health, health-related outcomes and risk factors. The aim of this study was to apply Grade of Membership (GoM modelling as a means to condense extensive health information from the WHS into a set of easily understandable health profiles and to assign the degree to which an individual belongs to each profile. PRINCIPAL FINDINGS: This paper described the application of the GoM models to summarize population health status using World Health Survey data. Grade of Membership analysis is a flexible, non-parametric, multivariate method, used to calculate health profiles from WHS self-reported health state and health conditions. The WHS dataset was divided into four country economic categories based on the World Bank economic groupings (high, upper-middle, lower-middle and low income economies for separate GoM analysis. Three main health profiles were produced for each of the four areas: I. Robust; II. Intermediate; III. Frail; moreover population health, wealth and inequalities are defined for countries in each economic area as a means to put the health results into perspective. CONCLUSIONS: These analyses have provided a robust method to better understand health profiles and the components which can help to identify healthy and non-healthy individuals. The obtained profiles have described concrete levels of health and have clearly delineated characteristics of healthy and non-healthy respondents. The GoM results provided both a useable way of summarising complex individual health information and a selection of intermediate determinants which can be targeted for interventions to improve health. As populations' age, and with limited budgets for additional costs for health care and social services, applying the GoM methods may assist with identifying higher risk profiles for decision

  7. Adjoint sensitivity studies of loop current and eddy shedding in the Gulf of Mexico

    KAUST Repository

    Gopalakrishnan, Ganesh; Cornuelle, Bruce D.; Hoteit, Ibrahim


    Adjoint model sensitivity analyses were applied for the loop current (LC) and its eddy shedding in the Gulf of Mexico (GoM) using the MIT general circulation model (MITgcm). The circulation in the GoM is mainly driven by the energetic LC and subsequent LC eddy separation. In order to understand which ocean regions and features control the evolution of the LC, including anticyclonic warm-core eddy shedding in the GoM, forward and adjoint sensitivities with respect to previous model state and atmospheric forcing were computed using the MITgcm and its adjoint. Since the validity of the adjoint model sensitivities depends on the capability of the forward model to simulate the real LC system and the eddy shedding processes, a 5 year (2004–2008) forward model simulation was performed for the GoM using realistic atmospheric forcing, initial, and boundary conditions. This forward model simulation was compared to satellite measurements of sea-surface height (SSH) and sea-surface temperature (SST), and observed transport variability. Despite realistic mean state, standard deviations, and LC eddy shedding period, the simulated LC extension shows less variability and more regularity than the observations. However, the model is suitable for studying the LC system and can be utilized for examining the ocean influences leading to a simple, and hopefully generic LC eddy separation in the GoM. The adjoint sensitivities of the LC show influences from the Yucatan Channel (YC) flow and Loop Current Frontal Eddy (LCFE) on both LC extension and eddy separation, as suggested by earlier work. Some of the processes that control LC extension after eddy separation differ from those controlling eddy shedding, but include YC through-flow. The sensitivity remains stable for more than 30 days and moves generally upstream, entering the Caribbean Sea. The sensitivities of the LC for SST generally remain closer to the surface and move at speeds consistent with advection by the high-speed core of

  8. Adjoint sensitivity studies of loop current and eddy shedding in the Gulf of Mexico

    KAUST Repository

    Gopalakrishnan, Ganesh


    Adjoint model sensitivity analyses were applied for the loop current (LC) and its eddy shedding in the Gulf of Mexico (GoM) using the MIT general circulation model (MITgcm). The circulation in the GoM is mainly driven by the energetic LC and subsequent LC eddy separation. In order to understand which ocean regions and features control the evolution of the LC, including anticyclonic warm-core eddy shedding in the GoM, forward and adjoint sensitivities with respect to previous model state and atmospheric forcing were computed using the MITgcm and its adjoint. Since the validity of the adjoint model sensitivities depends on the capability of the forward model to simulate the real LC system and the eddy shedding processes, a 5 year (2004–2008) forward model simulation was performed for the GoM using realistic atmospheric forcing, initial, and boundary conditions. This forward model simulation was compared to satellite measurements of sea-surface height (SSH) and sea-surface temperature (SST), and observed transport variability. Despite realistic mean state, standard deviations, and LC eddy shedding period, the simulated LC extension shows less variability and more regularity than the observations. However, the model is suitable for studying the LC system and can be utilized for examining the ocean influences leading to a simple, and hopefully generic LC eddy separation in the GoM. The adjoint sensitivities of the LC show influences from the Yucatan Channel (YC) flow and Loop Current Frontal Eddy (LCFE) on both LC extension and eddy separation, as suggested by earlier work. Some of the processes that control LC extension after eddy separation differ from those controlling eddy shedding, but include YC through-flow. The sensitivity remains stable for more than 30 days and moves generally upstream, entering the Caribbean Sea. The sensitivities of the LC for SST generally remain closer to the surface and move at speeds consistent with advection by the high-speed core of

  9. Development of microalgae biomaterials with enhanced antioxidant activity using electron beam

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Younghwa; Park, Hyunjin; Choi, Soojeong; Lee, Jaehwa [Silla Univ., Busan (Korea, Republic of)


    By increasing the antioxidant products (e. g. antioxidant enzyme, carotenoid, phycobiliproteins, chlorophyll, lipid phenolic compounds, etc.) in microalgae, it could be useful for industry. In this study, mutants of fresh water microalgae Arthrospira platensis (A. platensis) by high energy electron beam were isolated and characterized. Those selected mutants showed higher growth rate than parental strain. The antioxidant enzyme activity (SOD and POD), flavonoid, phenolic compound and phycocyanin of mutants were increased about 2 times compared to wild type. Moreover, DPPH radical scavenging activity was increased about 20%. Microalgae species with improved growth rate and enhanced active compounds make the commercial process more feasible in industry. Using microalgae mutants with increased antioxidant products, it is useful to develop microalgae biomaterials for neutraceuticals.

  10. Carbohydrate-enriched cyanobacterial biomass as feedstock for bio-methane production through anaerobic digestion

    DEFF Research Database (Denmark)

    Markou, Giorgos; Angelidaki, Irini; Georgakakis, Dimitris


    The anaerobic digestion performance using carbohydrate-enriched biomass of Arthrospira platensis was studied. The carbohydrate enrichment was achieved after the cultivation of A. platensis under phosphorus limitation conditions. Three biomass compositions (60%, 40% and 20% carbohydrates content......) were used. The overall observation as the biomass carbohydrates increased was that bio-methane yield increased. The highest bio-methane yield in bioreactors with 60% carbohydrates was 203±10ml CH4 gCODinfl-1, while the lowest bio-methane yield in bioreactors with 20% carbohydrates was 123±10ml CH4 g......CODinfl-1. The trend of increasing bio-methane yield as carbohydrates content of the biomass increased was observed almost in all three HRT (15, 20 and 30days) studied and after thermal pre-treatment. However, thermal pre-treatment did not improve the bio-methane yield. Ammonia concentration had an overall...

  11. Development of microalgae biomaterials with enhanced antioxidant activity using electron beam

    International Nuclear Information System (INIS)

    Kim, Younghwa; Park, Hyunjin; Choi, Soojeong; Lee, Jaehwa


    By increasing the antioxidant products (e. g. antioxidant enzyme, carotenoid, phycobiliproteins, chlorophyll, lipid phenolic compounds, etc.) in microalgae, it could be useful for industry. In this study, mutants of fresh water microalgae Arthrospira platensis (A. platensis) by high energy electron beam were isolated and characterized. Those selected mutants showed higher growth rate than parental strain. The antioxidant enzyme activity (SOD and POD), flavonoid, phenolic compound and phycocyanin of mutants were increased about 2 times compared to wild type. Moreover, DPPH radical scavenging activity was increased about 20%. Microalgae species with improved growth rate and enhanced active compounds make the commercial process more feasible in industry. Using microalgae mutants with increased antioxidant products, it is useful to develop microalgae biomaterials for neutraceuticals

  12. Chronology and ancient feeding ecology of two upper Pleistocene megamammals from the Brazilian Intertropical Region (United States)

    de Melo França, Lucas; Trindade Dantas, Mário André; Bocchiglieri, Adriana; Cherckinsky, Alexander; de Souza Ribeiro, Adauto; Bocherens, Hervé


    In Brazilian Intertropical Region (BIR) fossil remains of the giant ground sloth Eremotherium laurillardi (Lund, 1842) and of the proboscidean Notiomastodon platensis (Ameghino, 1888) are the most abundant among megaherbivores. However, the paleoecology of both species needs to be better understood to enlighten why these species disappear in the end of the Pleistocene, an issue that is still debated. During the last decades, the carbon and oxygen stable isotopes have been increasingly being used to obtain paleoecological information about extinct animals, although this information is in most cases dissociated from chronological data. Thus, the main objective of this study is to contribute to the knowledge about feeding ecology and chronology of E. laurillardi and N. platensis within BIR. For each fossil sample we performed stable isotopes analyses (δ13C/δ18O) and radiocarbon dating (14C with AMS). The results showed that N. platensis occurred between 12,125 and 19,594 cal yr BP and exhibited a grazer diet (δ13C = -1.1‰-1.3‰), while E. laurillardi lived between 11,084 and 27,690 cal yr BP, with a mixed feeder diet (C3/C4 plants; values ratio δ13C = -7.7‰ to -3.3‰). The δ18O values of N. platensis ranged between 2.20‰ and 3.60‰, while the values of E. laurillardi ranged between -3.10‰ and -1.10‰. Neither species did exhibit differences in its diet through time, which suggests that the vegetational composition of this locality did not vary in the late Pleistocene. Both species were living in an open environment, rich in herbaceous plants (C4 plants) and with tree and shrub with disjoint distribution, maybe similar to some parts of recent Caatinga, where they have partitioned the spatial and feeding niches.

  13. A Review of Cyanobacterial Odorous and Bioactive Metabolites: Impacts and Management Alternatives in Aquaculture (United States)


    Ben-Amotz, A., 1985. Lipid and lipopoly- saccharide constituents of cyanobacterium Spirulina platensis (Cyanophyceae, Nostocales). Mar. Ecol. Prog...only been confirmed in liver and brain cells (Fischer et al., 2005; Meier- Abt et al., 2007). Once inside cells, microcystins and nodularins inhibit... assay ) or PPIA (protein phosphatase inhibition assay ) but the actual toxin responsible was not confirmed (i.e., confirmation by LC-MS, MALDI, or HPLC is

  14. 1829-IJBCS-Article-Barry Mamoudou

    African Journals Online (AJOL)


    Le Spirulina platensis est une algue utilisée pour ses effets nutritionnel et thérapeutique. De nombreuses études ont montré son intérêt ..... Mesure des cytokines (interleukine-4 (IL-4), l'interféron-γ (IFN-γ) et l'interleukine-2). - Réduction ... avec les métaux et les médicaments pouvant générer des radicaux libres toxiques ...

  15. KAROTENOID DARI MAKROALGAE DAN MIKROALGAE: POTENSI KESEHATAN APLIKASI DAN BIOTEKNOLOGI [Carotenoids from Macroalgae and Microalgae: Health Potential, Application and Biotechnology


    Leenawaty Limantara3); Budhi Prasetyo1); AB. Susanto2); Helly de Fretes1)*


    Algae, both micro and macroalgae, is one of the largest producers of carotenoids. The major composition of carotenoid on algae are β-carotene, astaxanthin, luthein, zeaxanthin, cryptoxanthin, and fucoxanthin which have important roles for human health. Carotenoids were produced by several microalgae species such as Dunaliella sallina, Haemotococcus pluvialis, Chlorella pyrenoidosa, Spirulina platensis, Nannnochloropsis oculata, and also from some macroalgae species such as Kappaphycus alvarez...

  16. Characterization of Various Biomass Feedstocks for Energy Production

    DEFF Research Database (Denmark)

    Toor, Saqib; Rosendahl, Lasse; Hoffmann, Jessica


    Biomass represents the renewable energy source and their use reduces the consumption of fossil fuels and limits the emission of CO2. In this work, various biomass feedstocks were assessed for assessing their suitability as energy production sources using thermochemical conversion routes especially...... hydrothermal liquefaction (HTL) process. The methods used to analyze involved performing proximate, ultimate and thermogravimetry analysis. On the basis of proximate, ultimate, and thermogravimetry analysis, the dried distiller grains with solubles (DDGS), corn silage, chlorella vulgaris, spirulina platensis...

  17. Análisis microscópico de muestras comerciales de Spirulina (Cyanophyta)


    Arenas, Patricia Marta; Cortella, Alicia Rita


    Se analizó el contenido de muestras comerciales de Spirulina (Cyanophytu), expendidas en el mercado como suplementos dietéticos y adelgazantes. Fueron observadas al microscopio fotónico y al microscopio electrónico de barrido (MEB), previo tratamiento por "freeze drying". Los resultados indican que todas contienen Spirulina platensis. En algunas de ellas esta especie se presenta pura, mientras que en otras se halla mezclada con otras Cyanophyta (Oscillatoria y Phormidium) debido probablemente...

  18. A espirulina: um novo modismo brasileiro




    A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis), microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros.

  19. A espirulina: um novo modismo brasileiro

    Directory of Open Access Journals (Sweden)

    Elizabeth Terãn

    Full Text Available A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis, microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros.

  20. Competitive biosorption of different forms of lead [Pb(NO 3 ) 2 and ...

    African Journals Online (AJOL)

    Spirulina platensis growth parameters [chlorophyll a (chl a) and dry-wet weight] effects on proline content, lead accumulation and the combined effect of the different forms of lead [Pb (NO3)2, Pb (CH3COO)2] and pH (6 to 8) were investigated for 192 h. The accumulation and form of lead were determined to be effective on ...

  1. Biotechnology in Georgia for Various Applications

    International Nuclear Information System (INIS)

    Mosulishvili, L.; Tsibakhashvili, N.; Kirkesali, E.; Tsertsvadze, L.; Frontasyeva, M.; Pavlov, S.


    The results of collaborative work carried out in the field of biotechnology at the Frank Laboratory of Neutron Physics (FLNP) of the Joint Institute for Nuclear Research (JINR) (Dubna, Russia) jointly with scientists from Georgia are presented. Using instrumental neutron activation analysis (NAA), significant results were ontained in the following directions - medical biotechnology, environmental biotechnology and industrial biotechnology. In the biomedical experiments a blue-green alga Spirulina platensis biomass has been used as a matrix for the development of pharmaceutical substances containing such vitally important trace elements as selenium, chromium and iodine. The feasibility of target-oriented introduction of these elements into Spirulina platensis biocomplexes retaining its protain composition and natural beneficial properties has been proved. The adsorption of such toxic metal as mercury by Spirulina platensis biomass in dynamics of growth has been studied also. NAA has been successfully applied to investigate the biotechnology of toxic Cr(VI) transformation into less toxic Cr(III) complexes by Cr(VI)-reducer bacteria isolated from polluted basalts in Georgia. This method was used to track accumulation of chromium in the bacterial cells. To monitor and identify Cr(III) complexes in these bacteria, electron spin resonance (ESR) spectrometry was employed. For the first time, the elemental composition of Cr(VI)-reducer bacteria has been studied using epithermal NAA. The natural organic mass of vegetal origin - peat - was applied as a source of microorganisms to study the bacterial leaching of some metals from lean ores, rocks and industrial wastes. (author)

  2. Influence of TiO2 Nanoparticles on Growth and Phenolic Compounds Production in Photosynthetic Microorganisms

    Directory of Open Access Journals (Sweden)

    Mattia Comotto


    Full Text Available The influence of titanium dioxide nanoparticles (pure anatase and 15% N doped anatase on the growth of Chlorella vulgaris, Haematococcus pluvialis, and Arthrospira platensis was investigated. Results showed that pure anatase can lead to a significant growth inhibition of C. vulgaris and A. platensis (17.0 and 74.1%, resp., while for H. pluvialis the nanoparticles do not cause a significant inhibition. Since in these stress conditions photosynthetic microorganisms can produce antioxidant compounds in order to prevent cell damages, we evaluated the polyphenols content either inside the cells or released in the medium. Although results did not show a significant difference in C. vulgaris, the phenolic concentrations of two other microorganisms were statistically affected by the presence of titanium dioxide. In particular, 15% N doped anatase resulted in a higher production of extracellular antioxidant compounds, reaching the concentration of 65.2 and 68.0 mg gDB-1 for H. pluvialis and A. platensis, respectively.

  3. Thermostable phycocyanin from the red microalga Cyanidioschyzon merolae, a new natural blue food colorant. (United States)

    Rahman, D Y; Sarian, F D; van Wijk, A; Martinez-Garcia, M; van der Maarel, M J E C


    The demand for natural food colorants is growing as consumers question the use of artificial colorants more and more. The phycobiliprotein C-phycocyanin of Arthospira platensis is used as a natural blue colorant in certain food products. The thermoacidophilic red microalga Cyanidioschyzon merolae might provide an alternative source of phycocyanin. Cyanidioschyzon merolae belongs to the order Cyanidiophyceae of the phylum Rhodophyta. Its natural habitat are sulfuric hot springs and geysers found near volcanic areas in, e.g., Yellowstone National Park in the USA and in Java, Indonesia. It grows optimally at a pH between 0.5 and 3.0 and at temperatures up to 56 °C. The low pH at which C . merolae grows minimizes the risk of microbial contamination and could limit production loss. As C . merolae lacks a cell wall, phycocyanin with a high purity number of 9.9 could be extracted by an osmotic shock using a simple ultrapure water extraction followed by centrifugation. The denaturation midpoint at pH 5 was 83 °C, being considerably higher than the A . platensis phycocyanin (65 °C). The C . merolae phycocyanin was relatively stable at pH 4 and 5 up to 80 °C. The high thermostability at slightly acidic pH makes the C . merolae phycocyanin an interesting alternative to A . platensis phycocyanin as a natural blue food colorant.

