Comparative interrogation of the developing xylem transcriptomes of two wood-forming species: Populus trichocarpa and Eucalyptus grandis.

Science.gov (United States)

Hefer, Charles A; Mizrachi, Eshchar; Myburg, Alexander A; Douglas, Carl J; Mansfield, Shawn D

2015-06-01

Wood formation is a complex developmental process governed by genetic and environmental stimuli. Populus and Eucalyptus are fast-growing, high-yielding tree genera that represent ecologically and economically important species suitable for generating significant lignocellulosic biomass. Comparative analysis of the developing xylem and leaf transcriptomes of Populus trichocarpa and Eucalyptus grandis together with phylogenetic analyses identified clusters of homologous genes preferentially expressed during xylem formation in both species. A conserved set of 336 single gene pairs showed highly similar xylem preferential expression patterns, as well as evidence of high functional constraint. Individual members of multi-gene orthologous clusters known to be involved in secondary cell wall biosynthesis also showed conserved xylem expression profiles. However, species-specific expression as well as opposite (xylem versus leaf) expression patterns observed for a subset of genes suggest subtle differences in the transcriptional regulation important for xylem development in each species. Using sequence similarity and gene expression status, we identified functional homologs likely to be involved in xylem developmental and biosynthetic processes in Populus and Eucalyptus. Our study suggests that, while genes involved in secondary cell wall biosynthesis show high levels of gene expression conservation, differential regulation of some xylem development genes may give rise to unique xylem properties. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

Gene Structures, Classification, and Expression Models of the DREB Transcription Factor Subfamily in Populus trichocarpa

Directory of Open Access Journals (Sweden)

Yunlin Chen

2013-01-01

Full Text Available We identified 75 dehydration-responsive element-binding (DREB protein genes in Populus trichocarpa. We analyzed gene structures, phylogenies, domain duplications, genome localizations, and expression profiles. The phylogenic construction suggests that the PtrDREB gene subfamily can be classified broadly into six subtypes (DREB A-1 to A-6 in Populus. The chromosomal localizations of the PtrDREB genes indicated 18 segmental duplication events involving 36 genes and six redundant PtrDREB genes were involved in tandem duplication events. There were fewer introns in the PtrDREB subfamily. The motif composition of PtrDREB was highly conserved in the same subtype. We investigated expression profiles of this gene subfamily from different tissues and/or developmental stages. Sixteen genes present in the digital expression analysis had high levels of transcript accumulation. The microarray results suggest that 18 genes were upregulated. We further examined the stress responsiveness of 15 genes by qRT-PCR. A digital northern analysis showed that the PtrDREB17, 18, and 32 genes were highly induced in leaves under cold stress, and the same expression trends were shown by qRT-PCR. Taken together, these observations may lay the foundation for future functional analyses to unravel the biological roles of Populus’ DREB genes.

Overexpression of Populus trichocarpa CYP85A3 promotes growth and biomass production in transgenic trees.

Science.gov (United States)

Jin, Yan-Li; Tang, Ren-Jie; Wang, Hai-Hai; Jiang, Chun-Mei; Bao, Yan; Yang, Yang; Liang, Mei-Xia; Sun, Zhen-Cang; Kong, Fan-Jing; Li, Bei; Zhang, Hong-Xia

2017-10-01

Brassinosteroids (BRs) are essential hormones that play crucial roles in plant growth, reproduction and response to abiotic and biotic stress. In Arabidopsis, AtCYP85A2 works as a bifunctional cytochrome P450 monooxygenase to catalyse the conversion of castasterone to brassinolide, a final rate-limiting step in the BR-biosynthetic pathway. Here, we report the functional characterizations of PtCYP85A3, one of the three AtCYP85A2 homologous genes from Populus trichocarpa. PtCYP85A3 shares the highest similarity with AtCYP85A2 and can rescue the retarded-growth phenotype of the Arabidopsis cyp85a2-2 and tomato d x mutants. Constitutive expression of PtCYP85A3, driven by the cauliflower mosaic virus 35S promoter, increased the endogenous BR levels and significantly promoted the growth and biomass production in both transgenic tomato and poplar. Compared to the wild type, plant height, shoot fresh weight and fruit yield increased 50%, 56% and 43%, respectively, in transgenic tomato plants. Similarly, plant height and stem diameter increased 15% and 25%, respectively, in transgenic poplar plants. Further study revealed that overexpression of PtCYP85A3 enhanced xylem formation without affecting the composition of cellulose and lignin, as well as the cell wall thickness in transgenic poplar. Our finding suggests that PtCYP85A3 could be used as a potential candidate gene for engineering fast-growing trees with improved wood production. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Ozone uptake (flux) as it relates to ozone-induced foliar symptoms of Prunus serotina and Populus maximowizii x trichocarpa

International Nuclear Information System (INIS)

Orendovici-Best, T.; Skelly, J.M.; Davis, D.D.; Ferdinand, J.A.; Savage, J.E.; Stevenson, R.E.

2008-01-01

Field studies were conducted during 2003 and 2004 from early June to the end of August, at 20 sites of lower or higher elevation within north-central Pennsylvania, using seedlings of black cherry (Prunus serotina, Ehrh.) and ramets of hybrid poplar (Populus maximowizii x trichocarpa). A linear model was developed to estimate the influence of local environmental conditions on stomatal conductance. The most significant factors explaining stomatal variance were tree species, air temperature, leaf vapor pressure deficit, elevation, and time of day. Overall, environmental factors explained less than 35% of the variation in stomatal conductance. Ozone did not affect gas exchange rates in either poplar or cherry. Ozone-induced foliar injury was positively correlated with cumulative ozone exposures, expressed as SUM40. Overall, the amount of foliar injury was better correlated to a flux-based approach rather than to an exposure-based approach. More severe foliar injuries were observed on plants growing at higher elevations. - Within heterogeneous environments, ozone flux does not completely explain the variation observed in ozone-induced visible injury

The role of water channel proteins in facilitating recovery of leaf hydraulic conductance from water stress in Populus trichocarpa.

Directory of Open Access Journals (Sweden)

Joan Laur

Full Text Available Gas exchange is constrained by the whole-plant hydraulic conductance (Kplant. Leaves account for an important fraction of Kplant and may therefore represent a major determinant of plant productivity. Leaf hydraulic conductance (Kleaf decreases with increasing water stress, which is due to xylem embolism in leaf veins and/or the properties of the extra-xylary pathway. Water flow through living tissues is facilitated and regulated by water channel proteins called aquaporins (AQPs. Here we assessed changes in the hydraulic conductance of Populus trichocarpa leaves during a dehydration-rewatering episode. While leaves were highly sensitive to drought, Kleaf recovered only 2 hours after plants were rewatered. Recovery of Kleaf was absent when excised leaves were bench-dried and subsequently xylem-perfused with a solution containing AQP inhibitors. We examined the expression patterns of 12 highly expressed AQP genes during a dehydration-rehydration episode to identify isoforms that may be involved in leaf hydraulic adjustments. Among the AQPs tested, several genes encoding tonoplast intrinsic proteins (TIPs showed large increases in expression in rehydrated leaves, suggesting that TIPs contribute to reversing drought-induced reductions in Kleaf. TIPs were localized in xylem parenchyma, consistent with a role in facilitating water exchange between xylem vessels and adjacent living cells. Dye uptake experiments suggested that reversible embolism formation in minor leaf veins contributed to the observed changes in Kleaf.