  4. Evaluación del comportamiento de vidrios lixiviados como nutrientes de algas

    Directory of Open Access Journals (Sweden)

    Natalia Grabska


    Full Text Available Se han preparado 3 vidrios con distinto contenido en SiO2 y de composición similar a los nutrientes necesarios para el crecimiento del alga Spirulina platensis. Se han escogido 2 fracciones con distinto tamaño de partícula para cada uno de los vidrios preparados y la cinética de lixiviación de dichos vidrios ha sido estudiada a través del análisis químico de las aguas de lixiviado, permitiendo obtener las curvas de velocidad para cada uno de los componentes del vidrio. A partir del cálculo de la constante de velocidad y del exponente de la reacción de lixiviado, se ha realizado una aproximación al crecimiento del alga Spirulina platensis en condiciones ambientales normales de luz, pH y temperatura y se ha obtenido que, a través de la modificación de la composición del vidrio de partida o de su tamaño de partícula, es posible ajustar el aporte de nutrientes al medio a la velocidad de crecimiento del alga Spirulina platensis.

  5. The effects of Hurricanes Katrina and Rita on seabed polycyclic aromatic hydrocarbon dynamics in the Gulf of Mexico. (United States)

    Mitra, Siddhartha; Lalicata, Joseph J; Allison, Mead A; Dellapenna, Timothy M


    To assess the extent to which Hurricanes Katrina and Rita affected polycyclic aromatic hydrocarbons (PAH) in the Gulf of Mexico (GOM), sediment cores were analyzed in late 2005 from: a shallow shelf, a deeper shelf, and a marsh station. Sediment geochronology, fabric, and geochemistry show that the 2005 storms deposited approximately 10cm of sediment to the surface of a core at 5-12A. Bulk carbon geochemistry and PAH isomers in this top layer suggest that the source of sediment to the top portion of core 5-12A was from a relatively more marine area. Particulate PAHs in the marsh core (04M) appeared unaffected by the storms while sediments in the core from Station 5-1B (deeper shelf) were affected minimally (some possible storm-derived deposition). Substantial amounts of PAH-laden particles may have been displaced from the seabed in shallow areas of the water column in the GOM by these 2005 storms.

  6. Review: Rusticle Formation on the RMS Titanic and the Potential Influence of Oceanography (United States)

    Salazar, Maxsimo; Little, Brenda


    Meter length iron-rich rusticles on the RMS Titanic contain bacteria that reportedly mobilize iron from the ship structure at a rate that will reduce the wreck to rust in decades. Other sunken ships, such as the World War II shipwrecks in the Gulf of Mexico (GOM) are also similarly covered. However, at the GOM sites, rusticles are only centimeters in length. Minimal differences in water temperature (a few °C) between the two sites and comparable exposure times from wreckage to discovery cannot rationalize the extreme differences in rusticle length. One possible explanation for the observed difference in rusticle size is the differing amounts of dissolved or colloidal iron at the two locations.

  7. Geophysical Data Define Boundaries and Sub-Regions of the Northern Gulf of Mexico Basin: Structural Histories and Causes are Hypothesized. (United States)

    Kinsland, G. L.


    Within the last several years new types of geophysical data of the southern margin of the North American Craton and the Northern Gulf of Mexico Basin (NGoMB) have become available, e.g., results from the USArray experiment, high resolution satellite gravity data of the GoM itself and new heat flow data. These data when combined with previously existing geophysical data (gravity, magnetic and seismic) and shallow structural data offer new insights into the boundaries and sub-regions of the NGoMB. I offer hypotheses for the development of the structures of the buried crust and upper mantle which cause these features. Of particular interest might be my suggestion that the NGoMB might have extended in a southeasterly direction prior to the counter-clockwise rotation of the Yucatan Peninsula which ultimately resulted in the GoM.

  8. Petroleum hydrocarbons in sediment from the northern Gulf of Mexico shoreline, Texas to Florida (United States)

    Rosenbauer, Robert J.; Campbell, Pamela L.; Lam, Angela; Lorenson, T.D.; Hostettler, Frances D.; Thomas, Burt; Wong, Florence L.


    Petroleum hydrocarbons were extracted and analyzed from shoreline sediment collected from the northern Gulf of Mexico (nGOM) coastline that could potentially be impacted by Macondo-1 (M-1) well oil. Sediment was collected before M-1 well oil made significant local landfall and analyzed for baseline conditions by a suite of diagnostic petroleum biomarkers. Oil residue in trace quantities was detected in 45 of 69 samples. With the aid of multivariate statistical analysis, three different oil groups, based on biomarker similarity, were identified that were distributed geographically along the nGOM from Texas to Florida. None of the sediment hydrocarbon extracts correlated with the M-1 well oil extract, however, the similarity of tarballs collected at one site (FL-18) with the M-1 well oil suggests that some oil from the Deepwater Horizon spill may have been transported to this site in the Florida Keys, perhaps by a loop current, before that site was sampled.

  9. The deepwater Gulf of Mexico : promises delivered?

    International Nuclear Information System (INIS)

    Pickering, D.R.


    A summary review of deepwater Gulf of Mexico (GOM) oil production was presented for the years 1989 to 1998. Trends and prospects in deepwater GOM production and leasing were assessed. Promises and forecasts made in the early 1990s were compared with what actually happened since then. Forecasts in the early 1990s promised deeper, faster and cheaper developments in the deepwater Gulf. Results of the comparison showed that the prognosticators were correct on all three counts. Regarding the future of the Gulf, one can be justified in being optimistic in so far as more experience, robust economics, more and cheaper rigs can be taken as reliable indicators of optimism. In contrast, there are certain negatives to consider, such as low commodity prices, budget constraints, lease expirations, technical challenges and increased competition. . 12 figs

  10. Deep-water oilfield development cost analysis and forecasting —— Take gulf of mexico for example (United States)

    Shi, Mingyu; Wang, Jianjun; Yi, Chenggao; Bai, Jianhui; Wang, Jing


    Gulf of Mexico (GoM) is the earliest offshore oilfield which has ever been developed. It tends to breed increasingly value of efficient, secure and cheap key technology of deep-water development. Thus, the analyze of development expenditure in this area is significantly important the evaluation concept of deep-water oilfield all over the world. This article emphasizes on deep-water development concept and EPC contract value in GoM in recent 10 years in case of comparison and selection to the economic efficiency. Besides, the QUETOR has been put into use in this research processes the largest upstream cost database to simulate and calculate the calculating examples’ expenditure. By analyzing and forecasting the deep-water oilfield development expenditure, this article explores the relevance between expenditure index and oil price.

  11. Ultrastructural analysis of small blood vessels in skin biopsies in CADASIL

    Directory of Open Access Journals (Sweden)

    Lačković Vesna


    Full Text Available Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL is an inherited small- and medium-artery disease of the brain caused by mutation of the Notch3 gene. Very often, this disease is misdiagnosed. We examined skin biopsies in two members of the first discovered Serbian family affected by CADASIL. Electron microscopy showed that skin blood vessels of both patients contain numerous deposits of granular osmiophilic material (GOM around vascular smooth muscle cells (VSMCs. We observed degeneration of VSMCs, reorganization of their cytoskeleton and dense bodies, disruption of myoendothelial contacts, and apoptosis. Our results suggest that the presence of GOM in small skin arteries represents a specific marker in diagnosis of CADASIL.

  12. Ocean Data Assimilation in the Gulf of Mexico Using 3D VAR Approach - Preliminary Results (United States)

    Paturi, S.; Garraffo, Z. D.; Cummings, J. A.; Rivin, I.; Mehra, A.; Kim, H. C.


    Approaches to ocean data assimilation vary widely, both in terms of the sophistication of the method and the observations assimilated.A three-dimensional variational (3DVAR) data assimilation system, part of the Navy Coupled Ocean Data Assimilation (NCODA) system developed at Navy Research Laboratory (NRL), is used for assimilating Sea Surface Temperature (SST) and Sea Surface Height (SSH) in the Gulf of Mexico (GoM). The NCODA 3DVAR produces simultaneous analyses of temperature, salinity, and vector velocity and uses all possible sources of ocean data observations.The Hybrid Coordinate Ocean Model (HYCOM) is used for the simulations, at 1/25o grid resolution for July 2011 period. After successful implementation of NCODA 3DVAR in the GoM, the system will be extended to the global ocean with the intent of making it operational.

  13. Historical polycyclic aromatic and petrogenic hydrocarbon loading in Northern Central Gulf of Mexico shelf sediments. (United States)

    Overton, E B; Ashton, B M; Miles, M S


    The distribution of selected hydrocarbons within ten dated sediment cores taken from the Mississippi River Bight off coastal Louisiana suggests a chronic contaminant loading from several sources including the river itself, oil and gas exploration in the central Gulf of Mexico (GOM) shelf area, and natural geologic hydrocarbon seeps. Data were grouped as either total polycyclic aromatic hydrocarbons (PAH's), which were indicative of pyrogenic PAH's; or estimated total hopanes (indicative of petrogenic hydrocarbons). The total PAH concentrations and estimated total hopanes begin increasing above background levels (approximately 200 ng g(-1)) after the 1950s. The distribution of these hydrocarbons and hopanes within the dated sediment cores suggests that the Mississippi River is a regional source of pyrogenic PAH's, and that the hopanes are from natural geologic hydrocarbon seeps, oil and gas exploration in the GOM, or both.

  14. An overview of atmospheric mercury monitoring at Auchencorth Moss, the UK EMEP Supersite in southern Scotland: trends, patterns and a source analysis

    Directory of Open Access Journals (Sweden)

    Kentisbeer J.


    Full Text Available Speciated atmospheric mercury has been measures semi-continuously at the Auchencorth Moss field site in southern Scotland since 2004. Here we present an analysis of the data from 2009 to 2011 for the three species: elemental, gaseous oxidized (GOM and particulate bound (PBM mercury. Measurements of elemental mercury were made using the Tekran 2537A analyser and the Tekran 1130 and 1135 speciation units were used to collect GOM and PBM respectively. The data shows no upward or downward trend for elemental mercury, with yearly average concentrations between 1.3 and 1.5 ng m-3. We will continue the work started in Kentisbeer et al, 2010 to analyse the effect of wind direction on the mercury species, making further of air mass back trajectories and introducing cluster analysis to investigate the effects of longer rangetransport to the site.

  15. Deepwater Horizon oil in Gulf of Mexico waters after 2 years: transformation into the dissolved organic matter pool. (United States)

    Bianchi, Thomas S; Osburn, Christopher; Shields, Michael R; Yvon-Lewis, Shari; Young, Jordan; Guo, Laodong; Zhou, Zhengzhen


    Recent work has shown the presence of anomalous dissolved organic matter (DOM), with high optical yields, in deep waters 15 months after the Deepwater Horizon (DWH) oil spill in the Gulf of Mexico (GOM). Here, we continue to use the fluorescence excitation-emission matrix (EEM) technique coupled with parallel factor analysis (PARAFAC) modeling, measurements of bulk organic carbon, dissolved inorganic carbon (DIC), oil indices, and other optical properties to examine the chemical evolution and transformation of oil components derived from the DWH in the water column of the GOM. Seawater samples were collected from the GOM during July 2012, 2 years after the oil spill. This study shows that, while dissolved organic carbon (DOC) values have decreased since just after the DWH spill, they remain higher at some stations than typical deep-water values for the GOM. Moreover, we continue to observe fluorescent DOM components in deep waters, similar to those of degraded oil observed in lab and field experiments, which suggest that oil-related fluorescence signatures, as part of the DOM pool, have persisted for 2 years in the deep waters. This supports the notion that some oil-derived chromophoric dissolved organic matter (CDOM) components could still be identified in deep waters after 2 years of degradation, which is further supported by the lower DIC and partial pressure of carbon dioxide (pCO2) associated with greater amounts of these oil-derived components in deep waters, assuming microbial activity on DOM in the current water masses is only the controlling factor of DIC and pCO2 concentrations.

  16. Oil-Spill Analysis: Gulf of Mexico Outer Continental Shelf (OCS) Lease Sales, Eastern Planning Area, 2003-2007 and Gulfwide OCS Program, 2003-2042 (United States)


    The Federal Government plans to offer U.S. Outer Continental Shelf (OCS) lands in the Eastern Planning Area of the Gulf of Mexico (GOM) for oil and gas leasing. This report summarizes results of that analysis, the objective of which was to estimate the risk of oil-spill contact to sensitive offshore and onshore environmental resources and socioeconomic features from oil spills accidentally occurring from the OCS activities.

  17. Structural Integrity Management for Fixed Offshore Platforms in Malaysia


    Narayanan Sambu Potty; Mohammad Kabir B. Mohd Akram


    Structural Integrity Management (SIM) is important for the protection of offshore crew, environment, business assets and company and industry reputation. API RP 2A contained guidelines for assessment of existing platforms mostly for the Gulf of Mexico (GOM). ISO 19902 SIM framework also does not specifically cater for Malaysia. There are about 200 platforms in Malaysia with 90 exceeding their design life. The Petronas Carigali Sdn Bhd (PCSB) uses the Asset Integrity Management ...

  18. Variational Data Assimilative Modeling of the Gulf of Maine Circulation in Spring and Summer 2010


    Li, Yizhen; He, Ruoying; Chen, Ke; McGillicuddy, Dennis J.


    A data assimilative ocean circulation model is used to hindcast the Gulf of Maine (GOM) circulation in spring and summer 2010. Using the recently developed incremental strong constraint 4D Variational data assimilation algorithm, the model assimilates satellite sea surface temperature and in situ temperature and salinity profiles measured by expendable bathythermograph, Argo floats, and shipboard CTD casts. Validation against independent observations shows that the model skill is significantl...

  19. Effect of Macondo Prospect 252 Oil on Microbiota Associated with Pelagic Sargassum in the Northern Gulf of Mexico. (United States)

    Torralba, Manolito G; Franks, James S; Gomez, Andres; Yooseph, Shibu; Nelson, Karen E; Grimes, D Jay


    The environmental impact of major oil spills on marine microorganisms has yet to be thoroughly investigated using molecular biology techniques. The Deepwater Horizon (DWH) drilling rig explosion of 2010 affected an approximately 176,000 km 2 surface area of the Gulf of Mexico (GOM) when an estimated 210 million gallons of oil from the Macondo Prospect spilled into the environment. Pelagic Sargassum, a complex of two surface drifting species (Sargassum natans and Sargassum fluitans) of marine brown macroalgae and a critically important habitat in the GOM ecosystem, was suffused by Macondo Prospect 252 oil released during the DWH event. Using 16S rRNA PCR and Roche 454 pyrosequencing, the effect of the oil on the bacterial population associated with pelagic Sargassum and contiguous waters was examined by comparing sequence data generated from samples collected from oiled and non-oiled locations in the northern GOM. Sequence data showed similar microbial composition in Sargassum regardless of exposure to oil primarily dominated by five phyla; Proteobacteria, Bacteroidetes, Actinobacteria, Verrucomicrobia, and unclassified bacteria. The microbial composition in water samples was significantly less diverse than for Sargassum and consisted primarily of Proteobacteria, Firmicutes, and Bacteroidetes. Due to the evenly distributed abundance of microbial species on oiled and non-oiled pelagic Sargassum, study findings indicate that DWH spilled oil had minimal effect on the composition and diversity of the microbial community associated with Sargassum and contiguous waters. However, higher abundances of Sulfitobacter and one species of Psychrobacter were found in oiled water samples when compared to non-oiled water samples indicating some effect of DHW oil in the microbial composition of seawater. Though there are a number of marine studies using molecular biology approaches, this is the first molecular examination of the impact of the DWH oil spill on bacterial communities

  20. Considerations for NATO Satellite Communications in the Post 2000 Era (Elements de Reflexion pour les Communications par Satellite dans les Pays Membres de l’OTAN apres l’An 2000), (United States)


    International Packet switching which allocates bandwith on a dynamic basis, Standards Organisation’s ( ISO ) Open System Interconnection has become the...SUPERBIRD (JAPAN) 1682E . ACSAT (AUSTRALIA) 164 6 F. ~ --- -- GALS (USSR) 170OW GOMS (USSR) 1868 f OSCSI11 DSCS III (LJS) 175W OSCS II. OSCS III (us) ISO W...or six catellites in highly elliptical 16-hour orbits 27003 km , titudei nave been considered, with a view to avoiding double-heading by arranging

  1. Parametric Adjustments to the Rankine Vortex Wind Model for Gulf of Mexico Hurricanes (United States)


    2012 4. TITLE AND SUBTITLE Parametric Adjustments to the Rankine Vortex Wind Model for Gulf of Mexico Hurricanes 5a. CONTRACT NUMBER 5b. GRANT ...may be used to construct spatially varying wind fields for the GOM region (e.g., Thompson and Cardone [12]), but this requires using a complicated...Storm Damage Reduc- tion, and Dredging Operations and Environmental Research (DOER). The USACE Headquarters granted permission to publish this paper

  2. Horizontal distribution of near-inertial waves in the western Gulf of Mexico: Eulerian vs Lagrangian. (United States)

    Pallas Sanz, E.; García-Carrillo, P.; Garcia Gomez, B. I.; Lilly, J. M.; Perez-Brunius, P.


    The time-average horizontal distribution of the near-inertial waves (NIWs) on the western Gulf of Mexico (GoM) is investigated using horizontal velocity data obtained from Lagrangian trajectories of 200 surface drifters drogued at 50m and deployed between September 2008 and September 2012. Preliminary results suggest maximum time-averaged near-inertial circle radius of 2.6km located in the southern Campeche bay near [22N,95W]; implying an inertial velocity of about 0.14m/s. Similar conclusions are delineated using horizontal velocity data obtained from 21 moorings deployed in the western GoM during the same time period. Maximum near-inertial kinetic energy and clockwise spectral energy is found in the mooring LNK3500 located at 21.850N and 94.028W. Maximum inertial circles measured with mooring data, however, are of about 1.6km leading to inertial currents of 0.087m/s, approximately a 40% smaller. This discrepancy seems to be due to the different depth level of the measurements and the bandwidth used to extract the near-inertial oscillations from the total flow. The time-average horizontal distributions of wind work computed from Lagrangian and Eulerian data are compared and they are not consistent with the time-averaged NIW field. The differences are not well understood but we speculate they may be due to the different time scales of wind fluctuations in the northwestern GoM compared to those observed in the Bay of Campeche, together with the change of sign of the background vorticity in the region; being negative (anticyclonic) in the northern GoM and positive (cyclonic) in the Bay of Campeche.

  3. Stable isotopes provide new insights into vestimentiferan physiological ecology at Gulf of Mexico cold seeps (United States)

    Becker, Erin Leigh; Macko, Stephen A.; Lee, Raymond W.; Fisher, Charles R.


    On the otherwise low-biomass seafloor of the Gulf of Mexico (GoM) continental slope, natural oil and gas seeps are oases of local primary production that support lush animal communities. Hundreds of seep communities have been documented on the continental slope, and nutrition derived from seeps could be an important link in the overall GoM food web. Here, we present a uniquely large and cohesive data set of δ13C, δ15N, and δ34S compositions of the vestimentiferan tubeworms Escarpia laminata and Lamellibrachia sp. 1, which dominate biomass at GoM seeps and provide habitat for hundreds of other species. Our sampling design encompassed an entire region of the GoM lower slope, allowing us for the first time to assess spatial variability in isotope compositions and to robustly address long-standing hypotheses about how vestimentiferans acquire and cycle nutrients over their long lifespan (200+ years). Tissue δ13C values provided strong evidence that larger adult vestimentiferans use their buried roots to take up dissolved inorganic carbon from sediment pore water, while very small individuals use their plume to take up carbon dioxide from the seawater. δ34S values were extremely variable among individuals of the same species within one location (<1 m2 area), indicating high variability in the inorganic sulfur pools on a very small spatial scale. This finding supports the hypothesis that vestimentiferans use their roots to cycle sulfate and sulfide between their symbionts and free-living consortia of sulfate-reducing archaea in the sediment. Finally, consistent differences in δ15N between two cooccurring vestimentiferan species provided the first strong evidence for partitioning of inorganic resources, which has significant implications for the ecology and evolution of this taxonomic group.

  4. Variation in concentrations of three mercury (Hg) forms at a rural and a suburban site in New York State. (United States)

    Choi, Hyun-Deok; Huang, Jiaoyan; Mondal, Sumona; Holsen, Thomas M


    Tekran® Hg speciation systems were used at a rural site (Huntington Forest, NY; HF) and a suburban site (Rochester, NY; ROC) to measure gaseous elemental mercury (GEM), gaseous oxidized mercury (GOM), and fine particulate-bound mercury (PBM2.5) concentrations for two years (December 2007 to November 2009). Ancillary data were also available from the New York State Department of Environmental Conservation and the United States Environmental Protection Agency Clean Air Status and Trends Network. Seasonal GEM concentrations were similar at both sites and influenced by factors such as the planet boundary layer (PBL) height and mercury emissions from snow, soil, and point sources. In some seasons, O3 was negatively correlated with GEM at ROC and positively correlated with GEM at HF. At HF, O3 was correlated with GOM and was typically higher in the afternoon. The cause of this pattern may be photochemical reactions during the day, and the GOM diel pattern may also be due to deposition which is enhanced by dew formation during the night and early morning. PBM2.5 concentrations were higher in winter at both sites. This is indicative of local wood combustion for space heating in winter, increased sorption to particles at lower temperatures, and lower PBL in the winter. At the suburban site, 2 of 12 events with enhanced GEM/CO ratios were poorly correlated with SO2/GOM, implying that these two events were due either to long range transport or regional metallurgical industries in Canada. Copyright © 2012 Elsevier B.V. All rights reserved.

  5. Single nucleotide polymorphisms in native South American Atlantic coast populations of smooth shelled mussels: hybridization with invasive European Mytilus galloprovincialis. (United States)

    Zbawicka, Małgorzata; Trucco, María I; Wenne, Roman


    Throughout the world, harvesting of mussels Mytilus spp. is based on the exploitation of natural populations and aquaculture. Aquaculture activities include transfers of spat and live adult mussels between various geographic locations, which may result in large-scale changes in the world distribution of Mytilus taxa. Mytilus taxa are morphologically similar and difficult to distinguish. In spite of much research on taxonomy, evolution and geographic distribution, the native Mytilus taxa of the Southern Hemisphere are poorly understood. Recently, single nucleotide polymorphisms (SNPs) have been used to clarify the taxonomic status of populations of smooth shelled mussels from the Pacific coast of South America. In this paper, we used a set of SNPs to characterize, for the first time, populations of smooth shelled mussels Mytilus from the Atlantic coast of South America. Mytilus spp. samples were collected from eastern South America. Six reference samples from the Northern Hemisphere were used: Mytilus edulis from USA and Northern Ireland, Mytilus trossulus from Canada, and Mytilus galloprovincialis from Spain and Italy. Two other reference samples from the Southern Hemisphere were included: M. galloprovincialis from New Zealand and Mytilus chilensis from Chile. Fifty-five SNPs were successfully genotyped, of which 51 were polymorphic. Population genetic analyses using the STRUCTURE program revealed the clustering of eight populations from Argentina (Mytilus platensis) and the clustering of the sample from Ushuaia with M. chilensis from Chile. All individuals in the Puerto Madryn (Argentina) sample were identified as M. platensis × M. galloprovincialis F2 (88.89%) hybrids, except one that was classified as Mediterranean M. galloprovincialis. No F1 hybrids were observed. We demonstrate that M. platensis (or Mytilus edulis platensis) and M. chilensis are distinct native taxa in South America, which indicates that the evolutionary histories of Mytilus taxa along the

  6. Renewable Electricity Grid Integration Roadmap for Mexico. Supplement to the IEA Expert Group Report on Recommended Practices for Wind Integration Studies

    Energy Technology Data Exchange (ETDEWEB)

    Parsons, Brian [Evergreen Renewable Consulting, Evergreen, CO (United States); Cochran, Jaquelin [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Watson, Andrea [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Katz, Jessica [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bracho, Ricardo [National Renewable Energy Laboratory (NREL), Golden, CO (United States)


    As a recognized leader in efforts to mitigate global climate change, the Government of Mexico (GOM) works proactively to reduce emissions, demonstrating strong political will and capacity to comprehensively address climate change. Since 2010, the U.S. government (USG) has supported these efforts by partnering with Mexico under the Enhancing Capacity for Low Emission Development Strategies (EC-LEDS) program. Through the program, the USG has partnered with Mexico’s Ministry of Energy (SENER), as well as other government agencies, to support GOM in reaching its clean energy and climate change goals. Specifically, the EC-LEDS program is supporting GOM’s clean energy goal of generating 35% of its electricity from renewable energy (RE) by 2024. EC-LEDS, through the U.S. Agency for International Development (USAID) and the U.S Department of Energy’s (DOE’s) National Renewable Energy Laboratory (NREL), has been collaborating with SENER and GOM interagency working group—the Consejo Consultivo para las Energías Renovables (Consultative Council on Renewable Energy)—to create a grid integration roadmap for variable RE. 1 A key objective in creating a grid integration roadmap is assessing likely impacts of wind and solar energy on the power system and modifying planning and operations accordingly. This paper applies best practices in conducting a grid integration study to the Mexican context.

  7. Controlling the reproducibility of Coulomb blockade phenomena for gold nanoparticles on an organic monolayer/silicon system. (United States)

    Caillard, L; Sattayaporn, S; Lamic-Humblot, A-F; Casale, S; Campbell, P; Chabal, Y J; Pluchery, O


    Two types of highly ordered organic layers were prepared on silicon modified with an amine termination for binding gold nanoparticles (AuNPs). These two grafted organic monolayers (GOMs), consisting of alkyl chains with seven or 11 carbon atoms, were grafted on oxide-free Si(111) surfaces as tunnel barriers between the silicon electrode and the AuNPs. Three kinds of colloidal AuNPs were prepared by reducing HAuCl4 with three different reactants: citrate (Turkevich synthesis, diameter ∼16 nm), ascorbic acid (diameter ∼9 nm), or NaBH4 (Natan synthesis, diameter ∼7 nm). Scanning tunnel spectroscopy (STS) was performed in a UHV STM at 40 K, and Coulomb blockade behaviour was observed. The reproducibility of the Coulomb behavior was analysed as a function of several chemical and physical parameters: size, crystallinity of the AuNPs, influence of surrounding surfactant molecules, and quality of the GOM/Si interface (degree of oxidation after the full processing). Samples were characterized with scanning tunneling microscope, STS, atomic force microscope, Fourier transform infrared spectroscopy, x-ray photoelectron spectroscopy (XPS), and high resolution transmission electronic microscope. We show that the reproducibility in observing Coulomb behavior can be as high as ∼80% with the Natan synthesis of AuNPs and GOMs with short alkyl chains.

  8. Novel Infection Site and Ecology of Cryptic Didymocystis sp. (Trematoda) in the Fish Scomberomorus maculatus. (United States)

    Schrandt, Meagan N; Andres, Michael J; Powers, Sean P; Overstreet, Robin M


    An undescribed, cryptic species of Didymocystis, as determined from sequences of 2 ribosomal genes and superficially similar to Didymocystis scomberomori ( MacCallum and MacCallum, 1916 ), infected the skin of the Spanish mackerel, Scomberomorus maculatus , in the north-central Gulf of Mexico (GOM). An analysis of 558 fish from 2011 to 2013 from Louisiana, Mississippi, Alabama, and the Florida panhandle showed the prevalence of the trematode varied both spatially and temporally but not with sex of the fish host. Month, year, and geographic location were identified by a negative binomial generalized linear model as indicators of the abundance and intensity of infection. Prevalence, abundance, and intensity of infection were greatest in spring and fall months off the Florida panhandle. Furthermore, the abundance and intensity of infection correlated negatively with fork length, weight, and gonad weight of mature fish but positively with longitude. Therefore, smaller adult fish tended to be more infected than larger adults, and prevalence and intensity increased from west to east (Louisiana to Florida). Spatial and temporal trends seemed to result from physical factors (e.g., water temperature, salinity, bottom type), but they also coincided with the annual migration of S. maculatus as fish moved northward along the GOM coastline from the southern tip of Florida in the spring months and returned in the fall, being present in the north-central GOM from late spring through fall. This pattern suggests the possibility that acquisition of infections occurred from a molluscan host in waters off the Florida panhandle.

  9. Development of task analysis method for operator tasks in main control room of an advanced nuclear power plant

    International Nuclear Information System (INIS)

    Lin Chiuhsiangloe; Hsieh Tsungling


    Task analysis methods provide an insight for quantitative and qualitative predictions of how people will use a proposed system, though the different versions have different emphases. Most of the methods can attest to the coverage of the functionality of a system and all provide estimates of task performance time. However, most of the tasks that operators deal with in a digital work environment in the main control room of an advanced nuclear power plant require high mental activity. Such mental tasks overlap and must be dealt with at the same time; most of them can be assumed to be highly parallel in nature. Therefore, the primary aim to be addressed in this paper was to develop a method that adopts CPM-GOMS (cognitive perceptual motor-goals operators methods selection rules) as the basic pattern of mental task analysis for the advanced main control room. A within-subjects experiment design was used to examine the validity of the modified CPM-GOMS. Thirty participants participated in two task types, which included high- and low-compatibility types. The results indicated that the performance was significantly higher on the high-compatibility task type than on the low-compatibility task type; that is, the modified CPM-GOMS could distinguish the difference between high- and low-compatibility mental tasks. (author)

  10. Drifter Observations of the Gulf of Maine Coastal Current. (United States)

    Manning, J P; McGillicuddy, D J; Pettigrew, N R; Churchill, J H; Incze, L S


    Two-hundred and twenty seven satellite-tracked drifters were deployed in the Gulf of Maine (GoM) from 1988 to 2007, primarily during spring and summer. The archive of tracks includes over 100,000 kilometers logged thus far. Statistics such as transit times, mean velocities, response to wind events, and preferred pathways are compiled for various areas of the coastal GoM. We compare Lagrangian flow with Eulerian estimates from near-by moorings and evaluate drifter trajectories using Ekman theory and 3-D ocean circulation models. Results indicate that the Gulf of Maine Coastal Current is a strong and persistent feature centered on the 94 ± 23 meter isobath, but that particles: a) deviate from the seasonal-mean core fairly regularly, and are often re-entrained; b) follow a slower (9 cm/s), less-constrained path in the western portion off the coast of Maine relative to the eastern (16 cm/s) section; and c) can be affected by wind events and small scale baroclinic structures. Residence times calculated for each ½ degree grid cell throughout the GoM depict some regions (Eastern Maine and Western Nova Scotia) as being relatively steady, flow-through systems, while others (Penobscot, Great South Channel) have more variable, branching pathways. Travel times for drifters that are retained within the coastal current along the entire western side of the Gulf of Maine are typically less than two months (55 days).

  11. Passive acoustic monitoring of beaked whale densities in the Gulf of Mexico. (United States)

    Hildebrand, John A; Baumann-Pickering, Simone; Frasier, Kaitlin E; Trickey, Jennifer S; Merkens, Karlina P; Wiggins, Sean M; McDonald, Mark A; Garrison, Lance P; Harris, Danielle; Marques, Tiago A; Thomas, Len


    Beaked whales are deep diving elusive animals, difficult to census with conventional visual surveys. Methods are presented for the density estimation of beaked whales, using passive acoustic monitoring data collected at sites in the Gulf of Mexico (GOM) from the period during and following the Deepwater Horizon oil spill (2010-2013). Beaked whale species detected include: Gervais' (Mesoplodon europaeus), Cuvier's (Ziphius cavirostris), Blainville's (Mesoplodon densirostris) and an unknown species of Mesoplodon sp. (designated as Beaked Whale Gulf - BWG). For Gervais' and Cuvier's beaked whales, we estimated weekly animal density using two methods, one based on the number of echolocation clicks, and another based on the detection of animal groups during 5 min time-bins. Density estimates derived from these two methods were in good general agreement. At two sites in the western GOM, Gervais' beaked whales were present throughout the monitoring period, but Cuvier's beaked whales were present only seasonally, with periods of low density during the summer and higher density in the winter. At an eastern GOM site, both Gervais' and Cuvier's beaked whales had a high density throughout the monitoring period.

  12. Large-scale deposition of weathered oil in the Gulf of Mexico following a deep-water oil spill. (United States)

    Romero, Isabel C; Toro-Farmer, Gerardo; Diercks, Arne-R; Schwing, Patrick; Muller-Karger, Frank; Murawski, Steven; Hollander, David J


    The blowout of the Deepwater Horizon (DWH) drilling rig in 2010 released an unprecedented amount of oil at depth (1,500 m) into the Gulf of Mexico (GoM). Sedimentary geochemical data from an extensive area (∼194,000 km 2 ) was used to characterize the amount, chemical signature, distribution, and extent of the DWH oil deposited on the seafloor in 2010-2011 from coastal to deep-sea areas in the GoM. The analysis of numerous hydrocarbon compounds (N = 158) and sediment cores (N = 2,613) suggests that, 1.9 ± 0.9 × 10 4 metric tons of hydrocarbons (>C9 saturated and aromatic fractions) were deposited in 56% of the studied area, containing 21± 10% (up to 47%) of the total amount of oil discharged and not recovered from the DWH spill. Examination of the spatial trends and chemical diagnostic ratios indicate large deposition of weathered DWH oil in coastal and deep-sea areas and negligible deposition on the continental shelf (behaving as a transition zone in the northern GoM). The large-scale analysis of deposited hydrocarbons following the DWH spill helps understanding the possible long-term fate of the released oil in 2010, including sedimentary transformation processes, redistribution of deposited hydrocarbons, and persistence in the environment as recycled petrocarbon. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  13. A MITgcm/DART ensemble analysis and prediction system with application to the Gulf of Mexico

    KAUST Repository

    Hoteit, Ibrahim


    This paper describes the development of an advanced ensemble Kalman filter (EnKF)-based ocean data assimilation system for prediction of the evolution of the loop current in the Gulf of Mexico (GoM). The system integrates the Data Assimilation Research Testbed (DART) assimilation package with the Massachusetts Institute of Technology ocean general circulation model (MITgcm). The MITgcm/DART system supports the assimilation of a wide range of ocean observations and uses an ensemble approach to solve the nonlinear assimilation problems. The GoM prediction system was implemented with an eddy-resolving 1/10th degree configuration of the MITgcm. Assimilation experiments were performed over a 6-month period between May and October during a strong loop current event in 1999. The model was sequentially constrained with weekly satellite sea surface temperature and altimetry data. Experiments results suggest that the ensemble-based assimilation system shows a high predictive skill in the GoM, with estimated ensemble spread mainly concentrated around the front of the loop current. Further analysis of the system estimates demonstrates that the ensemble assimilation accurately reproduces the observed features without imposing any negative impact on the dynamical balance of the system. Results from sensitivity experiments with respect to the ensemble filter parameters are also presented and discussed. © 2013 Elsevier B.V.

  14. Extracting quasi-steady Lagrangian transport patterns from the ocean circulation: An application to the Gulf of Mexico. (United States)

    Duran, R; Beron-Vera, F J; Olascoaga, M J


    We construct a climatology of Lagrangian coherent structures (LCSs)-the concealed skeleton that shapes transport-with a twelve-year-long data-assimilative simulation of the sea-surface circulation in the Gulf of Mexico (GoM). Computed as time-mean Cauchy-Green strain tensorlines of the climatological velocity, the climatological LCSs (cLCSs) unveil recurrent Lagrangian circulation patterns. The cLCSs strongly constrain the ensemble-mean Lagrangian circulation of the instantaneous model velocity, showing that a climatological velocity can preserve meaningful transport information. The quasi-steady transport patterns revealed by the cLCSs agree well with aspects of the GoM circulation described in several previous observational and numerical studies. For example, the cLCSs identify regions of persistent isolation, and suggest that coastal regions previously identified as high-risk for pollution impact are regions of maximal attraction. We also show that cLCSs are remarkably accurate at identifying transport patterns observed during the Deepwater Horizon and Ixtoc oil spills, and during the Grand LAgrangian Deployment (GLAD) experiment. Thus it is shown that computing cLCSs is an efficient and meaningful way of synthesizing vast amounts of Lagrangian information. The cLCS method confirms previous GoM studies, and contributes to our understanding by revealing the persistent nature of the dynamics and kinematics treated therein.