The role of water channel proteins in facilitating recovery of leaf hydraulic conductance from water stress in Populus trichocarpa.

Science.gov (United States)

Laur, Joan; Hacke, Uwe G

2014-01-01

Gas exchange is constrained by the whole-plant hydraulic conductance (Kplant). Leaves account for an important fraction of Kplant and may therefore represent a major determinant of plant productivity. Leaf hydraulic conductance (Kleaf) decreases with increasing water stress, which is due to xylem embolism in leaf veins and/or the properties of the extra-xylary pathway. Water flow through living tissues is facilitated and regulated by water channel proteins called aquaporins (AQPs). Here we assessed changes in the hydraulic conductance of Populus trichocarpa leaves during a dehydration-rewatering episode. While leaves were highly sensitive to drought, Kleaf recovered only 2 hours after plants were rewatered. Recovery of Kleaf was absent when excised leaves were bench-dried and subsequently xylem-perfused with a solution containing AQP inhibitors. We examined the expression patterns of 12 highly expressed AQP genes during a dehydration-rehydration episode to identify isoforms that may be involved in leaf hydraulic adjustments. Among the AQPs tested, several genes encoding tonoplast intrinsic proteins (TIPs) showed large increases in expression in rehydrated leaves, suggesting that TIPs contribute to reversing drought-induced reductions in Kleaf. TIPs were localized in xylem parenchyma, consistent with a role in facilitating water exchange between xylem vessels and adjacent living cells. Dye uptake experiments suggested that reversible embolism formation in minor leaf veins contributed to the observed changes in Kleaf.

Non-dispersive phloem-protein bodies (NPBs of Populus trichocarpa consist of a SEOR protein and do not respond to cell wounding and Ca2+

Directory of Open Access Journals (Sweden)

Daniel L. Mullendore

2018-04-01

Full Text Available Differentiating sieve elements in the phloem of angiosperms produce abundant phloem-specific proteins before their protein synthesis machinery is degraded. These P-proteins initially form dense bodies, which disperse into individual filaments when the sieve element matures. In some cases, however, the dense protein agglomerations remain intact and are visible in functional sieve tubes as non-dispersive P-protein bodies, or NPBs. Species exhibiting NPBs are distributed across the entire angiosperm clade. We found that NPBs in the model tree, Populus trichocarpa, resemble the protein bodies described from other species of the order Malpighiales as they all consist of coaligned tubular fibrils bundled in hexagonal symmetry. NPBs of all Malpighiales tested proved unresponsive to sieve tube wounding and Ca2+. The P. trichocarpa NPBs consisted of a protein encoded by a gene that in the genome database of this species had been annotated as a homolog of SEOR1 (sieve element occlusion-related 1 in Arabidopsis. Sequencing of the gene in our plants corroborated this interpretation, and we named the gene PtSEOR1. Previously characterized SEOR proteins form irregular masses of P-protein slime in functional sieve tubes. We conclude that a subgroup of these proteins is involved in the formation of NPBs at least in the Malpighiales, and that these protein bodies have no role in rapid wound responses of the sieve tube network.

Insertional mutagenesis in Populus: relevance and feasibility

Science.gov (United States)

Victor Busov; Matthias Fladung; Andrew Groover; Steven Strauss

2005-01-01

The recent sequencing of the first tree genome, that of the black cottonwood (Populus trichocarpa), opens a new chapter in tree functional genomics. While the completion of the genome is a milestone, mobilizing this significant resource for better understanding the growth and development of woody perennials will be an even greater undertaking in the...

Observations on the Early Establishment of Foliar Endophytic Fungi in Leaf Discs and Living Leaves of a Model Woody Angiosperm, Populus trichocarpa (Salicaceae

Directory of Open Access Journals (Sweden)

Yu-Ling Huang

2018-05-01

Full Text Available Fungal endophytes are diverse and widespread symbionts that occur in the living tissues of all lineages of plants without causing evidence of disease. Culture-based and culture-free studies indicate that they often are abundant in the leaves of woody angiosperms, but only a few studies have visualized endophytic fungi in leaf tissues, and the process through which most endophytes colonize leaves has not been studied thoroughly. We inoculated leaf discs and the living leaves of a model woody angiosperm, Populus trichocarpa, which has endophytes that represent three distantly-related genera (Cladosporium, Penicillium, and Trichoderma. We used scanning electron microscopy and light microscopy to evaluate the timeline and processes by which they colonize leaf tissue. Under laboratory conditions with high humidity, conidia germinated on leaf discs to yield hyphae that grew epiphytically and incidentally entered stomata, but did not grow in a directed fashion toward stomatal openings. No cuticular penetration was observed. The endophytes readily colonized the interiors of leaf discs that were detached from living leaves, and could be visualized within discs with light microscopy. Although they were difficult to visualize within the interior of living leaves following in vivo inoculations, standard methods for isolating foliar endophytes confirmed their presence.

Physico-Chemical Properties and Biodegradability of Genetically Modified Populus trichocarpa and Pinus taeda

Science.gov (United States)

Edmunds, Charles Warren

Increasing concerns over greenhouse gas emissions and the finite supply of fossil fuels lead to the goal of utilizing lignocellulosic feedstocks for biofuels, platform chemicals, and biocomposites. Lignin is responsible for the recalcitrance of lignocellulosic biomass and is a major barrier to its deconstruction. Great progress has been made in mapping and modifying the lignin biosynthetic pathway. However, the link between the genetic modification, resulting chemical and physical properties of the wood, and how these properties influence the thermomechanical and recalcitrance to biological and chemical degradation needs further investigation. In this dissertation, the study of modified Populus trichocarpa and Pinus taeda were utilized to accomplish this goal. Thermo-mechanical properties of genetically modified P. trichocarpa with altered lignin content and/or lignin structure were measured with a series of tools including; dynamic mechanical analysis, nuclear magnetic resonance, and wet chemistry techniques. Results demonstrated lignin content and lignin structure likely influence the glass transition temperature (Tg), and that decreased lignin content and the corresponding higher proportion of cell wall carbohydrates may contribute to increased molecular mobility in the wood polymer structure. The effect of lignin biosynthetic pathway modification on biological degradation of these transgenic wood specimens was of interest. However, experimental methods for fungal treatment on small young greenhouse-grown wood specimens are not well established. Therefore, a project was undertaken to develop a method for fungal inoculation and incubation for these unique specimens. Several parameters were tested, and a fungal treatment method was identified with sufficient weight loss after decay and significant reduction in variation of weight loss between replicates compared to previous experiments by direct inoculation of wood with liquid malt extract fungal culture

Comparative genomic analysis of the WRKY III gene family in populus, grape, arabidopsis and rice.