  15. Materials and boiler rig testing to support chemical cleaning of once-through AGR boilers

    International Nuclear Information System (INIS)

    Tice, D.R.; Platts, N.; Raffel, A.S.; Rudge, A.


    An extensive programme of work has been carried out to evaluate two candidate inhibited cleaning solutions for possible implementation on plant, which would be the first chemical clean of an AGR boiler. The two candidate cleaning solutions considered were a Stannine-inhibited citric acid/formic acid mixture (GOM106) and inhibited hydrofluoric acid. Citric acid-based cleaning processes are widely used within the UK Power Industry. The GOM106 solution, comprising a mixture of 3% citric acid, 0.5% formic acid and 0.05% Stannine LTP inhibitor, buffered with ammonia to pH 3.5, was developed specifically for the AGR boilers during the 1970's. Although a considerable amount of materials testing work was carried out by British Energy's predecessor companies to produce a recommended cleaning procedure there were some remaining concerns with the use of GOM106, from these earlier studies, for example, an increased risk of pitting attack associated with the removal of thick 9Cr oxide deposits and a risk of unacceptable damage in critical locations such as the upper transition joints and other weld locations. Hence, additional testing was still required to validate the solution for use on plant. Inhibited hydrofluoric acid (HFA) was also evaluated as an alternative reagent to GOM106. HFA has been used extensively for cleaning mild and low'alloy steel boiler tubes in fossil-fired plant in the UK and elsewhere in Europe and is known to remove oxide quickly. Waste treatment is also easier than for the GOM106 process and some protection against damage to the boiler tube materials is provided by complexing of fluoride with ferric ion. Validation of the potential reagents and inhibitors was achieved by assessing the rate and effectiveness of oxide removal from specimens of helical boiler tubing and welds, together with establishing the extent of any metal loss or localised damage. The initial materials testing resulted in the inhibited ammoniated citric / formic acid reagent being

  16. Seismic Interferometry of Gulf of Mexico Basin Opening (GUMBO) Data: Extraction of Body and Surface Waves with a Mixed-Mode Array (United States)

    Thangraj, J. S.; Quiros, D.; Pulliam, J.


    The Gulf of Mexico (GoM) is a relative small oceanic basin that formed by rifting between the continental blocks of North America and Yucatan in the Middle to Late Jurassic. Following the breakup, seafloor spreading continued until the Early Cretaceous. Since then, subsidence and sedimentation have shaped the GoM margin that we see today. To better understand the opening of the GoM, a long-offset (307 km) seismic refraction line was acquired in 2010. The transect was located on the northwest GoM margin, and consisted of several types of instruments. This mixed-mode array combined 31 ocean bottom seismographs (OBS), 412 high-frequency instruments (4.5 Hz geophones with RefTek 125A "Texan" digitizers) and 12 broadband stations. The R/V Iron Cat provided the airgun source used in the refraction experiment. The airgun generated 2028 shots in a period of 2.5 days which were recorded by the entire array. The airgun-generated seismic energy was clearly visible on the OBS recordings, however its amplitude was too low to be discerned on most of the onshore stations. In fact, this energy was only visible on Texan stations 1-50 (station 1 is located at the coast), extending 18 km inland, limiting the extend of the velocity model that can be obtained. Here, we apply seismic interferometry techniques to the 2.5 days of continuous data recorded by the Texan array with the goal of extending the spatial range for which the airgun-generated seismic energy can be observed. Preliminary results show that by treating the 2.5 days of continuously recorded airgun data as ambient noise, and applying time-domain cross-correlation, we can observe energy propagating 50 to 70 km inland with apparent velocities of 1800 - 2200 ms-1. These velocities agree with the compressional seismic velocity for the top 5 km of sediments under the GoM obtained from the OBS records, suggesting that we are observing compressional energy in the virtual source gathers (VSG). We also observe arrivals in the VSG

  17. Ground-Penetrating Radar Study of Fort Morgan Peninsula Holocene Beach Ridges as Sea-level Indicators (United States)

    Philbin, A.; Frederick, B.; Blum, M. D.; Tsoflias, G. P.


    Holocene sea-level change along the northern Gulf of Mexico (GoM) coast is controversial. One view interprets basal peats from the Mississippi Delta to indicate continual sea-level (SL) rise for the GoM as a whole. An alternate view proposes that data from the subsiding delta is primarily a subsidence signal, and that sandy non-deltaic shorelines indicate that regional SL reached present elevations by the middle Holocene, with minor oscillations since then. In fact, new regional long-term subsidence records from biostratigraphic indicators display significant subsidence in deltaic areas where basal-peat data were collected, and negligible rates along the GoM shoreline to the east. However, the use of sandy progradational shorelines, commonly known as "beach ridge systems", has been criticized for a lack of precise sea-level indicators, and therefore discounted. This research focuses on developing Holocene progradational sandy shorelines along the Alabama coast in the eastern GoM as SL indicators. Sandy shorelines in this area are ideal to examine SL change because they are well preserved, sufficiently distant from the subsiding delta, well mapped, and ages are known from previous work. Two-dimensional ground-penetrating radar imaging of well-dated beach-ridge successions is used here to examine and identify changes through time in the elevation of the shoreface clinoform topset-foreset break, which represents the transition between flat-lying foreshore and seaward-dipping shoreface facies, and forms in the intertidal zone. Beach-ridge successions with optical luminescence ages of ca. 5500-4800 yrs BP display topset-foreset breaks at current mean sea-level elevation, whereas beach-ridge successions from ca. 3500-2400 yrs BP display topset-foreset breaks that are 1 m above present mean SL and the elevation of modern topset-foreset breaks. These data support the view that current sea-level was reached by the middle Holocene, and was higher than present for at least

  18. Effect of Light Intensities and Atmospheric Gas Conditions on Biohydrogen Production of Microalgae Isolated from Fisheries Wastewater

    Directory of Open Access Journals (Sweden)

    Mujalin Pholchan


    Full Text Available Recently, the fishery farming industry has been developed rapidly due to increasing demand and consumption as well as the depletion of wild fish resources. Production processes in the industry usually generate large amounts of wastewater containing high nutrients, posing a threat to downstream water. However, phytoplankton removal techniques commonly used to counteract the threat, though appearing to have low efficiency, are timeconsuming and less sustainable. Microalgae are photosynthetic microorganisms that convert solar energy into hydrogen. Using the isolated algae from fish farms as a source of renewable energy production could be a promising choice for handling fisheries wastewater in a more efficient manner. However, hydrogen production processes from algae still need more studies as their efficiencies vary between algae species and growth factors. In this work, the efficiency of hydrogen production from Scenedesmus accuminatus and Arthrospira platensis harvested from fish farms under three different light intensity conditions and three atmospheric gas conditions was determined. The results showed that the best conditions for hydrogen production from both species included 24 h darkness and carbon dioxide addition. Under the atmospheric gas combination of 99% argon and 1% carbon dioxide, S. accuminatus could produce hydrogen gas as high as 0.572 mol H2/mgCh h within 12 h, while the highest hydrogen production (0.348 mol H2/mgCh h obtained from A. platensis was found under the atmospheric gas mixture of 98% argon and 2% carbon dioxide. Interestingly, S. accuminatus appeared to produce more hydrogen than A. platensis under the same conditions.

  19. Application of Low cost Spirulina growth medium using Deep sea water (United States)

    Lim, Dae-hack; Kim, Bong-ju; Lee, Sung-jae; Choi, Nag-chul; Park, Cheon-young


    Deep-sea water has a relatively constant temperature, abundant nutrients such as calcium, magnesium, nitrates, and phosphates, etc., and stable water quality, even though there might be some variations of their compositions according to collection places. Thus, deep-sea water would be a good substrate for algal growth and biomass production since it contains various nutrients, including a fluorescent red pigment, and β-carotene, etc. The aim of this study was to investigate the economics of a culture condition through comparative analysis to Spirulina platensis growth characteristic under various medium conditions for cost-effective production of Spirulina sp.. Growth experiments were performed with S. platensis under various culture medium conditions (deep sea water + SP medium). Growth tests for culture medium demonstrated that the deep sea water to SP medium ratio of 50:50(W/W) was effective in S. platensis with the maximum biomass (1.35g/L) and minimum medium making cost per production mass (133.28 KRW/g). Parameter estimation of bio-kinetics (maximum growth rate and yield) for low cost medium results showed that the maximum growth rate and yield of N, P, K were obtained under deep sea water to SP medium ratio of 50:50(W/W) of 0.057 1/day and 0.151, 0.076, 0.123, respectively. Acknowledgment : "This research was a part of the project titled 'Development of microalgae culture technique for cosmetic materials based on ocean deep sea water(20160297)', funded by the Ministry of Oceans and Fisheries, Korea."

  20. Fouling community dominated by Metridium senile (Cnidaria: Anthozoa: Actiniaria in Bahía San Julián (southern Patagonia, Argentina

    Directory of Open Access Journals (Sweden)

    Juan Pablo Martin


    Full Text Available The objective of this study is to provide information about a harbour-fouling community dominated by Metridium senile in southern Patagonia. Several steel tubes from the wharf of Puerto San Julián were extracted to perform repair tasks, allowing the attached benthic community to be studied. Sampling was conducted at three levels: lower intertidal, 3-4 m depth and 6-7 m depth. In the lower intertidal, M. senile had a relative abundance of 43%, the most abundant accompanying species being Perumytilus purpuratus, Mytilus edulis platensis and Aulacomya atra atra. At subtidal level, the anemone showed relative abundances of 64% and 65%, and was accompanied by Monocorophium insidiosum at 3-4 m depth and by polychaetes of families Sabellidae and Syllidae at 6-7 m at depth. In the lower intertidal, epibiosis was more frequent on P. purpuratus, A. atra atra and M. edulis platensis, while in the subtidal, the richness of substrate-organisms increased significantly and the anemone was fixed to A. atra atra, M. edulis platensis, Paramolgula gregaria, Crepipatella dilatata, Austromegabalanus psittacus, Hiatella arctica, Polyzoa opuntia, Pyura sp. and Sabellidae tubes. The ability of M. senile to settle on many different organisms, along with other strategies, makes it a colonizer able to displace other species that could compete with it for substratum. Given the cosmopolitan nature of M. senile, the fact that this species has not been previously reported in the coastal zone of the region, and the results of our study, we discuss the possibility that this sea anemone is an invasive alien species in southern Patagonia, or at least a cryptogenic species.

  1. Bioconversion of poultry droppings for biogas and algal production

    Energy Technology Data Exchange (ETDEWEB)

    Mahadevaswamy, M.; Venkataraman, L.V.


    An integrated system for the bioconversion of poultry droppings for biogas production and utilization of the effluent for the production of the blue-green alga Spirulina platensis was studied. Poultry droppings produced 0.54 cubic m of biogas per kilogran of Total Solids (TS). The 2% TS biogas plant effluent as sole nutrient medium for Spirulina yielded 7-8 g dry algae a day. The biomass was harvested by filtration. The sundried algal biomass has been used as a poultry feed component. In economic terms the system appears promising. 18 references.

  2. Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

    Directory of Open Access Journals (Sweden)

    Koh Yih Yih


    Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

  3. Microelement composition of the herbs with hypoglycemic and tonic actions

    International Nuclear Information System (INIS)

    Babaev, T.A.; Ibragimova, E.A.; Nazirova, E.R.; Samarkhodjaeva, N.R.; Nalbandyan, A.A.


    Full text: Diabetes mellitus is a heavy disease with complex neuroendocrinal pathogenesis, which disturbs all stages of metabolism, including exchange of microelements. A significant role in pathogenesis of diabetes mellitus is given to copper, zinc, chromium, manganese - microelements directly participating in carbohydrate exchange. Usage of microelements in medicine as inorganic salts has not found a wide application. It is known, that the majority of vitaminous-mineral complexes represent a mechanical mix of artificial vitamins and microelements. The available facts testify that such inorganic forms of minerals are poorly assimilated by an organism, and moreover can block the assimilation of organic forms, what results in a gradual increase of deficiency in these microelements in organism. Scientists know around 300 plants possessing hypoglycemising effect to a greater or lesser extent. Using the method of neutron-activation analysis we have investigated the microelement composition of some of herbs possessing hypoglycemising and tonic action. On the basis of these data our group has developed the structure of a phytocompound, which includes 15 components, Spirulina platensis and mumiyo containing the balanced amount of easily assimilated organically connected minerals. The analysis of received data shows, that the developed phytocompound contains significant amount of Mn, Cu, Zn and in smaller amounts Co. Calculations show, that the daily need of an organism for copper, manganese, zinc and iodine is completely satisfied by the phytocompound. The data on analysis of element structure of Spirulina platensis and mumiyo evidence the presence of a wide spectrum of the majority of microelements in these preparations, and the content of copper and manganese in Spirulina platensis exceeds their content in mumiyo 1,5-2 times, and the presence of chromium is almost 20 times higher. The complex of the developed phytocompound, Spirulina platensis and mumiyo is suggested

  4. Application of some microorganisms for synthesis of gold and silver nanoparticles

    International Nuclear Information System (INIS)

    Frontas'eva, M.V.; Pavlov, S.S.; Zinicovscaia, I.I.; Kirkesali, E.I.; Kalabegishvili, T.; Murusidze, I.; Faanhof, A.


    In recent years, much attention has been paid to microbial technologies of nanoparticle production. Novel strains of actinomycetes Streptomyces glaucus 71 MD, Streptomyces spp. 211A, arthrobacter genera - Arthrobacter globiformis 151B and Arthrobacter oxydans 61B and blue-green microalga Spirulina platensis were used for synthesis of silver and gold nanoparticles. The studies were carried out using scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDAX), transmission electron microscopy (TEM), X-ray diffraction (XRD), atomic absorption spectrometry (AAS), and neutron activation analysis (NAA)

  5. Bioleaching of UO22+ ions from poor uranium ores by means of cyanobacteria

    International Nuclear Information System (INIS)

    Cecal, A.; Humelnicu, D.; Popa, K.; Palamaru, I.; Nemtoi, G.; Rudic, V.; Gulea, A.


    Uranium (VI) leaching, as uranyl ions, from ores with a poor content in util minerals, using some algae as: Porphyridium cruentum (Smith and Soerly) Naegeli, Spirulina platensis CNM-CB-02 and Nostoc linkia (Roth) Born and Flah was studied. The basic composition of these ores allowed the self-maintenance and self-development of these microorganisms, which have facilitated then the leaching of the uranium (VI) as UO 2 2+ ions. The microbial leaching degree was comprised between 40-90%, depending on the used alga and experimental conditions. (author)

  6. Determination of the elemental composition of cyanobacteria cells and cell fractions by atomic emission and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Sedykh, Eh.M.; Lyabusheva, O.A.; Bannykh, L.N.; Tambiev, A.Kh.


    An approach to studying the elemental composition of cyanobacteria Spirulina platensis and Nostoc commune using a set of complementary analytical methods (ICP-AES, PAAS, and ETAAS) was proposed . The procedures were adapted for the determination of macro- and microelements (Na, K, Mg, Ca, Fe, Mn, Cu, Mo, Zn, B, and Se) in the biomass of cyanobacteria and separated cell fractions (chloroform and water-methanol extracts and precipitates). The conditions for the mineralization of biological materials were optimized for autoclave and microwave sample preparation procedures. The evaporation and atomization of Se and Mo in a graphite furnace in the presence of chloroform and methanol were studied [ru

  7. Contribution to the knowledge of pathogenic fungi of spiders in Argentina. Southernmost record in the world. (United States)

    Manfrino, Romina G; González, Alda; Barneche, Jorge; Tornesello Galván, Julieta; Hywell-Jones, Nigel; López Lastra, Claudia C

    The aim of this study was to identify entomopathogenic fungi infecting spiders (Araneae) in a protected area of Buenos Aires province, Argentina. The Araneae species identified was Stenoterommata platensis. The pathogens identified were Lecanicillium aphanocladii Zare & W. Gams, Purpureocillium lilacinum (Thom) Luangsa-ard, Houbraken, Hywel Jones & Samson and Ophiocordyceps caloceroides (Berk & M.A. Curtis). This study constitutes the southernmost records in the world and contributes to expanding the knowledge of the biodiversity of pathogenic fungi of spiders in Argentina. Copyright © 2016 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  8. Redescriptions of two species of Lepeophtheirus (Copepoda, Siphonostomatoida, Caligidae parasitic on teleost marine fishes from the coastal zone of the State of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    José Luis Luque


    Full Text Available Two species of Lepeophtheirus Nordmann, 1832 parasitic on the ariid fish Netuma barba Lacépède, 1803, and the bothiid fish Paralichthys sp. from the coastal zone of the State of Rio de Janeiro, are redescribed and illustrated: L. bagri Dana, 1852, and L. monacanthus Heller, 1865. New junior synonyms for these species are proposed: L. marginatus syn.n., L. christianensis syn.n. and L. platensis syn.n. of L. bagri and L. unispinosus syn.n. of L. monacanthus.

  9. Microelement composition of the herbs with hypoglycemic and tonic actions

    Energy Technology Data Exchange (ETDEWEB)

    Babaev, T A; Ibragimova, E A; Nazirova, E R; Samarkhodjaeva, N R; Nalbandyan, A A [Institute of Biochemistry, Tashkent (Uzbekistan)


    Full text: Diabetes mellitus is a heavy disease with complex neuroendocrinal pathogenesis, which disturbs all stages of metabolism, including exchange of microelements. A significant role in pathogenesis of diabetes mellitus is given to copper, zinc, chromium, manganese - microelements directly participating in carbohydrate exchange. Usage of microelements in medicine as inorganic salts has not found a wide application. It is known, that the majority of vitaminous-mineral complexes represent a mechanical mix of artificial vitamins and microelements. The available facts testify that such inorganic forms of minerals are poorly assimilated by an organism, and moreover can block the assimilation of organic forms, what results in a gradual increase of deficiency in these microelements in organism. Scientists know around 300 plants possessing hypoglycemising effect to a greater or lesser extent. Using the method of neutron-activation analysis we have investigated the microelement composition of some of herbs possessing hypoglycemising and tonic action. On the basis of these data our group has developed the structure of a phytocompound, which includes 15 components, Spirulina platensis and mumiyo containing the balanced amount of easily assimilated organically connected minerals. The analysis of received data shows, that the developed phytocompound contains significant amount of Mn, Cu, Zn and in smaller amounts Co. Calculations show, that the daily need of an organism for copper, manganese, zinc and iodine is completely satisfied by the phytocompound. The data on analysis of element structure of Spirulina platensis and mumiyo evidence the presence of a wide spectrum of the majority of microelements in these preparations, and the content of copper and manganese in Spirulina platensis exceeds their content in mumiyo 1,5-2 times, and the presence of chromium is almost 20 times higher. The complex of the developed phytocompound, Spirulina platensis and mumiyo is suggested

  10. Gamma radiodecontamination of natural products uses in Cuban pharmaceutical industry

    International Nuclear Information System (INIS)

    Rodriguez, M.; Lopez, M.; Guerra, M.; Lastra, H.; Prieto, E.; Padron, E.


    The aim of the present paper was to carry out the gamma radiodecontamination of industrial productions from there medicinal plant species (C. officinalis, P. incarta and M. recuttia) and two pharmaceuticals forms (S. platensis and bee pollen tabs) which presented high levels of microbiological count. Adequate irradiation doses calculated for each product were used in decontamination. The results obtained showed the effectiveness of the process in the elimination of microbial contamination from theses natural products. No changes in nutritional constituents or physico-chemical properties were observed

  11. A espirulina: um novo modismo brasileiro


    Terãn, Elizabeth


    A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis), microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros. The author presents a series of figures referents to morphology, culture, process of manufacture, chemical composition and uses of spiruline, a blue-gre...

  12. Neutron activation analysis for development of mercury sorbent based on blue-green alga salipriina palatinates

    International Nuclear Information System (INIS)

    Frontasyeva, M.V.; Kirkesali, E.I.; Aksenova, N.G.; Mosulishvili, L.M.; Belokobylsky, A.I.; Khizanishvili, A.I.


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamic of accumulation of Hg was investigated over days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was / out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations ∼ 100 μg/1

  13. Optimization of a process for high fibre and high protein biscuit. (United States)

    Singh, Parul; Singh, Rakhi; Jha, Alok; Rasane, Prasad; Gautam, Anuj Kumar


    Biscuits are popular and convenient food products due to their ready to eat nature. Biscuits were prepared from sorghum and whole wheat flour with the addition of spirulina (Spirulina platensis) powder to produce high fibre and high protein biscuit. Levels of ingredients in biscuits such as spirulina powder, sorghum flour and guar gum were optimized using response surface methodology (RSM) for its sensory, textural and antioxidant attributes. Sensory attributes as colour intensity (R2 = 0.89, P powder and sorghum flour was found to have significant effect on the responses.

  14. Hydrothermal liquefaction of microalgae's for bio oil production

    DEFF Research Database (Denmark)

    Toor, Saqib; Reddy, Harvind; Deng, Shuguang

    process water for algae cultivation. GC-MS, elemental analyzer, calorimeter and nutrient analysis were used to analyze bio-crude, lipid-extracted algae and water samples produced in the hydrothermal liquefaction process. The highest bio-oil yield of 46% was obtained on Nannochloropsis salina at 310 °C...... and 107 bar. For Spirulina platensis algae sample, the highest bio-oil yield is 38% at 350 °C and 195 bar. Preliminary data also indicate that a lipid-extracted algae solid residue sample obtained in the hydrothermal liquefaction process contains a high level of proteins...

  15. Estudio de las propiedades fisicoquímicas y sensoriales de esferas de microalgas.




    [ES] En el presente trabajo se estudia el proceso de elaboración de un nuevo producto alimentario utilizando como base dos tipos diferentes de microalgas -Chlorella vulgaris y Arthrospira platensis-, elegidas debido a los beneficios que proporcionan sus propiedades a la salud humana. Además, estos beneficios se ven incrementados mediante la incorporación de batidos naturales a la formulación final del producto. Estos batidos están compuestos por una combinación de frutas y verd...

  16. Riverine export of dissolved organic carbon to the Gulf of Maine (United States)

    Huntington, T. G.; Aiken, G.


    Land-to-sea carbon transport of dissolved organic carbon (DOC) is an important part of the carbon cycle that can affect long-term carbon sequestration, satellite-derived ocean color metrics, and ocean primary productivity and biogeochemistry. Using continuous discharge data and discrete sampling we estimated DOC fluxes from rivers covering about 68% of the watershed that drains to the Gulf of Maine (GoM) for water years (October through September) 2011 and 2012. Estimates for rivers entering the GoM in the USA were made using LOADEST regression software that fits a seasonally-adjusted concentration discharge relation to the data. The basin area-weighted 95% confidence limits about the LOADEST mean fluxes averaged 8.1% for the lower limit and 8.9% for the upper limit. Estimates for rivers entering the GoM in Canada were obtained from previously published estimates. Carbon yield tends to increase from southwest (35 to 36 kg C/ha/yr) to a maximum of 76 kg C/ha/yr for the Penobscot River and then decline further to the northeast (61 kg C/ha/yr in the St. John River and 41 kg C/ha/yr in the rest of New Brunswick and Nova Scotia). The area-weighted average carbon yield for all measured basins was 54.5 kg C/ha/yr. The variation in carbon yield is most closely associated with the amount of runoff and wetland area within a river basin. Simple area-weighted extrapolation to the entire GoM basin resulted in an estimate of 9.8 x 105 metric tons C per year for the WY2011 and WY2012 period. Runoff is the dominant control on intra and inter-annual variation in DOC flux because runoff varies much more than DOC concentration at these temporal scales. Runoff is usually low during the winter, peaks in the spring during snowmelt, decreases to a minimum in late summer and increases again in the fall when transpiration decreases. DOC concentration is low during the winter and snowmelt-dominated spring period, generally increases through the summer, and peaks during the fall. DOC flux to

  17. Species distribution and population connectivity of deep-sea mussels at hydrocarbon seeps in the Gulf of Mexico.

    Directory of Open Access Journals (Sweden)

    Baptiste Faure

    Full Text Available Hydrocarbon seepage is widespread and patchy in the Gulf of Mexico, and six species of symbiont containing bathymodiolin mussels are found on active seeps over wide and overlapping depth and geographic ranges. We use mitochondrial genes to discriminate among the previously known and a newly discovered species and to assess the connectivity among populations of the same species in the northern Gulf of Mexico (GoM. Our results generally validate the morphologically based distribution of the three previously known GoM species of Bathymodiolus, although we found that approximately 10% of the morphologically based identifications were incorrect and this resulted in some inaccuracies with respect to their previously assigned depth and geographical distribution patterns. These data allowed us to confirm that sympatry of two species of Bathymodiolus within a single patch of mussels is common. A new species of bathymodiolin, Bathymodiolus sp. nov., closely related to B. heckerae was also discovered. The two species live at the same depths but have not been found in sympatry and both have small effective population sizes. We found evidence for genetic structure within populations of the three species of Bathymodiolinae for which we had samples from multiple sites and suggest limited connectivity for populations at some sites. Despite relatively small sample sizes, genetic diversity indices suggest the largest population sizes for B. childressi and Tamu fisheri and the smallest for B. heckerae and B. sp. nov. among the GoM bathymodiolins. Moreover, we detected an excess of rare variants indicating recent demographic changes and population expansions for the four species of bathymodiolins from the Gulf of Mexico.

  18. The role of meltwater-induced subsurface ocean warming in regulating the Atlantic meridional overturning in glacial climate simulations

    Energy Technology Data Exchange (ETDEWEB)

    Brady, Esther C.; Otto-Bliesner, Bette L. [National Center for Atmospheric Research, Boulder, CO (United States)


    The Community Climate System Model version 3, (CCSM3) is used to investigate the effect of the high latitude North Atlantic subsurface ocean temperature response in idealized freshwater hosing experiments on the strength of the Atlantic meridional overturning circulation (AMOC). The hosing experiments covered a range of input magnitudes at two locations in a glacial background state. Subsurface subpolar ocean warms when freshwater is added to the high latitude North Atlantic (NATL cases) and weakly cools when freshwater is added to the Gulf of Mexico (GOM cases). All cases show subsurface ocean warming in the Southern Hemisphere (SH). The sensitivity of the AMOC response to the location and magnitude of hosing is related to the induced subsurface temperature response, which affects the magnitude of the large-scale meridional pressure gradient at depth through the effect on upper ocean density. The high latitude subsurface warming induced in the NATL cases lowers the upper ocean density in the deepwater formation region enhancing a density reduction by local freshening. In the GOM cases the effect of SH warming partially offsets the effect of the high latitude freshening on the meridional density gradient. Following the end of hosing, a brief convective event occurs in the largest NATL cases which flushes some of the heat stored in the subsurface layers. This fuels a rapid rise in AMOC that lasts less than a couple of decades before subsequent freshening from increases in precipitation and sea ice melt reverses the initial increase in the meridional density gradient. Thereafter AMOC recovery slows to the rate found in comparable GOM cases. The result for these glacial transient hosing experiments is that the pace of the longer recovery is not sensitive to location of the imposed freshwater forcing. (orig.)

  19. Towards Defining the Ecological Niches of Novel Coastal Gulf of Mexico Bacterial Isolates (United States)

    Henson, M. W.; Thrash, C.; Nall, E.


    The study of microbial contributions to biogeochemistry is critical to understanding the cycles of fundamental compounds and gain predictive capabilities in a changing environment. Such study requires observation of microbial communities and genetics in nature, coupled with experimental testing of hypotheses both in situ and in laboratory settings. This study combines dilution-to-extinction based high-throughput culturing (HTC) with cultivation-independent and geochemical measurements to define potential ecological niches of novel bacterial isolates from the coastal northern Gulf of Mexico (cnGOM). Here we report findings from the first of a three-year project. In total, 43 cultures from seven HTC experiments were capable of being repeatedly transferred. Sanger sequencing of the 16S rRNA gene identified these isolates as belonging to the phyla Gammaproteobacteria, Alphaproteobacteria, Actinobacteria, and Betaproteobacteria. Eight are being genome sequenced, with two selected for further physiological characterization due to their phylogenic novelty and potential ecological significance. Strain LSUCC101 likely represents a novel family of Gammaproteobacteria (best blast hit to a cultured representative showed 91% sequence identity) and strain LSUCC96 belongs to the OM252 clade, with the Hawaiian isolate HIMB30 as its closest relative. Both are small (0.3-0.5 µm) cocci. The environmental importance of both LSUCC101 and LSUCC96 was illustrated by their presence within the top 30 OTU0.03 of cnGOM 16S rRNA gene datasets as well as within clone libraries from coastal regions around the world. Ongoing work is determining growth efficiencies, substrate utilization profiles, and metabolic potential to elucidate the roles of these organisms in the cnGOM. Comparative genomics will examine the evolutionary divergence of these organisms from their closest neighbors, and metagenomic recruitment to genomes will help identify strain-based variation from different coastal regions.

  20. State estimates and forecasts of the loop current in the Gulf of Mexico using the MITgcm and its adjoint

    KAUST Repository

    Gopalakrishnan, Ganesh


    An ocean state estimate has been developed for the Gulf of Mexico (GoM) using the MIT general circulation model and its adjoint. The estimate has been tested by forecasting loop current (LC) evolution and eddy shedding in the GoM. The adjoint (or four-dimensional variational) method was used to match the model evolution to observations by adjusting model temperature and salinity initial conditions, open boundary conditions, and atmospheric forcing fields. The model was fit to satellite-derived along-track sea surface height, separated into temporal mean and anomalies, and gridded sea surface temperature for 2 month periods. The optimized state at the end of the assimilation period was used to initialize the forecast for 2 months. Forecasts explore practical LC predictability and provide a cross-validation test of the state estimate by comparing it to independent future observations. The model forecast was tested for several LC eddy separation events, including Eddy Franklin in May 2010 during the deepwater horizon oil spill disaster in the GoM. The forecast used monthly climatological open boundary conditions, atmospheric forcing, and run-off fluxes. The model performance was evaluated by computing model-observation root-mean-square difference (rmsd) during both the hindcast and forecast periods. The rmsd metrics for the forecast generally outperformed persistence (keeping the initial state fixed) and reference (forecast initialized using assimilated Hybrid Coordinate Ocean Model 1/12° global analysis) model simulations during LC eddy separation events for a period of 1̃2 months.

  1. State estimates and forecasts of the loop current in the Gulf of Mexico using the MITgcm and its adjoint

    KAUST Repository

    Gopalakrishnan, Ganesh; Cornuelle, Bruce D.; Hoteit, Ibrahim; Rudnick, Daniel L.; Owens, W. Brechner


    An ocean state estimate has been developed for the Gulf of Mexico (GoM) using the MIT general circulation model and its adjoint. The estimate has been tested by forecasting loop current (LC) evolution and eddy shedding in the GoM. The adjoint (or four-dimensional variational) method was used to match the model evolution to observations by adjusting model temperature and salinity initial conditions, open boundary conditions, and atmospheric forcing fields. The model was fit to satellite-derived along-track sea surface height, separated into temporal mean and anomalies, and gridded sea surface temperature for 2 month periods. The optimized state at the end of the assimilation period was used to initialize the forecast for 2 months. Forecasts explore practical LC predictability and provide a cross-validation test of the state estimate by comparing it to independent future observations. The model forecast was tested for several LC eddy separation events, including Eddy Franklin in May 2010 during the deepwater horizon oil spill disaster in the GoM. The forecast used monthly climatological open boundary conditions, atmospheric forcing, and run-off fluxes. The model performance was evaluated by computing model-observation root-mean-square difference (rmsd) during both the hindcast and forecast periods. The rmsd metrics for the forecast generally outperformed persistence (keeping the initial state fixed) and reference (forecast initialized using assimilated Hybrid Coordinate Ocean Model 1/12° global analysis) model simulations during LC eddy separation events for a period of 1̃2 months.

  2. Constraining gas hydrate occurrence in the northern Gulf of Mexico continental slope : fine scale analysis of grain-size in hydrate-bearing sediments

    Energy Technology Data Exchange (ETDEWEB)

    Hangsterfer, A.; Driscoll, N.; Kastner, M. [Scripps Inst. of Oceanography, La Jolla, CA (United States). Geosciences Research Division


    Methane hydrates can form within the gas hydrate stability zone (GHSZ) in sea beds. The Gulf of Mexico (GOM) contains an underlying petroleum system and deeply buried, yet dynamic salt deposits. Salt tectonics and fluid expulsion upward through the sediment column result in the formation of fractures, through which high salinity brines migrate into the GHSZ, destabilizing gas hydrates. Thermogenic and biogenic hydrocarbons also migrate to the seafloor along the GOMs northern slope, originating from the thermal and biogenic degradation of organic matter. Gas hydrate occurrence can be controlled by either primary permeability, forming in coarse-grained sediment layers, or by secondary permeability, forming in areas where hydrofracture and faulting generate conduits through which hydrocarbon-saturated fluids flow. This paper presented a study that attempted to determine the relationship between grain-size, permeability, and gas hydrate distribution. Grain-size analyses were performed on cores taken from Keathley Canyon and Atwater Valley in the GOM, on sections of cores that both contained and lacked gas hydrate. Using thermal anomalies as proxies for the occurrence of methane hydrate within the cores, samples of sediment were taken and the grain-size distributions were measured to see if there was a correlation between gas hydrate distribution and grain-size. The paper described the methods, including determination of hydrate occurrence and core analysis. It was concluded that gas hydrate occurrence in Keathley Canyon and Atwater Valley was constrained by secondary permeability and was structurally controlled by hydrofractures and faulting that acted as conduits through which methane-rich fluids flowed. 11 refs., 2 tabs., 5 figs.

  3. Temporal variability of chlorophyll distribution in the Gulf of Mexico: bio-optical data from profiling floats (United States)

    Pasqueron de Fommervault, Orens; Perez-Brunius, Paula; Damien, Pierre; Camacho-Ibar, Victor F.; Sheinbaum, Julio


    Chlorophyll concentration is a key oceanic biogeochemical variable. In the Gulf of Mexico (GOM), its distribution, which is mainly obtained from satellite surface observations and scarce in situ experiments, is still poorly understood. In 2011-2012, eight profiling floats equipped with biogeochemical sensors were deployed for the first time in the GOM and generated an unprecedented dataset that significantly increased the number of chlorophyll vertical distribution measurements in the region. The analysis of these data, once calibrated, permits us to reconsider the spatial and temporal variability of the chlorophyll concentration in the water column. At a seasonal scale, results confirm the surface signal seen by satellites, presenting maximum concentrations in winter and low values in summer. It is shown that the deepening of the mixed layer is the primary factor triggering the chlorophyll surface increase in winter. In the GOM, a possible interpretation is that this surface increase corresponds to a biomass increase. However, the present dataset suggests that the basin-scale climatological surface increase in chlorophyll content results from a vertical redistribution of subsurface chlorophyll and/or photoacclimation processes, rather than a net increase of biomass. One plausible explanation for this is the decoupling between the mixed-layer depth and the deep nutrient reservoir since mixed-layer depth only reaches the nitracline in sporadic events in the observations. Float measurements also provide evidence that the depth and the magnitude of the deep chlorophyll maximum is strongly controlled by the mesoscale variability, with higher chlorophyll biomass generally observed in cyclones rather than anticyclones.