Science.gov (United States)

Wang, Yiyi; Feng, Lin; Zhu, Yuxin; Li, Yuan; Yan, Hanwei; Xiang, Yan

2015-09-08

WRKY III genes have significant functions in regulating plant development and resistance. In plant, WRKY gene family has been studied in many species, however, there still lack a comprehensive analysis of WRKY III genes in the woody plant species poplar, three representative lineages of flowering plant species are incorporated in most analyses: Arabidopsis (a model plant for annual herbaceous dicots), grape (one model plant for perennial dicots) and Oryza sativa (a model plant for monocots). In this study, we identified 10, 6, 13 and 28 WRKY III genes in the genomes of Populus trichocarpa, grape (Vitis vinifera), Arabidopsis thaliana and rice (Oryza sativa), respectively. Phylogenetic analysis revealed that the WRKY III proteins could be divided into four clades. By microsynteny analysis, we found that the duplicated regions were more conserved between poplar and grape than Arabidopsis or rice. We dated their duplications by Ks analysis of Populus WRKY III genes and demonstrated that all the blocks were formed after the divergence of monocots and dicots. Strong purifying selection has played a key role in the maintenance of WRKY III genes in Populus. Tissue expression analysis of the WRKY III genes in Populus revealed that five were most highly expressed in the xylem. We also performed quantitative real-time reverse transcription PCR analysis of WRKY III genes in Populus treated with salicylic acid, abscisic acid and polyethylene glycol to explore their stress-related expression patterns. This study highlighted the duplication and diversification of the WRKY III gene family in Populus and provided a comprehensive analysis of this gene family in the Populus genome. Our results indicated that the majority of WRKY III genes of Populus was expanded by large-scale gene duplication. The expression pattern of PtrWRKYIII gene identified that these genes play important roles in the xylem during poplar growth and development, and may play crucial role in defense to drought

PlantTribes: a gene and gene family resource for comparative genomics in plants

OpenAIRE

Wall, P. Kerr; Leebens-Mack, Jim; Müller, Kai F.; Field, Dawn; Altman, Naomi S.; dePamphilis, Claude W.

2007-01-01

The PlantTribes database (http://fgp.huck.psu.edu/tribe.html) is a plant gene family database based on the inferred proteomes of five sequenced plant species: Arabidopsis thaliana, Carica papaya, Medicago truncatula, Oryza sativa and Populus trichocarpa. We used the graph-based clustering algorithm MCL [Van Dongen (Technical Report INS-R0010 2000) and Enright et al. (Nucleic Acids Res. 2002; 30: 1575–1584)] to classify all of these species’ protein-coding genes into putative gene families, ca...

A 34K SNP genotyping array for Populus trichocarpa: design, application to the study of natural populations and transferability to other Populus species.

Science.gov (United States)

Geraldes, A; Difazio, S P; Slavov, G T; Ranjan, P; Muchero, W; Hannemann, J; Gunter, L E; Wymore, A M; Grassa, C J; Farzaneh, N; Porth, I; McKown, A D; Skyba, O; Li, E; Fujita, M; Klápště, J; Martin, J; Schackwitz, W; Pennacchio, C; Rokhsar, D; Friedmann, M C; Wasteneys, G O; Guy, R D; El-Kassaby, Y A; Mansfield, S D; Cronk, Q C B; Ehlting, J; Douglas, C J; Tuskan, G A

2013-03-01

Genetic mapping of quantitative traits requires genotypic data for large numbers of markers in many individuals. For such studies, the use of large single nucleotide polymorphism (SNP) genotyping arrays still offers the most cost-effective solution. Herein we report on the design and performance of a SNP genotyping array for Populus trichocarpa (black cottonwood). This genotyping array was designed with SNPs pre-ascertained in 34 wild accessions covering most of the species latitudinal range. We adopted a candidate gene approach to the array design that resulted in the selection of 34 131 SNPs, the majority of which are located in, or within 2 kb of, 3543 candidate genes. A subset of the SNPs on the array (539) was selected based on patterns of variation among the SNP discovery accessions. We show that more than 95% of the loci produce high quality genotypes and that the genotyping error rate for these is likely below 2%. We demonstrate that even among small numbers of samples (n = 10) from local populations over 84% of loci are polymorphic. We also tested the applicability of the array to other species in the genus and found that the number of polymorphic loci decreases rapidly with genetic distance, with the largest numbers detected in other species in section Tacamahaca. Finally, we provide evidence for the utility of the array to address evolutionary questions such as intraspecific studies of genetic differentiation, species assignment and the detection of natural hybrids. © 2013 Blackwell Publishing Ltd.

Epigenomics of Development in Populus

Energy Technology Data Exchange (ETDEWEB)

Strauss, Steve; Freitag, Michael; Mockler, Todd

2013-01-10

We conducted research to determine the role of epigenetic modifications during tree development using poplar (Populus trichocarpa), a model woody feedstock species. Using methylated DNA immunoprecipitation (MeDIP) or chromatin immunoprecipitation (ChIP), followed by high-throughput sequencing, we are analyzed DNA and histone methylation patterns in the P. trichocarpa genome in relation to four biological processes: bud dormancy and release, mature organ maintenance, in vitro organogenesis, and methylation suppression. Our project is now completed. We have 1) produced 22 transgenic events for a gene involved in DNA methylation suppression and studied its phenotypic consequences; 2) completed sequencing of methylated DNA from eleven target tissues in wildtype P. trichocarpa; 3) updated our customized poplar genome browser using the open-source software tools (2.13) and (V2.2) of the P. trichocarpa genome; 4) produced summary data for genome methylation in P. trichocarpa, including distribution of methylation across chromosomes and in and around genes; 5) employed bioinformatic and statistical methods to analyze differences in methylation patterns among tissue types; and 6) used bisulfite sequencing of selected target genes to confirm bioinformatics and sequencing results, and gain a higher-resolution view of methylation at selected genes 7) compared methylation patterns to expression using available microarray data. Our main findings of biological significance are the identification of extensive regions of the genome that display developmental variation in DNA methylation; highly distinctive gene-associated methylation profiles in reproductive tissues, particularly male catkins; a strong whole genome/all tissue inverse association of methylation at gene bodies and promoters with gene expression; a lack of evidence that tissue specificity of gene expression is associated with gene methylation; and evidence that genome methylation is a significant impediment to tissue

Increasing the productivity of biomass plantations of Populus species and hybrids in the Pacific Northwest. Final report, September 14, 1981--December 31, 1996

Energy Technology Data Exchange (ETDEWEB)

DeBell, D.S.; Harrington, C.A.; Clendenen, G.W. [USDA Forest Service, Olympia, WA (United States)] [and others

1997-08-01

This final report represents the culmination of eight years of biological research devoted to increasing the productivity of short rotation plantations of Populus trichocarpa and Populus hybrids in the Pacific Northwest. Studies described herein provide an understanding of tree growth, stand development and biomass yield at various spacings, and how patterns thereof differ by Populus clone in monoclonal and polyclonal plantings. Also included is some information about factors related to wind damage in Populus plantings, use of leaf size as a predictor of growth potential, and approaches for estimating tree and stand biomass and biomass growth. The work was accomplished in three research plantations, all established cooperatively with the Washington State Department of Natural Resources (DNR) and located at the DNR Tree Improvement Center near Olympia. The first plantation was established in Spring 1986 to evaluate the highly touted {open_quotes}woodgrass{close_quotes} concept and compare it with more conventional short-rotation management regimes, using two Populus hybrid clones planted at five spacings. Besides providing scientific data to resolve the politicized {open_quotes}wood-grass{close_quotes} dispute, this plantation has furnished excellent data on stand dynamics and woody biomass yield. A second plantation was established at the same time; groups of trees therein received two levels of irrigation and different amounts of four fertilizer amendments, resulting in microsites with diverse moisture and nutrient conditions.