  4. Fat, weather, and date affect migratory songbirds' departure decisions, routes, and time it takes to cross the Gulf of Mexico. (United States)

    Deppe, Jill L; Ward, Michael P; Bolus, Rachel T; Diehl, Robert H; Celis-Murillo, Antonio; Zenzal, Theodore J; Moore, Frank R; Benson, Thomas J; Smolinsky, Jaclyn A; Schofield, Lynn N; Enstrom, David A; Paxton, Eben H; Bohrer, Gil; Beveroth, Tara A; Raim, Arlo; Obringer, Renee L; Delaney, David; Cochran, William W


    Approximately two thirds of migratory songbirds in eastern North America negotiate the Gulf of Mexico (GOM), where inclement weather coupled with no refueling or resting opportunities can be lethal. However, decisions made when navigating such features and their consequences remain largely unknown due to technological limitations of tracking small animals over large areas. We used automated radio telemetry to track three songbird species (Red-eyed Vireo, Swainson's Thrush, Wood Thrush) from coastal Alabama to the northern Yucatan Peninsula (YP) during fall migration. Detecting songbirds after crossing ∼1,000 km of open water allowed us to examine intrinsic (age, wing length, fat) and extrinsic (weather, date) variables shaping departure decisions, arrival at the YP, and crossing times. Large fat reserves and low humidity, indicative of beneficial synoptic weather patterns, favored southward departure across the Gulf. Individuals detected in the YP departed with large fat reserves and later in the fall with profitable winds, and flight durations (mean = 22.4 h) were positively related to wind profit. Age was not related to departure behavior, arrival, or travel time. However, vireos negotiated the GOM differently than thrushes, including different departure decisions, lower probability of detection in the YP, and longer crossing times. Defense of winter territories by thrushes but not vireos and species-specific foraging habits may explain the divergent migratory behaviors. Fat reserves appear extremely important to departure decisions and arrival in the YP. As habitat along the GOM is degraded, birds may be limited in their ability to acquire fat to cross the Gulf.

  5. Fat, weather, and date affect migratory songbirds’ departure decisions, routes, and time it takes to cross the Gulf of Mexico (United States)

    Deppe, Jill L.; Ward, Michael P.; Bolus, Rachel T.; Diehl, Robert H.; Celis-Murillo, A.; Zenzal, Theodore J.; Moore, Frank R.; Benson, Thomas J.; Smolinsky, Jaclyn A.; Schofield, Lynn N.; Enstrom, David A.; Paxton, Eben H.; Bohrer, Gil; Beveroth, Tara A.; Raim, Arlo; Obringer, Renee L.; Delaney, David; Cochran, William W.


    Approximately two thirds of migratory songbirds in eastern North America negotiate the Gulf of Mexico (GOM), where inclement weather coupled with no refueling or resting opportunities can be lethal. However, decisions made when navigating such features and their consequences remain largely unknown due to technological limitations of tracking small animals over large areas. We used automated radio telemetry to track three songbird species (Red-eyed Vireo, Swainson’s Thrush, Wood Thrush) from coastal Alabama to the northern Yucatan Peninsula (YP) during fall migration. Detecting songbirds after crossing ∼1,000 km of open water allowed us to examine intrinsic (age, wing length, fat) and extrinsic (weather, date) variables shaping departure decisions, arrival at the YP, and crossing times. Large fat reserves and low humidity, indicative of beneficial synoptic weather patterns, favored southward departure across the Gulf. Individuals detected in the YP departed with large fat reserves and later in the fall with profitable winds, and flight durations (mean = 22.4 h) were positively related to wind profit. Age was not related to departure behavior, arrival, or travel time. However, vireos negotiated the GOM differently than thrushes, including different departure decisions, lower probability of detection in the YP, and longer crossing times. Defense of winter territories by thrushes but not vireos and species-specific foraging habits may explain the divergent migratory behaviors. Fat reserves appear extremely important to departure decisions and arrival in the YP. As habitat along the GOM is degraded, birds may be limited in their ability to acquire fat to cross the Gulf.

  6. Stable isotope composition of mercury forms in flue gases from a typical coal-fired power plant, Inner Mongolia, northern China

    International Nuclear Information System (INIS)

    Tang, Shunlin; Feng, Chaohui; Feng, Xinbin; Zhu, Jianming; Sun, Ruoyu; Fan, Huipeng; Wang, Lina; Li, Ruiyang; Mao, Tonghua; Zhou, Ting


    Highlights: • The first speciated Hg isotope ratios in coal combustion flue gases are presented. • Significant Hg isotope kinetic MDF was observed during Hg forms transformation. • Emitted gaseous Hg highly enriches in heavy Hg isotopes relative to feed coal. - Abstract: Mercury forms emitted from coal combustion via air pollution control devices are speculated to carry different Hg isotope signatures. Yet, their Hg isotope composition is still not reported. Here, we present the first onsite Hg isotope data for gaseous elemental Hg (GEM) and gaseous oxidized Hg (GOM) of flue gases from a typical lignite-fired power plant (CFPP). Significant mass dependent fractionation (MDF) and insignificant mass independent fractionation (MIF) are observed between feed coal and coal combustion products. As compared to feed coal (δ 202 Hg = −2.04 ± 0.25‰), bottom ash, GEM and GOM in flue gases before and after wet flue gas desulfurization system significantly enrich heavy Hg isotopes by 0.7–2.6‰ in δ 202 Hg, while fly ash, desulfurization gypsum and waste water show slight but insignificant enrichment of light Hg isotopes. GEM is significantly enriched heavy Hg isotopes compared to GOM and Hg in fly ash. Our observations verify the previous speculation on Hg isotope fractionation mechanism in CFPPs, and suggest a kinetically-controlled mass dependent Hg isotope fractionation during transformation of Hg forms in flue gases. Finally, our data are compared to Hg isotope compositions of atmospheric Hg pools, suggesting that coal combustion Hg emission is likely an important atmospheric Hg contributor.

  7. Effect of NaCl induced salinity on some physiological and agronomic traits of wheat

    International Nuclear Information System (INIS)

    Bilkis, A.; Islam, M.H.R.; Hasan, M.A.


    Wheat genotypes were evaluated for salt stress at early seedling stage (solution culture) and maturity (pot culture) at Crop Physiology and Ecology Laboratory, Hajee Mohammad Danesh Science and Technology University, Dinajpur, Bangladesh. Shoot length, root length, root to shoot length ratio and seedling dry weight of 15 days old seedlings were found to be reduced at 12 dS m-1 salinity level compared to control condition. Based on seedling dry weight Shatabdi, BARI Gom 25, BARI Gom 26, BAW 1111, BAW 1146, BAW 1154 and BAW 1156 were identified as salt tolerant (STI = >0.70); BAW 1130, BAW 1135 and BAW 1142 were salt sensitive (STI = <0.60) and other ten were screened as moderately salt tolerant (STI = 0.60 to 0.70) wheat genotypes. Out of twenty genotypes, two salt tolerant (Shatabdi and BARI Gom 25) and two salt sensitive (BAW 1130 and BAW 1142) wheat genotypes were grown in pot irrigated with three levels of saline water (control, 6 dS m/sup -1/ and 12 dS m/sup -1/). Salt tolerant wheat genotypes maintained lower level of leaf Na, higher level of leaf K, greater K to Na ratio, increased level of flag leaf proline and greater flag leaf SPAD value in saline condition than the sensitive ones. Salt sensitive genotypes affected more in spikes plant-1, grains spike/sup -1/, grain dry weight spike-1, 100 grain weight and grain yield plant-1 under saline condition than salt tolerant genotypes. (author)

  8. Seagrass blue carbon dynamics in the Gulf of Mexico: Stocks, losses from anthropogenic disturbance, and gains through seagrass restoration. (United States)

    Thorhaug, Anitra; Poulos, Helen M; López-Portillo, Jorge; Ku, Timothy C W; Berlyn, Graeme P


    Seagrasses comprise a substantive North American and Caribbean Sea blue carbon sink. Yet fine-scale estimates of seagrass carbon stocks, fluxes from anthropogenic disturbances, and potential gains in sedimentary carbon from seagrass restoration are lacking for most of the Western Hemisphere. To begin to fill this knowledge gap in the subtropics and tropics, we quantified organic carbon (C org ) stocks, losses, and gains from restorations at 8 previously-disturbed seagrass sites around the Gulf of Mexico (GoM) (n=128 cores). Mean natural seagrass C org stocks were 25.7±6.7MgC org ha -1 around the GoM, while mean C org stocks at adjacent barren sites that had previously hosted seagrass were 17.8MgC org ha -1 . Restored seagrass beds contained a mean of 38.7±13.1MgC org ha -1 . Mean C org losses differed by anthropogenic impact type, but averaged 20.98±7.14MgC org ha -1 . C org gains from seagrass restoration averaged 20.96±8.59Mgha -1 . These results, when combined with the similarity between natural and restored C org content, highlight the potential of seagrass restoration for mitigating seagrass C org losses from prior impact events. Our GoM basin-wide estimates of natural C org totaled ~36.4Tg for the 947,327ha for the USA-GoM. Including Mexico, the total basin contained an estimated 37.2-37.5Tg C org . Regional US-GoM losses totaled 21.69Tg C org . C org losses differed significantly among anthropogenic impacts. Yet, seagrass restoration appears to be an important climate change mitigation strategy that could be implemented elsewhere throughout the tropics and subtropics. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Habitat-specific density and diet of rapidly expanding invasive red lionfish, Pterois volitans, populations in the northern Gulf of Mexico. (United States)

    Dahl, Kristen A; Patterson, William F


    Invasive Indo-Pacific red lionfish, Pterois volitans, were first reported in the northern Gulf of Mexico (nGOM) in summer 2010. To examine potential impacts on native reef fish communities, lionfish density and size distributions were estimated from fall 2010 to fall 2013 with a remotely operated vehicle at natural (n = 16) and artificial (n = 22) reef sites. Lionfish (n = 934) also were sampled via spearfishing to examine effects of habitat type, season, and fish size on their diet and trophic ecology. There was an exponential increase in lionfish density at both natural and artificial reefs over the study period. By fall 2013, mean lionfish density at artificial reefs (14.7 fish 100 m(-2)) was two orders of magnitude higher than at natural reefs (0.49 fish 100 m(-2)), and already was among the highest reported in the western Atlantic. Lionfish diet was significantly different among habitats, seasons, and size classes, with smaller (lionfish sampled from artificial reefs being composed predominantly of non-reef associated prey. The ontogenetic shift in lionfish feeding ecology was consistent with δ15N values of white muscle tissue that were positively related to total length. Overall, diet results indicate lionfish are generalist mesopredators in the nGOM that become more piscivorous at larger size. However, lionfish diet was much more varied at artificial reef sites where they clearly were foraging on open substrates away from reef structure. These results have important implications for tracking the lionfish invasion in the nGOM, as well as estimating potential direct and indirect impacts on native reef fish communities in this region.

  10. Habitat-specific density and diet of rapidly expanding invasive red lionfish, Pterois volitans, populations in the northern Gulf of Mexico.

    Directory of Open Access Journals (Sweden)

    Kristen A Dahl

    Full Text Available Invasive Indo-Pacific red lionfish, Pterois volitans, were first reported in the northern Gulf of Mexico (nGOM in summer 2010. To examine potential impacts on native reef fish communities, lionfish density and size distributions were estimated from fall 2010 to fall 2013 with a remotely operated vehicle at natural (n = 16 and artificial (n = 22 reef sites. Lionfish (n = 934 also were sampled via spearfishing to examine effects of habitat type, season, and fish size on their diet and trophic ecology. There was an exponential increase in lionfish density at both natural and artificial reefs over the study period. By fall 2013, mean lionfish density at artificial reefs (14.7 fish 100 m(-2 was two orders of magnitude higher than at natural reefs (0.49 fish 100 m(-2, and already was among the highest reported in the western Atlantic. Lionfish diet was significantly different among habitats, seasons, and size classes, with smaller (<250 mm total length fish consuming more benthic invertebrates and the diet of lionfish sampled from artificial reefs being composed predominantly of non-reef associated prey. The ontogenetic shift in lionfish feeding ecology was consistent with δ15N values of white muscle tissue that were positively related to total length. Overall, diet results indicate lionfish are generalist mesopredators in the nGOM that become more piscivorous at larger size. However, lionfish diet was much more varied at artificial reef sites where they clearly were foraging on open substrates away from reef structure. These results have important implications for tracking the lionfish invasion in the nGOM, as well as estimating potential direct and indirect impacts on native reef fish communities in this region.

  11. Stable isotope composition of mercury forms in flue gases from a typical coal-fired power plant, Inner Mongolia, northern China

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Shunlin, E-mail: [Institute of Resources and Environment, Henan Polytechnic University, Jiaozuo, Henan Province, 454000 (China); Feng, Chaohui [Institute of Resources and Environment, Henan Polytechnic University, Jiaozuo, Henan Province, 454000 (China); Feng, Xinbin [State Key Laboratory of Environmental Geochemistry, Institute of Geochemistry, Chinese Academy of Sciences, Guiyang, 550002 (China); Zhu, Jianming [Institute of Resources and Environment, Henan Polytechnic University, Jiaozuo, Henan Province, 454000 (China); State Key Laboratory of Geological Processes and Mineral Resources, China University of Geosciences, Beijing, 100086 (China); Sun, Ruoyu, E-mail: [CAS Key Laboratory of Crust-Mantle Materials and Environment, School of Earth and Space Sciences, University of Science and Technology of China, Hefei, Anhui 230026 (China); Fan, Huipeng; Wang, Lina; Li, Ruiyang; Mao, Tonghua [Institute of Resources and Environment, Henan Polytechnic University, Jiaozuo, Henan Province, 454000 (China); Zhou, Ting [State Key Laboratory of Ore Deposit Geochemistry, Institute of Geochemistry, Chinese Academy of Sciences, Guiyang, 550002 (China)


    Highlights: • The first speciated Hg isotope ratios in coal combustion flue gases are presented. • Significant Hg isotope kinetic MDF was observed during Hg forms transformation. • Emitted gaseous Hg highly enriches in heavy Hg isotopes relative to feed coal. - Abstract: Mercury forms emitted from coal combustion via air pollution control devices are speculated to carry different Hg isotope signatures. Yet, their Hg isotope composition is still not reported. Here, we present the first onsite Hg isotope data for gaseous elemental Hg (GEM) and gaseous oxidized Hg (GOM) of flue gases from a typical lignite-fired power plant (CFPP). Significant mass dependent fractionation (MDF) and insignificant mass independent fractionation (MIF) are observed between feed coal and coal combustion products. As compared to feed coal (δ{sup 202}Hg = −2.04 ± 0.25‰), bottom ash, GEM and GOM in flue gases before and after wet flue gas desulfurization system significantly enrich heavy Hg isotopes by 0.7–2.6‰ in δ{sup 202}Hg, while fly ash, desulfurization gypsum and waste water show slight but insignificant enrichment of light Hg isotopes. GEM is significantly enriched heavy Hg isotopes compared to GOM and Hg in fly ash. Our observations verify the previous speculation on Hg isotope fractionation mechanism in CFPPs, and suggest a kinetically-controlled mass dependent Hg isotope fractionation during transformation of Hg forms in flue gases. Finally, our data are compared to Hg isotope compositions of atmospheric Hg pools, suggesting that coal combustion Hg emission is likely an important atmospheric Hg contributor.

  12. Hydrocarbon Seeps Formations: a Study Using 3-D Seismic Attributes in Combination with Satellite Data (United States)

    Garcia-Pineda, O. G.; MacDonald, I. R.; Shedd, W.


    Analyzing the magnitude of oil discharges from natural hydrocarbon seeps is important in improving our understanding of carbon contribution as oil migrates from deeper sediments to the water column, and then eventually to the atmosphere. Liquid hydrocarbon seepage in the deep water of the Gulf of Mexico (GOM) is associated with deep cutting faults, associated with vertical salt movement, that provide conduits for the upward migration of oil and gas. Seeps transform surface geology and generate prominent geophysical targets that can be identified on 3-D seismic data as seafloor amplitude anomalies maps that correlate with the underlying deep fault systems. Using 3D seismic data, detailed mapping of the northern GOM has identified more than 21,000 geophysical anomalies across the basin. In addition to seismic data, Synthetic Aperture Radar (SAR) images have proven to be a reliable tool for localizing natural seepage of oil. We used a Texture Classifier Neural Network Algorithm (TCNNA) to process more than 1200 SAR images collected over the GOM. We quantified more than 900 individual seep formations distributed along the continental shelf and in deep water. Comparison of the geophysical anomalies with the SAR oil slick targets shows good general agreement between the distributions of the two indicators. However, there are far fewer active oil slicks than geophysical anomalies, most of which are probably associated with gas seepage. By examining several sites where the location of active venting can be determined by submersibles observations, we found that the active oily vents are often spatially offset from the most intense geophysical targets (i.e. GC600, GC767, GC204, etc). In addition to the displacement of the oil by deep sea currents, we propose that during the 100K years of activity, the location of the vents on the seafloor probably migrate as carbonate cementation reduces the permeability of the upper sediment. Many of the geophysical targets may represent

  13. Ecosystem responses to recent oceanographic variability in high-latitude Northern Hemisphere ecosystems (United States)

    Mueter, Franz J.; Broms, Cecilie; Drinkwater, Kenneth F.; Friedland, Kevin D.; Hare, Jonathan A.; Hunt, George L., Jr.; Melle, Webjørn; Taylor, Maureen


    As part of the international MENU collaboration, we compared and contrasted ecosystem responses to climate-forced oceanographic variability across several high latitude regions of the North Pacific (Eastern Bering Sea (EBS) and Gulf of Alaska (GOA)) and North Atlantic Oceans (Gulf of Maine/Georges Bank (GOM/GB) and the Norwegian/Barents Seas (NOR/BAR)). Differences in the nitrate content of deep source waters and incoming solar radiation largely explain differences in average primary productivity among these ecosystems. We compared trends in productivity and abundance at various trophic levels and their relationships with sea-surface temperature. Annual net primary production generally increases with annual mean sea-surface temperature between systems and within the EBS, BAR, and GOM/GB. Zooplankton biomass appears to be controlled by both top-down (predation by fish) and bottom-up forcing (advection, SST) in the BAR and NOR regions. In contrast, zooplankton in the GOM/GB region showed no evidence of top-down forcing but appeared to control production of major fish populations through bottom-up processes that are independent of temperature variability. Recruitment of several fish stocks is significantly and positively correlated with temperature in the EBS and BAR, but cod and pollock recruitment in the EBS has been negatively correlated with temperature since the 1977 shift to generally warmer conditions. In each of the ecosystems, fish species showed a general poleward movement in response to warming. In addition, the distribution of groundfish in the EBS has shown a more complex, non-linear response to warming resulting from internal community dynamics. Responses to recent warming differ across systems and appear to be more direct and more pronounced in the higher latitude systems where food webs and trophic interactions are simpler and where both zooplankton and fish species are often limited by cold temperatures.