Correlating laser-induced breakdown spectroscopy with neutron activation analysis to determine the elemental concentration in the ionome of the Populus trichocarpa leaf

Science.gov (United States)

Martin, Madhavi Z.; Glasgow, David C.; Tschaplinski, Timothy J.; Tuskan, Gerald A.; Gunter, Lee E.; Engle, Nancy L.; Wymore, Ann M.; Weston, David J.

2017-12-01

The black cottonwood poplar (Populus trichocarpa) leaf ionome (inorganic trace elements and mineral nutrients) is an important aspect for determining the physiological and developmental processes contributing to biomass production. A number of techniques are used to measure the ionome, yet characterizing the leaf spatial heterogeneity remains a challenge, especially in solid samples. Laser-induced breakdown spectroscopy (LIBS) has been used to determine the elemental composition of leaves and is able to raster across solid matrixes at 10 μm resolution. Here, we evaluate the use of LIBS for solid sample leaf elemental characterization in relation to neutron activation. In fact, neutron activation analysis is a laboratory-based technique which is used by the National Institute of Standards and Technology (NIST) to certify trace elements in candidate reference materials including plant leaf matrices. Introduction to the techniques used in this research has been presented in this manuscript. Neutron activation analysis (NAA) data has been correlated to the LIBS spectra to achieve quantification of the elements or ions present within poplar leaves. The regression coefficients of calibration and validation using multivariate analysis (MVA) methodology for six out of seven elements have been determined and vary between 0.810 and 0.998. LIBS and NAA data has been presented for the elements such as, calcium, magnesium, manganese, aluminum, copper, and potassium. Chlorine was also detected but it did not show good correlation between the LIBS and NAA techniques. This research shows that LIBS can be used as a fast, high-spatial resolution technique to quantify elements as part of large-scale field phenotyping projects.

Alanine rich peptide from Populus trichocarpa inhibit growth of Staphylococcus aureus via targetting its extracellular domain of Sensor Histidine Kinase YycGex protein.

Science.gov (United States)

Al Akeel, Raid; Mateen, Ayesha; Syed, Rabbani; Al-Qahtani, Mohammed S; Alqahtani, A

2018-05-11

Due to growing concern towards microbial resistance, ongoing search for developing novel bioactive compounds such as peptides is on rise. The aim of this study was to evaluate antimicrobial effect of Populus trichocarpa extract, chemically identify the active peptide fraction and finds its target in Staphylococcus aureus. In this study the active fraction of P. trichocarpa crude extract was purified and characterized using MS/MS. This peptide PT13 antimicrobial activity was confirmed by in-vitro agar based disk diffusion and in-vivo infection model of G. mellonella. The proteomic expression analysis of S. aureus under influence of PT13 was studied using LTQ-Orbitrap-MS in-solution digestion and identity of target protein was acquired with their quantified expression using label-free approach of Progenesis QI software. Docking study was performed with peptide PT13 and its target YycG protein using CABS-dock. The active fraction PT13 sequence was identified as KVPVAAAAAAAAAVVASSMVVAAAK, with 25 amino acid including 13 alanine having M/Z 2194.2469. PT13 was uniformly inhibited growth S. aureus SA91 and MIC was determined 16 μg/mL for SA91 S. aureus strain. Sensor histidine kinase (YycG) was most significant target found differentially expressed under influence of PT13. G. mellonella larvae were killed rapidly due to S aureus infection, whereas death in protected group was insignificant in compare to control. The docking models showed ten docking models with RMSD value 1.89 for cluster 1 and RMSD value 3.95 for cluster 2 which is predicted to be high quality model. Alanine rich peptide could be useful in constructing as antimicrobial peptide for targeting extracellular Domain of Sensor Histidine Kinase YycG from S. aureus used in the study. Copyright © 2018. Published by Elsevier Ltd.

Light-regulated leaf expansion in two Populus species: dependence on developmentally controlled ion transport.

Science.gov (United States)

Stiles, Kari A; Van Volkenburgh, Elizabeth

2002-07-01

Leaf growth responses to light have been compared in two species of Populus, P. deltoides and P. trichocarpa. These species differ markedly in morphology, anatomy, and dependence on light during leaf expansion. Light stimulates the growth rate and acidification of cell walls in P. trichocarpa but not in P. deltoides, whereas leaves of P. deltoides maintain growth in the dark. Light-induced growth is promoted in P. deltoides when cells are provided 50-100 mM KCl. In both species, light initially depolarizes, then hyperpolarizes mesophyll plasma membranes. However, in the dark, the resting E(m) of mesophyll cells in P. deltoides, but not in P. trichocarpa, is relatively insensitive to decade changes in external [K+]. Results suggest that light-stimulated leaf growth depends on developmentally regulated cellular mechanisms controlling ion fluxes across the plasma membrane. These developmental differences underlie species-level differences in growth and physiological responses to the photoenvironment.

Genome-wide Identification of WRKY Genes in the Desert Poplar Populus euphratica and Adaptive Evolution of the Genes in Response to Salt Stress.

Science.gov (United States)

Ma, Jianchao; Lu, Jing; Xu, Jianmei; Duan, Bingbing; He, Xiaodong; Liu, Jianquan

2015-01-01

WRKY transcription factors play important roles in plant development and responses to various stresses in plants. However, little is known about the evolution of the WRKY genes in the desert poplar species Populus euphratica, which is highly tolerant of salt stress. In this study, we identified 107 PeWRKY genes from the P. euphratica genome and examined their evolutionary relationships with the WRKY genes of the salt-sensitive congener Populus trichocarpa. Ten PeWRKY genes are specific to P. euphratica, and five of these showed altered expression under salt stress. Furthermore, we found that two pairs of orthologs between the two species showed evidence of positive evolution, with dN/dS ratios>1 (nonsynonymous/synonymous substitutions), and both of them altered their expression in response to salinity stress. These findings suggested that both the development of new genes and positive evolution in some orthologs of the WRKY gene family may have played an important role in the acquisition of high salt tolerance by P. euphratica.

Overexpression of PtrMYB119, a R2R3-MYB transcription factor from Populus trichocarpa, promotes anthocyanin production in hybrid poplar.

Science.gov (United States)

Cho, Jin-Seong; Nguyen, Van Phap; Jeon, Hyung-Woo; Kim, Min-Ha; Eom, Seok Hyun; Lim, You Jin; Kim, Won-Chan; Park, Eung-Jun; Choi, Young-Im; Ko, Jae-Heung

2016-09-01

Anthocyanins are a group of colorful and bioactive natural pigments with important physiological and ecological functions in plants. We found an MYB transcription factor (PtrMYB119) from Populus trichocarpa that positively regulates anthocyanin production when expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis Amino acid sequence analysis revealed that PtrMYB119 is highly homologous to Arabidopsis PAP1 (PRODUCTION OF ANTHOCYANIN PIGMENT1), a well-known transcriptional activator of anthocyanin biosynthesis. Independently produced transgenic poplars overexpressing PtrMYB119 or PtrMYB120 (a paralogous gene to PtrMYB119) (i.e., 35S::PtrMYB119 and 35S::PtrMYB120, respectively) showed elevated accumulation of anthocyanins in the whole plants, including leaf, stem and even root tissues. Using a reverse-phase high-performance liquid chromatography, we confirmed that the majority of the accumulated anthocyanin in our transgenic poplar is cyanidin-3-O-glucoside. Gene expression analyses revealed that most of the genes involved in the anthocyanin biosynthetic pathway were highly upregulated in 35S::PtrMYB119 poplars compared with the nontransformed control poplar. Among these genes, expression of PtrCHS1 (Chalcone Synthase1) and PtrANS2 (Anthocyanin Synthase2), which catalyze the initial and last steps of anthocyanin biosynthesis, respectively, was upregulated by up to 350-fold. Subsequent transient activation assays confirmed that PtrMYB119 activated the transcription of both PtrCHS1 and PtrANS2 Interestingly, expression of MYB182, a repressor of both anthocyanin and proanthocyanidin (PA) biosynthesis, was largely suppressed in 35S::PtrMYB119 poplars, while expression of MYB134, an activator of PA biosynthesis, was not changed significantly. More interestingly, high-level accumulation of anthocyanins in 35S::PtrMYB119 poplars did not have an adverse effect on plant growth. Taken together, our results demonstrate that PtrMYB119 and PtrMYB120

Phylogenetic analysis, subcellular localization, and expression patterns of RPD3/HDA1 family histone deacetylases in plants

OpenAIRE

Alinsug, Malona V; Yu, Chun-Wei; Wu, Keqiang

2009-01-01

Abstract Background Although histone deacetylases from model organisms have been previously identified, there is no clear basis for the classification of histone deacetylases under the RPD3/HDA1 superfamily, particularly on plants. Thus, this study aims to reconstruct a phylogenetic tree to determine evolutionary relationships between RPD3/HDA1 histone deacetylases from six different plants representing dicots with Arabidopsis thaliana, Populus trichocarpa, and Pinus taeda, monocots with Oryz...

Stock characterization and improvement: DNA fingerprinting and cold tolerance of Populus and Salix clones

Energy Technology Data Exchange (ETDEWEB)

Lin, Dolly; Hubbes, M.; Zsuffa, L. [Toronto Univ., ON (Canada). Faculty of Forestry; Tsarouhas, V.; Gullberg, U. [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Genetics; Howe, G.; Hackett, W.; Gardner, G.; Furnier, G. [Minnesota Univ., St. Paul, MN (United States). Dept. of Forest Resources; Tuskan, G. [Oak Ridge National Lab., TN (United States)

1998-12-31

Molecular characterization of advanced-generation pedigrees and evaluation of cold tolerance are two aspects of Populus and Salix genetic improvement programmes worldwide that have traditionally received little emphasis. As such, chloroplast DNA markers were tested as a means of determining multi-generation parental contributions to hybrid progeny. Likewise, greenhouse, growth chamber and field studies were used to assess cold tolerance in Populus and Salix. Chloroplast DNA markers did not reveal size polymorphisms among four tested Populus species, but did produce sequence polymorphisms between P. maximowiczii and P. trichocarpa. Additional crosses between multiple genotypes from each species are being used to evaluate the utility of the detected polymorphism for ascertaining parentage within interspecific crosses. Short-day, cold tolerance greenhouse studies revealed that bud set date and frost damage are moderately heritable and genetically correlated in Populus. The relationship between greenhouse and field studies suggests that factors other than short days contribute to cold tolerance in Populus. In Salix, response to artificial fall conditioning varied among full-sibling families, with the fastest growing family displaying the greatest amount of cold tolerance 26 refs, 3 tabs

Aldehyde Dehydrogenase Gene Superfamily in Populus: Organization and Expression Divergence between Paralogous Gene Pairs.

Science.gov (United States)

Tian, Feng-Xia; Zang, Jian-Lei; Wang, Tan; Xie, Yu-Li; Zhang, Jin; Hu, Jian-Jun

2015-01-01

Aldehyde dehydrogenases (ALDHs) constitute a superfamily of NAD(P)+-dependent enzymes that catalyze the irreversible oxidation of a wide range of reactive aldehydes to their corresponding nontoxic carboxylic acids. ALDHs have been studied in many organisms from bacteria to mammals; however, no systematic analyses incorporating genome organization, gene structure, expression profiles, and cis-acting elements have been conducted in the model tree species Populus trichocarpa thus far. In this study, a comprehensive analysis of the Populus ALDH gene superfamily was performed. A total of 26 Populus ALDH genes were found to be distributed across 12 chromosomes. Genomic organization analysis indicated that purifying selection may have played a pivotal role in the retention and maintenance of PtALDH gene families. The exon-intron organizations of PtALDHs were highly conserved within the same family, suggesting that the members of the same family also may have conserved functionalities. Microarray data and qRT-PCR analysis indicated that most PtALDHs had distinct tissue-specific expression patterns. The specificity of cis-acting elements in the promoter regions of the PtALDHs and the divergence of expression patterns between nine paralogous PtALDH gene pairs suggested that gene duplications may have freed the duplicate genes from the functional constraints. The expression levels of some ALDHs were up- or down-regulated by various abiotic stresses, implying that the products of these genes may be involved in the adaptation of Populus to abiotic stresses. Overall, the data obtained from our investigation contribute to a better understanding of the complexity of the Populus ALDH gene superfamily and provide insights into the function and evolution of ALDH gene families in vascular plants.

Aldehyde Dehydrogenase Gene Superfamily in Populus: Organization and Expression Divergence between Paralogous Gene Pairs.

Directory of Open Access Journals (Sweden)

Feng-Xia Tian

Full Text Available Aldehyde dehydrogenases (ALDHs constitute a superfamily of NAD(P+-dependent enzymes that catalyze the irreversible oxidation of a wide range of reactive aldehydes to their corresponding nontoxic carboxylic acids. ALDHs have been studied in many organisms from bacteria to mammals; however, no systematic analyses incorporating genome organization, gene structure, expression profiles, and cis-acting elements have been conducted in the model tree species Populus trichocarpa thus far. In this study, a comprehensive analysis of the Populus ALDH gene superfamily was performed. A total of 26 Populus ALDH genes were found to be distributed across 12 chromosomes. Genomic organization analysis indicated that purifying selection may have played a pivotal role in the retention and maintenance of PtALDH gene families. The exon-intron organizations of PtALDHs were highly conserved within the same family, suggesting that the members of the same family also may have conserved functionalities. Microarray data and qRT-PCR analysis indicated that most PtALDHs had distinct tissue-specific expression patterns. The specificity of cis-acting elements in the promoter regions of the PtALDHs and the divergence of expression patterns between nine paralogous PtALDH gene pairs suggested that gene duplications may have freed the duplicate genes from the functional constraints. The expression levels of some ALDHs were up- or down-regulated by various abiotic stresses, implying that the products of these genes may be involved in the adaptation of Populus to abiotic stresses. Overall, the data obtained from our investigation contribute to a better understanding of the complexity of the Populus ALDH gene superfamily and provide insights into the function and evolution of ALDH gene families in vascular plants.

Leaf anatomical changes in Populus trichocarpa, Quercus rubra, Pseudotsuga menziesii and Pinus ponderosa exposed to enhanced ultraviolet-B radiation

International Nuclear Information System (INIS)

Nagel, L.M.; Bassman, J.H.; Edwards, G.E.; Robberecht, R.; Franceshi, V.R.