  14. Manufacture of a four-sheet complex component from different titanium alloys by superplastic forming (United States)

    Allazadeh, M. R.; Zuelli, N.


    A superplastic forming (SPF) technology process was deployed to form a complex component with eight-pocket from a four-sheet sandwich panel sheetstock. Six sheetstock packs were composed of two core sheets made of Ti-6Al-4V or Ti-5Al-4Cr-4Mo-2Sn-2Zr titanium alloy and two skin sheets made of Ti-6Al-4V or Ti-6Al-2Sn-4Zr-2Mo titanium alloy in three different combinations. The sheets were welded with two subsequent welding patterns over the core and skin sheets to meet the required component's details. The applied welding methods were intermittent and continuous resistance seam welding for bonding the core sheets to each other and the skin sheets over the core panel, respectively. The final component configuration was predicted based on the die drawings and finite element method (FEM) simulations for the sandwich panels. An SPF system set-up with two inlet gas pipe feeding facilitated the trials to deliver two pressure-time load cycles acting simultaneously which were extracted from FEM analysis for specific forming temperature and strain rate. The SPF pressure-time cycles were optimized via GOM scanning and visually inspecting some sections of the packs in order to assess the levels of core panel formation during the inflation process of the sheetstock. Two sets of GOM scan results were compared via GOM software to inspect the surface and internal features of the inflated multisheet packs. The results highlighted the capability of the tested SPF process to form complex components from a flat multisheet pack made of different titanium alloys.

  15. Solar Variability Controls on Rainfall in the Last Millennia: Evidence from a Highly Resolved Stalagmite Record from DeSoto Caverns (USA) (United States)

    Aharon, P.; Lambert, W.; Hellstrom, J.


    Moisture transport from the Gulf of Mexico (GOM) inland has a considerable influence on both regional and continental rainfall patterns. Recent episodes of drought in the Southeastern USA exposed the vulnerability of the regional infrastructure to climate changes and gave rise to inter-state “water wars”. In order to better understand the cause of these periodic droughts and their controlling climate factors we have initiated a study of stalagmites from the DeSoto Caverns (Alabama, USA) that intersect the moisture flow from GOM. Combination of unusually high growth rates (up to 2 mm/decade), prominent dark and light seasonal layers, pristine aragonite mineralogy, precise U/Th dates acquired from mg-size samples and tight sampling (n=195) afforded generation of biannual (δ18O and δ13C of exceptional clarity spanning the last 700 yrs. The stalagmite (DSSG1) top yields isotope values (δ18O=-5.5 per-mill VPDB; δ13C=-10.1 per-mill VPDB) that are in good agreement with the predicted equilibrium isotope values. The oxygen and carbon isotope records exhibit a number of alternating negative and positive phase changes of correspond exactly with the Sun quiescence periods known as Dalton, Maunder, Spörer and Wolf Minima, and are corroborated by agreement with the positive shifts in atmospheric radiocarbon levels. Using a forward model we interpret the positive and negative δ18O and δ13C shifts during solar maxima and minima, respectively, as being primarily an expression of rapid shifts in rainfall sourced from GOM moisture and alternating between low and high rainfall intervals. The low and high rainfall intervals discerned in the stalagmite correspond to contemporaneous SST rise and fall in GOM and the Caribbean of about 1 oC amplitude. We suggest that small but measurable SST changes in the Western Hemisphere Warm Pool (WHWP), controlled by solar radiation changes between maxima and minima cycles, have a pronounced effect on the continental rainfall pattern. The

  16. From DNS to RANS: A Multi-model workflow to understand the Influence of Hurricanes on Generating Turbidity Currents in the Gulf of Mexico (United States)

    Syvitski, J. P.; Arango, H.; Harris, C. K.; Meiburg, E. H.; Jenkins, C. J.; Auad, G.; Hutton, E.; Kniskern, T. A.; Radhakrishnan, S.


    A loosely coupled numerical workflow is developed to address land-sea pathways for sediment routing from terrestrial and coastal sources, across the continental shelf and ultimately down the continental slope canyon system of the northern Gulf of Mexico (GOM). Model simulations represent a range of environmental conditions that might lead to the generation of turbidity-currents. The workflow comprises: 1) A simulator for the water and sediment discharged from rivers into the GOM with WMBsedv2 with calibration using USGS and USACE gauged river data; 2) Domain grids and bathymetry (ETOPO2) for the ocean models and realistic seabed sediment texture grids (dbSEABED) for the sediment transport models; 3) A spectral wave action simulator (10 km resolution) (WaveWatch III) driven by GFDL - GFS winds; 4) A simulator for ocean dynamics (ROMS) forced with ECMWF ERA winds; 5) A simulator for seafloor resuspension and transport (CSTMS); 6) Simulators (HurriSlip) of seafloor failure and flow ignition locations for boundary input to a turbidity current model; and 7) A RANS turbidity current model (TURBINS) to route sediment flows down GOM canyons, providing estimates of bottom shear stresses. TURBINS was developed first as a DNS model and then converted to an LES model wherein a dynamic turbulence closure scheme was employed. Like most DNS to LES model comparisons (these being done by the UCSB team), turbulence scaling allowed for higher Re applications but were found still not capable of simulating field scale (GOM continental canyons) environments. The LES model was next converted to a non-hydrostatic RANS model capable of field scale applications but only with a daisy-chain approach to multiple model runs along the simulated canyon floor. These model adaptations allowed the workflow to be tested for the year 1-Oct-2007 to 30-Sep-2008 that included two domain Hurricanes (Ike and Gustav). The RANS-TURBINS employed further boundary simplifications on both sediment erosion and

  17. A Conceptual Framework for Predicting Error in Complex Human-Machine Environments (United States)

    Freed, Michael; Remington, Roger; Null, Cynthia H. (Technical Monitor)


    We present a Goals, Operators, Methods, and Selection Rules-Model Human Processor (GOMS-MHP) style model-based approach to the problem of predicting human habit capture errors. Habit captures occur when the model fails to allocate limited cognitive resources to retrieve task-relevant information from memory. Lacking the unretrieved information, decision mechanisms act in accordance with implicit default assumptions, resulting in error when relied upon assumptions prove incorrect. The model helps interface designers identify situations in which such failures are especially likely.

  18. Effects of temperature and gamma radiation on the stability of 125{sub -}19-Iodo cholesterol; Efectos de la temperatura y la radiacion gamma sobre la estabilidad dle 19-Yodocolestero. 125 I

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L.; Rebollo, D. V.; Ruiz, J. M.


    He have studied the effect of the temperature and the gamma radiations on the I25I-19-iodocholesterol synthesized in our laboratory; the time of caducity (t 90) have been fixed from the rate constants of decomposition (k) (20,9) 32,1 y 144 . 10-3 h''-1) for different temperatures (35, 50 y 75degree centigree), and the value of Go(-M) (1,52) by radiation of samples of 19-Iodocholesterol-I25 I (0,94 mg/ml) with 60co (0,177 Hrad/h) . (Author) 8 refs.

  19. Hypoxia in the changing marine environment

    Digital Repository Service at National Institute of Oceanography (India)

    Zhang, J.; Cowie, G.; Naqvi, S.W.A.

    modification of Streeter–Phelps (SP) model to calculate longitudinal profiles of dissolved oxygen (DO) concentration for two major river-impacted coastal hypoxic areas of the United States, i.e. the Gulf of Mexico (GOM) along the Louisiana–Texas coasts...-resolution, depth-integrated, two- dimensional (2D) model and a large water quality database (1994–2010) to quantify the estuarine-shelf exchanges of carbon and nutrients in the Barataria Estuary of the Mississippi–Gulf of Mexico System, and to test the outwelling...

  20. Effects of temperature and gamma radiation on the stability of 125I-19-Iodocholesterol

    International Nuclear Information System (INIS)

    Rodriguez, L.; Rebollo, D. V.; Ruiz, J. M.


    He have studied the effect of the temperature and the gamma radiations on the I25I-19-iodocholesterol synthesized in our laboratory; the time of caducity (t 90) have been fixed from the rate constants of decomposition (k) (20,9) 32,1 y 144 . 10-3 h''-1) for different temperatures (35, 50 y 75degree centigree), and the value of Go(-M) (1,52) by radiation of samples of 19-Iodocholesterol-I25 I (0,94 mg/ml) with 60co (0,177 Hrad/h) . (Author) 8 refs

  1. Monsoon-facilitated characteristics and transport of atmospheric mercury at a high-altitude background site in southwestern China

    Directory of Open Access Journals (Sweden)

    H. Zhang


    Full Text Available To better understand the influence of monsoonal climate and transport of atmospheric mercury (Hg in southwestern China, measurements of total gaseous mercury (TGM, defined as the sum of gaseous elemental mercury, GEM, and gaseous oxidized mercury, GOM, particulate bound mercury (PBM and GOM were carried out at Ailaoshan Station (ALS, 2450 m a.s.l. in southwestern China from May 2011 to May 2012. The mean concentrations (± SD for TGM, GOM and PBM were 2.09 ± 0.63, 2.2 ± 2.3 and 31.3 ± 28.4 pg m−3, respectively. TGM showed a monsoonal distribution pattern with relatively higher concentrations (2.22 ± 0.58 ng m−3, p  =  0.021 during the Indian summer monsoon (ISM, from May to September and the east Asia summer monsoon (EASM, from May to September periods than that (1.99 ± 0.66 ng m−3 in the non-ISM period. Similarly, GOM and PBM concentrations were higher during the ISM period than during the non-ISM period. This study suggests that the ISM and the EASM have a strong impact on long-range and transboundary transport of Hg between southwestern China and south and southeast Asia. Several high TGM events were accompanied by the occurrence of northern wind during the ISM period, indicating anthropogenic Hg emissions from inland China could rapidly increase TGM levels at ALS due to strengthening of the EASM. Most of the TGM and PBM events occurred at ALS during the non-ISM period. Meanwhile, high CO concentrations were also observed at ALS, indicating that a strong south tributary of westerlies could have transported Hg from south and southeast Asia to southwestern China during the non-ISM period. The biomass burning in southeast Asia and anthropogenic Hg emissions from south Asia are thought to be the source of atmospheric Hg in remote areas of southwestern China during the non-ISM period.

  2. Environmental controls on barium incorporation into planktic foraminifer, Globorotalia truncatulinoides (United States)

    Richey, J. N.; Reynolds, C. E.; Fehrenbacher, J. S.


    The Ba/Ca of planktic foraminifera in marine sediment cores has been used primarily to track changes in riverine input over time, and thus may be a potentially powerful proxy for reconstructing past changes in the terrestrial hydrologic cycle. Using Ba/Ca as a proxy for riverine freshwater input requires the assumption that Ba/Ca in foraminiferal calcite reflects the Ba/Ca of seawater, and that the partition coefficient for barium between seawater and foraminiferal calcite is independent of the influence of temperature, salinity, pH, alkalinity and light availability. Although it has been shown that this partition coefficient is nearly identical for common species of spinose planktic foraminifera (e.g., Globigerinoides ruber, Orbulina universa, Globigerinoides sacculifer), some non-spinose species have been demonstrated to have Ba/Ca ratios that are much higher than that of co-occurring spinose specimens. We investigate environmental controls on Ba/Ca in the tests of Globorotalia truncatulinoides, a planktic species of foraminifera with a unique life history in the Gulf of Mexico (GoM). G. truncatulinoides experiences 92% of its annual flux to the sediment trap during winter (JFM) in the GoM. The Mg/Ca and ∂18O of the ontogenetic calcite suggests that primary calcification occurs within the surface mixed layer (0-150 meters), and a thick secondary crust is added at depths below the thermocline. We use LA-ICP-MS to analyze the Ba/Ca of both encrusted and non-encrusted G. truncatulinoides from a sediment trap time series in the GoM and find that the Ba/Ca in ontogenetic calcite of non-encrusted specimens varies between 10 and 200 mmol/mol, while the Ba/Ca of the secondary crust varies between 0 and 3 mmol/mol. The Ba/Ca of the non-encrusted G. truncatulinoides specimens is two to three orders of magnitude higher than that of co-occurring spinose planktic foraminifera (O. universa and G. ruber) in the GoM sediment trap, while the secondary crust has Ba/Ca similar to

  3. Gulf of Mexico Outer Continental Shelf daily oil and gas production rate projections from 1999 through 2003

    International Nuclear Information System (INIS)

    Melancon, J.M.; Baud, R.D.


    This paper provides daily oil and gas production rate projections for the Gulf of Mexico (GOM) Outer Continental Shelf (OCS) for the years 1999 through 2003. These projections represent daily oil and gas production estimates at calendar year end. In this report, daily oil production rates include both oil and condensate production, and daily gas production rates include both associated and nonassociated gas production. In addition to providing daily oil and gas production rate projections, the authors have included one figure and one table pertaining to leasing history and one table concerning exploration and development plan approvals

  4. Gulf of Mexico outer continental shelf daily oil and gas production rare projections from 1998 through 2002

    International Nuclear Information System (INIS)

    Melancon, J.M.; Roby, D.S.


    This paper provides daily oil and gas production rate projections for the Gulf of Mexico (GOM) Outer Continental Shelf (OCS) for the years 1998 through 2002. These projections represent daily oil and gas production estimates at calendar year end. In this report, daily oil production rates include both oil and condensate production, and daily gas production rates include both associated and nonassociated gas production. In addition to providing daily oil and gas production rate projections, the authors have included one figure and one table pertaining to leasing history and one table concerning exploration and development plan approvals

  5. Macondo-1 well oil in sediment and tarballs from the northern Gulf of Mexico shoreline (United States)

    Wong, Florence L.; Rosenbauer, Robert J.; Campbell, Pamela L.; Lam, Angela; Lorenson, T.D.; Hostettler, Frances D.; Thomas, Burt


    From April 20 through July 15, 2010, an estimated 4.4 million barrels (1 barrel = 42 gallons [~700,000 cu m]) of crude oil spilled into the northern Gulf of Mexico (nGOM) from the ruptured British Petroleum (BP) Macondo-1 (M-1) well after the explosion of the drilling platform Deepwater Horizon. In addition, ~1.84 million gallons (~7,000 cu m) of hydrocarbon-based Corexit dispersants were applied to the oil both on and below the sea surface (Operational Science Advisory Team, 2010). An estimate of the total extent of the surface oil slick, derived from wind, ocean currents, aerial photography, and satellite imagery, was 68,000 square miles (~180,000 sq km; Amos and Norse, 2010). Spilled oil from this event impacted sensitive habitat along the shores of the nGOM. In response to this environmental catastrophe, the U.S. Geological Survey (USGS) collected coastal sediment and tarball samples along the shores of the nGOM from Texas to Florida before and after oil made landfall. These sites included priority areas of the nGOM at highest risk for oil contamination. These areas included coastal wetlands, shorelines, and barrier islands that could suffer severe environmental damage if a significant amount of oil came ashore. Samples were collected before oil reached land from 69 sites; 49 were revisited to collect samples after oil landfall. This poster focuses on the samples from locations that were sampled on both occasions. The USGS samples and one M-1 well-oil sample provided by BP were analyzed for a suite of diagnostic geochemical biomarkers. Aided by multivariate statistical analysis, the M-1 well oil was not detected in the samples collected before landfall but have been identified in sediment and tarballs collected from Louisiana, Alabama, Mississippi, and Florida after landfall. None of the sediment hydrocarbon extracts from Texas correlated with the M-1 well oil. Oil-impacted sediment is confined to the shoreline adjacent to the cumulative oil slick of the

  6. Reconnaissance of Macondo-1 well oil in sediment and tarballs from the northern Gulf of Mexico shoreline, Texas to Florida (United States)

    Rosenbauer, Robert J.; Campbell, Pamela L.; Lam, Angela; Lorenson, T.D.; Hostettler, Frances D.; Thomas, Burt; Wong, Florence L.


    Hydrocarbons were extracted and analyzed from sediment and tarballs collected from the northern Gulf of Mexico (nGOM) coast that is potentially impacted by Macondo-1 (M-1) well oil. The samples were analyzed for a suite of diagnostic geochemical biomarkers. Aided by multivariate statistical analysis, the M-1 well oil has been identified in sediment and tarballs collected from Louisiana, Alabama, Mississippi, and Florida. None of the sediment hydrocarbon extracts from Texas correlated with the M-1 well oil. Oil-impacted sediments are confined to the shoreline adjacent to the cumulative oil slick of the Deepwater Horizon oil spill, and no impact was observed outside of this area.