1998-01-01

Leaf anatomical characteristics are important in determining the degree of injury sustained when plants are exposed to natural and enhanced levels of ultraviolet-B (UV-B) radiation (280–320 nm). The degree to which leaf anatomy can adapt to the increasing levels of UV-B radiation reaching the earth's surface is poorly understood in most tree species. We examined four tree species, representing a wide range of leaf anatomical characteristics, to determine responses of leaf area, specific leaf weight, and leaf tissue parameters after exposure to ambient and enhanced levels of UV-B radiation. Seedlings were grown in a greenhouse with photosynthetically active radiation of 39 mol m −2 day −1 and under one of three daily irradiances of biologically effective UV-B radiation (UV-BBE) supplied for 10 h per day: (1) approximate ambient level received at Pullman, Washington on June 21 (1 x ); two times ambient (2 x ), or three times ambient (3 x ). We hypothesized the response of each species to UV-B radiation would be related to inherent anatomical differences. We found that the conifers responded anatomically to nearly an equal degree as the broad-leaved trees, but that different tissues were involved. Populus trichocarpa, an indeterminate broadleaf species, showed significantly thicker palisade parenchyma in recently mature leaves at the 3 x level and in older leaves under the 2 x level. In addition, individual leaf area was generally greater with increased UV-B irradiance. Quercus rubra, a semi-determinate broadleaf species, exhibited significantly thicker palisade parenchyma at the 2 x and 3 x levels as compared to controls. Psuedotsuga menziesii, an evergreen coniferous species with bifacially flattened needles, and Pinus ponderosa, an evergreen coniferous species with a complete hypodermis, showed no significant change in leaf area or specific leaf weight under enhanced UV-B radiation. Epidermal thickness was unchanged in P. menziesii. However, P. ponderosa

Variable Nitrogen Fixation in Wild Populus.

Directory of Open Access Journals (Sweden)

Sharon L Doty

Full Text Available The microbiome of plants is diverse, and like that of animals, is important for overall health and nutrient acquisition. In legumes and actinorhizal plants, a portion of essential nitrogen (N is obtained through symbiosis with nodule-inhabiting, N2-fixing microorganisms. However, a variety of non-nodulating plant species can also thrive in natural, low-N settings. Some of these species may rely on endophytes, microorganisms that live within plants, to fix N2 gas into usable forms. Here we report the first direct evidence of N2 fixation in the early successional wild tree, Populus trichocarpa, a non-leguminous tree, from its native riparian habitat. In order to measure N2 fixation, surface-sterilized cuttings of wild poplar were assayed using both 15N2 incorporation and the commonly used acetylene reduction assay. The 15N label was incorporated at high levels in a subset of cuttings, suggesting a high level of N-fixation. Similarly, acetylene was reduced to ethylene in some samples. The microbiota of the cuttings was highly variable, both in numbers of cultured bacteria and in genetic diversity. Our results indicated that associative N2-fixation occurred within wild poplar and that a non-uniformity in the distribution of endophytic bacteria may explain the variability in N-fixation activity. These results point to the need for molecular studies to decipher the required microbial consortia and conditions for effective endophytic N2-fixation in trees.

Natural Selection and Recombination Rate Variation Shape Nucleotide Polymorphism Across the Genomes of Three Related Populus Species.

Science.gov (United States)

Wang, Jing; Street, Nathaniel R; Scofield, Douglas G; Ingvarsson, Pär K

2016-03-01

A central aim of evolutionary genomics is to identify the relative roles that various evolutionary forces have played in generating and shaping genetic variation within and among species. Here we use whole-genome resequencing data to characterize and compare genome-wide patterns of nucleotide polymorphism, site frequency spectrum, and population-scaled recombination rates in three species of Populus: Populus tremula, P. tremuloides, and P. trichocarpa. We find that P. tremuloides has the highest level of genome-wide variation, skewed allele frequencies, and population-scaled recombination rates, whereas P. trichocarpa harbors the lowest. Our findings highlight multiple lines of evidence suggesting that natural selection, due to both purifying and positive selection, has widely shaped patterns of nucleotide polymorphism at linked neutral sites in all three species. Differences in effective population sizes and rates of recombination largely explain the disparate magnitudes and signatures of linked selection that we observe among species. The present work provides the first phylogenetic comparative study on a genome-wide scale in forest trees. This information will also improve our ability to understand how various evolutionary forces have interacted to influence genome evolution among related species. Copyright © 2016 by the Genetics Society of America.

Microsatellite DNA fingerprinting, differentiation, and genetic relationships of clones, cultivars, and varieties of six poplar species from three sections of the genus Populus.

Science.gov (United States)

Rahman, Muhammad H; Rajora, Om P

2002-12-01

Accurate identification of Populus clones and cultivars is essential for effective selection, breeding, and genetic resource management programs. The unit of cultivation and breeding in poplars is a clone, and individual cultivars are normally represented by a single clone. Microsatellite DNA markers of 10 simple sequence repeat loci were used for genetic fingerprinting and differentiation of 96 clones/cultivars and varieties belonging to six Populus species (P. deltoides, P. nigra, P. balsamifera, P. trichocarpa, P. grandidentata, and P maximowiczii) from three sections of the genus. All 96 clones/cultivars could be uniquely fingerprinted based on their single- or multilocus microsatellite genotypes. The five P. grandidentata clones could be differentiated based on their single-locus genotypes, while six clones of P. trichocarpa and 11 clones of P. maximowiczii could be identified by their two-locus genotypes. Twenty clones of P. deltoides and 25 clones of P. nigra could be differentiated by their multilocus genotypes employing three loci, and 29 clones of P. balsamifera required the use of multilocus genotypes at five loci for their genetic fingerprinting and differentiation. The loci PTR3, PTR5, and PTR7 were found to be the most informative for genetic fingerprinting and differentiation of the clones. The mean number of alleles per locus ranged from 2.9 in P. trichocarpa or P. grandidentata to 6.0 in P. balsamifera and 11.2 in 96 clones of the six species. The mean number of observed genotypes per locus ranged from 2.4 in P. grandidentata to 7.4 in P. balsamifera and 19.6 in 96 clones of the six species. The mean number of unique genotypes per locus ranged from 1.3 in P. grandidentata to 3.9 in P. deltoides and 8.8 in 96 clones of the six species. The power of discrimination of the microsatellite DNA markers in the 96 clones ranged from 0.726 for PTR4 to 0.939 for PTR7, with a mean of 0.832 over the 10 simple sequence repeat loci. Clones/cultivars from the same

SPTEdb: a database for transposable elements in salicaceous plants

Science.gov (United States)

Jia, Zirui; Xiao, Yao; Ma, Wenjun; Wang, Junhui

2018-01-01

Abstract Although transposable elements (TEs) play significant roles in structural, functional and evolutionary dynamics of the salicaceous plants genome and the accurate identification, definition and classification of TEs are still inadequate. In this study, we identified 18 393 TEs from Populus trichocarpa, Populus euphratica and Salix suchowensis using a combination of signature-based, similarity-based and De novo method, and annotated them into 1621 families. A comprehensive and user-friendly web-based database, SPTEdb, was constructed and served for researchers. SPTEdb enables users to browse, retrieve and download the TEs sequences from the database. Meanwhile, several analysis tools, including BLAST, HMMER, GetORF and Cut sequence, were also integrated into SPTEdb to help users to mine the TEs data easily and effectively. In summary, SPTEdb will facilitate the study of TEs biology and functional genomics in salicaceous plants. Database URL: http://genedenovoweb.ticp.net:81/SPTEdb/index.php PMID:29688371

Intron-mediated alternative splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B regulates cell wall thickening during fiber development in Populus species.

Science.gov (United States)

Zhao, Yunjun; Sun, Jiayan; Xu, Peng; Zhang, Rui; Li, Laigeng

2014-02-01

Alternative splicing is an important mechanism involved in regulating the development of multicellular organisms. Although many genes in plants undergo alternative splicing, little is understood of its significance in regulating plant growth and development. In this study, alternative splicing of black cottonwood (Populus trichocarpa) wood-associated NAC domain transcription factor (PtrWNDs), PtrWND1B, is shown to occur exclusively in secondary xylem fiber cells. PtrWND1B is expressed with a normal short-transcript PtrWND1B-s as well as its alternative long-transcript PtrWND1B-l. The intron 2 structure of the PtrWND1B gene was identified as a critical sequence that causes PtrWND1B alternative splicing. Suppression of PtrWND1B expression specifically inhibited fiber cell wall thickening. The two PtrWND1B isoforms play antagonistic roles in regulating cell wall thickening during fiber cell differentiation in Populus spp. PtrWND1B-s overexpression enhanced fiber cell wall thickening, while overexpression of PtrWND1B-l repressed fiber cell wall thickening. Alternative splicing may enable more specific regulation of processes such as fiber cell wall thickening during wood formation.

Intron-Mediated Alternative Splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B Regulates Cell Wall Thickening during Fiber Development in Populus Species1[W

Science.gov (United States)

Zhao, Yunjun; Sun, Jiayan; Xu, Peng; Zhang, Rui; Li, Laigeng

2014-01-01

Alternative splicing is an important mechanism involved in regulating the development of multicellular organisms. Although many genes in plants undergo alternative splicing, little is understood of its significance in regulating plant growth and development. In this study, alternative splicing of black cottonwood (Populus trichocarpa) wood-associated NAC domain transcription factor (PtrWNDs), PtrWND1B, is shown to occur exclusively in secondary xylem fiber cells. PtrWND1B is expressed with a normal short-transcript PtrWND1B-s as well as its alternative long-transcript PtrWND1B-l. The intron 2 structure of the PtrWND1B gene was identified as a critical sequence that causes PtrWND1B alternative splicing. Suppression of PtrWND1B expression specifically inhibited fiber cell wall thickening. The two PtrWND1B isoforms play antagonistic roles in regulating cell wall thickening during fiber cell differentiation in Populus spp. PtrWND1B-s overexpression enhanced fiber cell wall thickening, while overexpression of PtrWND1B-l repressed fiber cell wall thickening. Alternative splicing may enable more specific regulation of processes such as fiber cell wall thickening during wood formation. PMID:24394777

Overexpression of the PtSOS2 gene improves tolerance to salt stress in transgenic poplar plants.

Science.gov (United States)

Yang, Yang; Tang, Ren-Jie; Jiang, Chun-Mei; Li, Bei; Kang, Tao; Liu, Hua; Zhao, Nan; Ma, Xu-Jun; Yang, Lei; Chen, Shao-Liang; Zhang, Hong-Xia

2015-09-01

In higher plants, the salt overly sensitive (SOS) signalling pathway plays a crucial role in maintaining ion homoeostasis and conferring salt tolerance under salinity condition. Previously, we functionally characterized the conserved SOS pathway in the woody plant Populus trichocarpa. In this study, we demonstrate that overexpression of the constitutively active form of PtSOS2 (PtSOS2TD), one of the key components of this pathway, significantly increased salt tolerance in aspen hybrid clone Shanxin Yang (Populus davidiana × Populus bolleana). Compared to the wild-type control, transgenic plants constitutively expressing PtSOS2TD exhibited more vigorous growth and produced greater biomass in the presence of high concentrations of NaCl. The improved salt tolerance was associated with a decreased Na(+) accumulation in the leaves of transgenic plants. Further analyses revealed that plasma membrane Na(+) /H(+) exchange activity and Na(+) efflux in transgenic plants were significantly higher than those in the wild-type plants. Moreover, transgenic plants showed improved capacity in scavenging reactive oxygen species (ROS) generated by salt stress. Taken together, our results suggest that PtSOS2 could serve as an ideal target gene to genetically engineer salt-tolerant trees. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Contrasting patterns of cytokinins between years in senescing aspen leaves

Czech Academy of Sciences Publication Activity Database

Edlund, E.; Novák, Ondřej; Karady, M.; Ljung, K.; Jansson, S.

2017-01-01

Roč. 40, č. 5 (2017), s. 622-634 ISSN 0140-7791 R&D Projects: GA ČR GA14-34792S; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : leaf senescence * arabidopsis-thaliana * autumn senescence * gene-expression * populus-trichocarpa * mass-spectrometry * tobacco plants * translocation * biosynthesis * identification * autumn senescence * gene expression * metabolism * Populus tremula * profiling Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Plant sciences, botany Impact factor: 6.173, year: 2016

Partitioning of Multivariate Phenotypes using Regression Trees Reveals Complex Patterns of Adaptation to Climate across the Range of Black Cottonwood (Populus trichocarpa

Directory of Open Access Journals (Sweden)

Regis Wendpouire Oubida

2015-03-01

Full Text Available Local adaptation to climate in temperate forest trees involves the integration of multiple physiological, morphological, and phenological traits. Latitudinal clines are frequently observed for these traits, but environmental constraints also track longitude and altitude. We combined extensive phenotyping of 12 candidate adaptive traits, multivariate regression trees, quantitative genetics, and a genome-wide panel of SNP markers to better understand the interplay among geography, climate, and adaptation to abiotic factors in Populus trichocarpa. Heritabilities were low to moderate (0.13 to 0.32 and population differentiation for many traits exceeded the 99th percentile of the genome-wide distribution of FST, suggesting local adaptation. When climate variables were taken as predictors and the 12 traits as response variables in a multivariate regression tree analysis, evapotranspiration (Eref explained the most variation, with subsequent splits related to mean temperature of the warmest month, frost-free period (FFP, and mean annual precipitation (MAP. These grouping matched relatively well the splits using geographic variables as predictors: the northernmost groups (short FFP and low Eref had the lowest growth, and lowest cold injury index; the southern British Columbia group (low Eref and intermediate temperatures had average growth and cold injury index; the group from the coast of California and Oregon (high Eref and FFP had the highest growth performance and the highest cold injury index; and the southernmost, high-altitude group (with high Eref and low FFP performed poorly, had high cold injury index, and lower water use efficiency. Taken together, these results suggest variation in both temperature and water availability across the range shape multivariate adaptive traits in poplar.