  7. Biogeographic Comparison of Lophelia-Associated Bacterial Communities in the Western Atlantic Reveals Conserved Core Microbiome

    Directory of Open Access Journals (Sweden)

    Christina A. Kellogg


    Full Text Available Over the last decade, publications on deep-sea corals have tripled. Most attention has been paid to Lophelia pertusa, a globally distributed scleractinian coral that creates critical three-dimensional habitat in the deep ocean. The bacterial community associated with L. pertusa has been previously described by a number of studies at sites in the Mediterranean Sea, Norwegian fjords, off Great Britain, and in the Gulf of Mexico (GOM. However, use of different methodologies prevents direct comparisons in most cases. Our objectives were to address intra-regional variation and to identify any conserved bacterial core community. We collected samples from three distinct colonies of L. pertusa at each of four locations within the western Atlantic: three sites within the GOM and one off the east coast of the United States. Amplicon libraries of 16S rRNA genes were generated using primers targeting the V4–V5 hypervariable region and 454 pyrosequencing. The dominant phylum was Proteobacteria (75–96%. At the family level, 80–95% of each sample was comprised of five groups: Pirellulaceae, Pseudonocardiaceae, Rhodobacteraceae, Sphingomonadaceae, and unclassified Oceanospirillales. Principal coordinate analysis based on weighted UniFrac distances showed a clear distinction between the GOM and Atlantic samples. Interestingly, the replicate samples from each location did not always cluster together, indicating there is not a strong site-specific influence. The core bacterial community, conserved in 100% of the samples, was dominated by the operational taxonomic units of genera Novosphingobium and Pseudonocardia, both known degraders of aromatic hydrocarbons. The sequence of another core member, Propionibacterium, was also found in prior studies of L. pertusa from Norway and Great Britain, suggesting a role as a conserved symbiont. By examining more than 40,000 sequences per sample, we found that GOM samples were dominated by the identified conserved core

  8. Submesoscale Dispersion in the Vicinity of the Deepwater Horizon Spill (United States)


    dental oil spill into marine waters in history with some 4.4 million barrels released into the DeSoto Canyon of the northern Gulf of Mexico (GoM) from...signal contamination from high-frequency motions (29), gridded altimeter-derived sea level anomalies only resolve the largest submesoscale motions. Long...Coriolis parameter, η(x, t) is sea surface height anomaly from AVISO, and φ(x, t) is such that v(x, t) is nondivergent in the interior and its normal

  9. Effects of temperature and gamma radiation on the stability of 125{sub -}19-Iodo cholesterol; Efectos de la temperatura y la radiacion gamma sobre la estabilidad dle 19-Yodocolestero. 125 I

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L; Rebollo, D V; Ruiz, J M


    He have studied the effect of the temperature and the gamma radiations on the I25I-19-iodocholesterol synthesized in our laboratory; the time of caducity (t 90) have been fixed from the rate constants of decomposition (k) (20,9) 32,1 y 144 . 10-3 h''-1) for different temperatures (35, 50 y 75degree centigree), and the value of Go(-M) (1,52) by radiation of samples of 19-Iodocholesterol-I25 I (0,94 mg/ml) with 60co (0,177 Hrad/h) . (Author) 8 refs.

  10. Geomechanics considerations for through-and near-salt well design

    International Nuclear Information System (INIS)

    Willson, S.M.; Fredrich, Joanne T.


    Over the next decade a significant amount of exploration and new field developments will take place in salt provinces around the world - in the deepwater Gulf of Mexico, and offshore Angola, Brazil, and North and West Africa. Salt formations provide both opportunities and challenges to the design and construction of the often complex wells to be drilled in these locations. An overview of the many geomechanical considerations necessary to ensure successful well construction when drilling in through-, sub- and near-salt environments is presented. The structural styles of deformed sediments adjacent to salt, combined with stress perturbations caused by the presence of salt, are used to assess the risk of encountering zones that might cause wellbore instability or lost-circulation problems. Well design examples are provided that show how near- and through-salt uncertainties may be included within a geomechanical well design for required mud weights while drilling. Salt is found in many hydrocarbon basins around the world. Significant deposits exist in the Gulf of Mexico (GoM), offshore West Africa and Brazil, in the Southern North Sea, Egypt, and the Middle East (Figure 1(1)). In deep water offshore North America, the GoM and offshore Nova Scotia (NE Canada) are notable areas of current oil and gas exploration and production. Significant exploration activity is also targeting areas offshore Angola and Brazil. The extent of deepwater exploration in the GoM is illustrated in Figure 2 that shows the steady march into deeper water, together with a focusing of efforts in the Sigsbee Escarpment areas of Green Canyon, Walker Ridge and Atwater Valley. The deepest wells in the GoM are reaching true vertical depths of up to 32,000 feet, with maximum-recorded downhole pressures in excess of 26,000 psi and bottomhole temperatures in excess of 400 F. Such wells may penetrate considerable thicknesses of salt - up to 20,000 feet of salt is not unheard of. With substantial discoveries

  11. National Renewable Energy Laboratory Renewable Energy Opportunity Assessment for USAID Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Watson, Andrea [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bracho, Ricardo [National Renewable Energy Lab. (NREL), Golden, CO (United States); Romero, Rachel [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mercer, Megan [National Renewable Energy Lab. (NREL), Golden, CO (United States)


    The United States Agency for International Development (USAID) Enhancing Capacity for Low Emission Development Strategies (EC-LEDS) program is designing its second phase of assistance to the Government of Mexico (GOM). In preparation for program design, USAID has asked the National Renewable Energy Laboratory (NREL) to assist in identifying options for enabling renewable energy in Mexico and reducing greenhouse gas (GHG) emissions in the energy sector. The NREL team conducted a literature review and consulted with over 20 Mexican agencies and organizations during a two-week temporary duty assignment (TDY) to Mexico to identify gaps, opportunities, and program theme areas for Mexico.

  12. Provenance of the lower Miocene of the Gulf of Mexico from detrital zircon double dating (United States)

    xu, J.


    The lower Miocene interval of the Gulf of Mexico (GOM) has recently gained increasing attention from oil and gas industry due to its hydrocarbon potential below the salt canopy. However, it has been less well studied than both the underlying Oligocene and overlying middle Miocene strata. The lower Miocene worldwide is a transitional period of tectonic, climatic, and oceanographic change. In particular, it is a period of major tectonic reorganization in the western interior of North America (Rocky Mountains), involving a shift from the Oligocene thermal phase, with abundant volcanic activity recorded in the thick Frio/Vicksburg succession of the GOM, to the Miocene Basin-Range extensional phase. Climatic conditions also changed from a relatively arid Oligocene to wetter Miocene, resulting in increased sediment yields from exhumed tectonic structures. Previous provenance studies used proportions of quartz, feldspar and lithic fragments and consideration of likely river courses through known paleogeomorphological elements. Only limited detrital zircon (DZ) U-Pb studies on Paleocene strata have been undertaken and there has been no previous U-Pb and (U-Th)/He double dating in the GOM. In this study we apply the latest analytical approaches, such as DZ U-Pb dating to gain robust source terranes ages and more fully elucidate the complex sediment provenance and dispersal history of GOM. We also employ DZ (U-Th)/He (ZHe) dating, combined with DZ U-Pb, to not only define sedimentary provenance but also the exhumation histories of detrital source regions. Samples of lower Miocene outcrop exposures in Texas and Louisiana have been collected to discriminate the varied tectonic and drainage system changes across the basin in lateral. In addition, samples from the Eocene, Oligocene and middle Miocene have been obtained to reveal vertical shift of source terranes contributions. Our initial age data show detrital zircons of lower Miocene sediments come from a wide range of source

  13. Improved Specification of Transboundary Air Pollution over the Gulf of Mexico Using Satellite Observations (United States)

    Pour Biazar, A.; Khan, M. N.; Park, Y. H.; McNider, R. T.; Cameron, B.


    The assessment of potential environmental impact of oil and gas operations in the Gulf of Mexico (GoM) and in particular the onshore air quality impact of such operations is important to State and Federal regulatory agencies. In adapting sound policies for control strategies, it is crucial to assess the impact of local pollution versus transboundary air pollution, and in a region such as GoM with scarce monitoring capability over open waters such distinctions represents a challenge. Furthermore, GoM region can be impacted by the recirculation of pollution in the southeastern United States. The current study examines the efficacy of utilizing the newly available satellite observations of aerosols and trace gases in air quality impacts assessment for addressing these issues. In particular, ozone profiles from the Tropospheric Emission Spectrometer (TES) and Ozone Monitoring Instrument (OMI) onboard Aura and aerosol products from Moderate Resolution Imaging Spectroradiometer (MODIS) onboard Terra and Aqua satellites were utilized in a modeling study during August 2006. The satellite observations were used in the specification of the background and lateral boundary and also once daily for the re-adjustment of the concentration fields. The results were then evaluated against ozonesonde and surface observations. The utilization of OMI ozone profiles significantly improved model performance in the free troposphere and the use of MODIS aerosol products substantially enhanced model prediction of aerosols in the boundary layer. Neither OMI nor TES provide adequate information in the boundary layer with respect to O3 and as a result they can only marginally impact ozone predictions in the boundary layer. The utilization of the satellite data for lateral boundary condition (BC) was helpful in the realization of transboundary transport of pollution. The hypothesis that the recirculation of pollution from Northeast Corridor can play a role over the Gulf of Mexico was tested and

  14. Genetic Connectivity in Scleractinian Corals across the Northern Gulf of Mexico: Oil/Gas Platforms, and Relationship to the Flower Garden Banks


    Sammarco, Paul W.; Brazeau, Daniel A.; Sinclair, James


    The 3,000 oil/gas structures currently deployed in the northern Gulf of Mexico (GOM) provide hard substratum for marine organisms in a region where such has been rare since the Holocene. The major exception to this are the Flower Garden Banks (FGB). Corals are known to have colonized oil/gas platforms around the FGB, facilitating biogeographic expansion. We ask the question, what are the patterns of genetic affinity in these coral populations. We sampled coral tissue from populations of two s...

  15. Metabolic Roles of Uncultivated Bacterioplankton Lineages in the Northern Gulf of Mexico "Dead Zone". (United States)

    Thrash, J Cameron; Seitz, Kiley W; Baker, Brett J; Temperton, Ben; Gillies, Lauren E; Rabalais, Nancy N; Henrissat, Bernard; Mason, Olivia U


    Marine regions that have seasonal to long-term low dissolved oxygen (DO) concentrations, sometimes called "dead zones," are increasing in number and severity around the globe with deleterious effects on ecology and economics. One of the largest of these coastal dead zones occurs on the continental shelf of the northern Gulf of Mexico (nGOM), which results from eutrophication-enhanced bacterioplankton respiration and strong seasonal stratification. Previous research in this dead zone revealed the presence of multiple cosmopolitan bacterioplankton lineages that have eluded cultivation, and thus their metabolic roles in this ecosystem remain unknown. We used a coupled shotgun metagenomic and metatranscriptomic approach to determine the metabolic potential of Marine Group II Euryarchaeota , SAR406, and SAR202. We recovered multiple high-quality, nearly complete genomes from all three groups as well as candidate phyla usually associated with anoxic environments- Parcubacteria (OD1) and Peregrinibacteria Two additional groups with putative assignments to ACD39 and PAUC34f supplement the metabolic contributions by uncultivated taxa. Our results indicate active metabolism in all groups, including prevalent aerobic respiration, with concurrent expression of genes for nitrate reduction in SAR406 and SAR202, and dissimilatory nitrite reduction to ammonia and sulfur reduction by SAR406. We also report a variety of active heterotrophic carbon processing mechanisms, including degradation of complex carbohydrate compounds by SAR406, SAR202, ACD39, and PAUC34f. Together, these data help constrain the metabolic contributions from uncultivated groups in the nGOM during periods of low DO and suggest roles for these organisms in the breakdown of complex organic matter. IMPORTANCE Dead zones receive their name primarily from the reduction of eukaryotic macrobiota (demersal fish, shrimp, etc.) that are also key coastal fisheries. Excess nutrients contributed from anthropogenic activity

  16. Replacement

    Directory of Open Access Journals (Sweden)

    S. Radhakrishnan


    Full Text Available The fishmeal replaced with Spirulina platensis, Chlorella vulgaris and Azolla pinnata and the formulated diet fed to Macrobrachium rosenbergii postlarvae to assess the enhancement ability of non-enzymatic antioxidants (vitamin C and E, enzymatic antioxidants (superoxide dismutase (SOD and catalase (CAT and lipid peroxidation (LPx were analysed. In the present study, the S. platensis, C. vulgaris and A. pinnata inclusion diet fed groups had significant (P < 0.05 improvement in the levels of vitamins C and E in the hepatopancreas and muscle tissue. Among all the diets, the replacement materials in 50% incorporated feed fed groups showed better performance when compared with the control group in non-enzymatic antioxidant activity. The 50% fishmeal replacement (best performance diet fed groups taken for enzymatic antioxidant study, in SOD, CAT and LPx showed no significant increases when compared with the control group. Hence, the present results revealed that the formulated feed enhanced the vitamins C and E, the result of decreased level of enzymatic antioxidants (SOD, CAT and LPx revealed that these feeds are non-toxic and do not produce any stress to postlarvae. These ingredients can be used as an alternative protein source for sustainable Macrobrachium culture.

  17. Blue green alga mediated synthesis of gold nanoparticles and its antibacterial efficacy against Gram positive organisms

    Energy Technology Data Exchange (ETDEWEB)

    Uma Suganya, K.S. [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Govindaraju, K., E-mail: [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Ganesh Kumar, V.; Stalin Dhas, T.; Karthick, V. [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Singaravelu, G. [Nanoscience Division, Department of Zoology, Thiruvalluvar University, Vellore 632115 (India); Elanchezhiyan, M. [Department of Microbiology, Dr ALM Post Graduate Institute of Basic Medical Sciences, University of Madras, Chennai 600113 (India)


    Biofunctionalized gold nanoparticles (AuNPs) play an important role in design and development of nanomedicine. Synthesis of AuNPs from biogenic materials is environmentally benign and possesses high bacterial inhibition and bactericidal properties. In the present study, blue green alga Spirulina platensis protein mediated synthesis of AuNPs and its antibacterial activity against Gram positive bacteria is discussed. AuNPs were characterized using Ultraviolet–visible (UV–vis) spectroscopy, Fluorescence spectroscopy, Fourier Transform-Infrared (FTIR) spectroscopy, Raman spectroscopy, High Resolution-Transmission Electron Microscopy (HR-TEM) and Energy Dispersive X-ray analysis (EDAX). Stable, well defined AuNPs of smaller and uniform shape with an average size of ∼ 5 nm were obtained. The antibacterial efficacy of protein functionalized AuNPs were tested against Gram positive organisms Bacillus subtilis and Staphylococcus aureus. - Highlights: • Size controlled synthesis of gold nanoparticles from blue green alga Spirulina platensis • Stability of gold nanoparticles at different temperatures • Potent antibacterial efficacy against Gram positive organisms.

  18. Los gonfotéridos (Mammalia, Proboscidea de Uruguay: taxonomía, estratigrafía y cronología

    Directory of Open Access Journals (Sweden)

    Perea, D.


    Full Text Available A large sample composed of relatively fragmentary remains of Gomphotheriidae was found in Uruguay. Belonging to this family there are materials assigned to Camacho Formation (Late Miocene, and to Pleistocene to Early Holocene units (Sopas, Libertad and Dolores formations. The Camacho and Sopas formations contain remains of indeterminate Gomphotheriidae, and the species Stegomastodon platensis is identified for the Libertad and Dolores formations. We think taxonomically suitable to support the opinion that all gomphotherids inhabitants of South American plains pertain to the genus Stegomastodon and to consider that species as the only representative of the genus in South America.En Uruguay se han hallado numerosos aunque relativamente fragmentarios restos de Gomphotheriidae. Pertenecientes a esta familia existen materiales asignados a la Formación Camacho (Mioceno tardío, y a unidades del Pleistoceno y Holoceno temprano (formaciones Sopas, Libertad y Dolores. Las formaciones Camacho y Sopas contienen restos de Gomphotheridae indeterminados, mientras que la especie Stegomastodon platensis está identificada para las formaciones Libertad y Dolores. Entendemos taxonómicamente adecuado el criterio de mantener a los gonfotéridos habitantes de las planicies sudamericanas bajo el género Stegomastodon y considerar dicha especie como única representante del género en Sudamérica.

  19. Effects of C-phycocyanin and Spirulina on Salicylate-Induced Tinnitus, Expression of NMDA Receptor and Inflammatory Genes (United States)

    Hwang, Juen-Haur; Chen, Jin-Cherng; Chan, Yin-Ching


    Effects of C-phycocyanin (C-PC), the active component of Spirulina platensis water extract on the expressions of N-methyl D-aspartate receptor subunit 2B (NR2B), tumor necrosis factor–α (TNF-α), interleukin-1β (IL-1β), and cyclooxygenase type 2 (COX-2) genes in the cochlea and inferior colliculus (IC) of mice were evaluated after tinnitus was induced by intraperitoneal injection of salicylate. The results showed that 4-day salicylate treatment (unlike 4-day saline treatment) caused a significant increase in NR2B, TNF-α, and IL-1β mRNAs expression in the cochlea and IC. On the other hand, dietary supplementation with C-PC or Spirulina platensis water extract significantly reduced the salicylate-induced tinnitus and down-regulated the mRNAs expression of NR2B, TNF-α, IL-1β mRNAs, and COX-2 genes in the cochlea and IC of mice. The changes of protein expression levels were generally correlated with those of mRNAs expression levels in the IC for above genes. PMID:23533584

  20. Effects of C-phycocyanin and Spirulina on salicylate-induced tinnitus, expression of NMDA receptor and inflammatory genes.

    Directory of Open Access Journals (Sweden)

    Juen-Haur Hwang

    Full Text Available Effects of C-phycocyanin (C-PC, the active component of Spirulina platensis water extract on the expressions of N-methyl D-aspartate receptor subunit 2B (NR2B, tumor necrosis factor-α (TNF-α, interleukin-1β (IL-1β, and cyclooxygenase type 2 (COX-2 genes in the cochlea and inferior colliculus (IC of mice were evaluated after tinnitus was induced by intraperitoneal injection of salicylate. The results showed that 4-day salicylate treatment (unlike 4-day saline treatment caused a significant increase in NR2B, TNF-α, and IL-1β mRNAs expression in the cochlea and IC. On the other hand, dietary supplementation with C-PC or Spirulina platensis water extract significantly reduced the salicylate-induced tinnitus and down-regulated the mRNAs expression of NR2B, TNF-α, IL-1β mRNAs, and COX-2 genes in the cochlea and IC of mice. The changes of protein expression levels were generally correlated with those of mRNAs expression levels in the IC for above genes.