Identification of Quantitative Trait Loci (QTL) and Candidate Genes for Cadmium Tolerance in Populus

Energy Technology Data Exchange (ETDEWEB)

Induri, Brahma R [West Virginia University; Ellis, Danielle R [West Virginia University; Slavov, Gancho [West Virginia University; Yin, Tongming [ORNL; Muchero, Wellington [ORNL; Tuskan, Gerald A [ORNL; DiFazio, Stephen P [West Virginia University

2012-01-01

Knowledge of genetic variation in response of Populus to heavy metals like cadmium (Cd) is an important step in understanding the underlying mechanisms of tolerance. In this study, a pseudo-backcross pedigree of Populus trichocarpa and Populus deltoides was characterized for Cd exposure. The pedigree showed significant variation for Cd tolerance thus enabling the identification of relatively tolerant and susceptible genotypes for intensive characterization. A total of 16 QTLs at logarithm of odds (LOD) ratio > 2.5, were found to be associated with total dry weight, its components, and root volume. Four major QTLs for total dry weight were mapped to different linkage groups in control (LG III) and Cd conditions (LG XVI) and had opposite allelic effects on Cd tolerance, suggesting that these genomic regions were differentially controlled. The phenotypic variation explained by Cd QTL for all traits under study varied from 5.9% to 11.6% and averaged 8.2% across all QTL. Leaf Cd contents also showed significant variation suggesting the phytoextraction potential of Populus genotypes, though heritability of this trait was low (0.22). A whole-genome microarray study was conducted by using two genotypes with extreme responses for Cd tolerance in the above study and differentially expressed genes were identified. Candidate genes including CAD2 (CADMIUM SENSITIVE 2), HMA5 (HEAVY METAL ATPase5), ATGTST1 (Arabidopsis thaliana Glutathione S-Transferase1), ATGPX6 (Glutathione peroxidase 6), and ATMRP 14 (Arabidopsis thaliana Multidrug Resistance associated Protein 14) were identified from QTL intervals and microarray study. Functional characterization of these candidate genes could enhance phytoremediation capabilities of Populus.

Differentiation of Populus species using chloroplast single nucleotide polymorphism (SNP) markers--essential for comprehensible and reliable poplar breeding.

Science.gov (United States)

Schroeder, H; Hoeltken, A M; Fladung, M

2012-03-01

Within the genus Populus several species belonging to different sections are cross-compatible. Hence, high numbers of interspecies hybrids occur naturally and, additionally, have been artificially produced in huge breeding programmes during the last 100 years. Therefore, determination of a single poplar species, used for the production of 'multi-species hybrids' is often difficult, and represents a great challenge for the use of molecular markers in species identification. Within this study, over 20 chloroplast regions, both intergenic spacers and coding regions, have been tested for their ability to differentiate different poplar species using 23 already published barcoding primer combinations and 17 newly designed primer combinations. About half of the published barcoding primers yielded amplification products, whereas the new primers designed on the basis of the total sequenced cpDNA genome of Populus trichocarpa Torr. & Gray yielded much higher amplification success. Intergenic spacers were found to be more variable than coding regions within the genus Populus. The highest discrimination power of Populus species was found in the combination of two intergenic spacers (trnG-psbK, psbK-psbl) and the coding region rpoC. In barcoding projects, the coding regions matK and rbcL are often recommended, but within the genus Populus they only show moderate variability and are not efficient in species discrimination. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.

Genome-wide analysis of SINA family in plants and their phylogenetic relationships.

Science.gov (United States)

Wang, Meng; Jin, Ying; Fu, Junjie; Zhu, Yun; Zheng, Jun; Hu, Jian; Wang, Guoying

2008-06-01

SINA genes in plants are part of a multigene family with 5 members in Arabidopsis thaliana, 10 members in Populus trichocarpa, 6 members in Oryza sativa, at least 6 members in Zea mays and at least 1 member in Physcomitrella patens. Six members in maize were confirmed by RT-PCR. All SINAs have one RING domain and one SINA domain. These two domains are highly conserved in plants. According to the motif organization and phylogenetic tree, SINA family members were divided into 2 groups. In addition, through semi-quantitative RT-PCR analysis of maize members and Digital Northern analysis of Arabidopsis and rice members, we found that the tissue expression patterns are more diverse in monocot than in Arabidopsis.

Structure and vascular tissue expression of duplicated TERMINAL EAR1-like paralogues in poplar.

Science.gov (United States)

Charon, Céline; Vivancos, Julien; Mazubert, Christelle; Paquet, Nicolas; Pilate, Gilles; Dron, Michel

2010-02-01

TERMINAL EAR1-like (TEL) genes encode putative RNA-binding proteins only found in land plants. Previous studies suggested that they may regulate tissue and organ initiation in Poaceae. Two TEL genes were identified in both Populus trichocarpa and the hybrid aspen Populus tremula x P. alba, named, respectively, PoptrTEL1-2 and PtaTEL1-2. The analysis of the organisation around the PoptrTEL genes in the P. trichocarpa genome and the estimation of the synonymous substitution rate for PtaTEL1-2 genes indicate that the paralogous link between these two Populus TEL genes probably results from the Salicoid large-scale gene-duplication event. Phylogenetic analyses confirmed their orthology link with the other TEL genes. The expression pattern of both PtaTEL genes appeared to be restricted to the mother cells of the plant body: leaf founder cells, leaf primordia, axillary buds and root differentiating tissues, as well as to mother cells of vascular tissues. Most interestingly, PtaTEL1-2 transcripts were found in differentiating cells of secondary xylem and phloem, but probably not in the cambium itself. Taken together, these results indicate specific expression of the TEL genes in differentiating cells controlling tissue and organ development in Populus (and other Angiosperm species).

Gibberellins in shoots and developing capsules of Populus species.

Science.gov (United States)

Pearce, David W; Hutt, Oliver E; Rood, Stewart B; Mander, Lewis N

2002-03-01

Extracts of stems of growing shoots of Populus deltoides and P. trichocarpa, and developing capsules of P. deltoides were analysed for gibberellins (GAs) by gas chromatography-mass spectrometry. The following known GAs were identified by comparison of their Kovats retention indices (KRIs) and mass spectra with those of standards: GA1, GA8, GA9, GA19, GA20, 16 beta,17-dihydro-17-hydroxy GA20, GA23, GA28, GA29, GA34, GA44, and GA97. Several of these have not been previously reported from Populus. In addition, two new GAs were identified as 12 beta-hydroxy GA53 (GA127) and 16 beta,17-dihydro-17-hydroxy GA53 and their structures were confirmed by partial synthesis. Evidence was found of 16,17-dihydro-16,17-dihydroxy GA9, 16,17-dihydro-16,17-dihydroxy GA12, 12-hydroxy GA14, and GA34-catabolite by comparison of mass spectra and KRIs with published data. Several putative GAs (hydroxy- and dihydroxy-GA12-like) were also found. The catabolites of active GAs or of key precursors, hydroxylated at C-2 in stems and either C-2, C-12, C-17, or C-16,17 in capsules, were the major proportion of the GAs.

Growth of Populus and Salix Species under Compost Leachate Irrigation

OpenAIRE

Tooba Abedi; Shamim Moghaddami; Ebrahim Lashkar Bolouki

2014-01-01

According to the known broad variation in remediation capacity, three plant species were used in the experiment: two fast growing poplar’s clones - Populus deltoides, Populus euramericana, and willows Salix alba. Populus and Salix cuttings were collected from the nursery of the Populus Research Center of Safrabasteh in the eastern part of Guilan province at north of Iran. The Populus clones were chosen because of their high biomass production capacity and willow- because it is native in Iran....

Sex-Specific Response to Stress in Populus

Directory of Open Access Journals (Sweden)

Nataliya V. Melnikova

2017-10-01

Full Text Available Populus is an effective model for genetic studies in trees. The genus Populus includes dioecious species, and the differences exhibited in males and females have been intensively studied. This review focused on the distinctions between male and female poplar and aspen plants under stress conditions, such as drought, salinity, heavy metals, and nutrient deficiency on morphological, physiological, proteome, and gene expression levels. In most studies, males of Populus species were more adaptive to the majority of the stress conditions and showed less damage, better growth, and higher photosynthetic capacity and antioxidant activity than that of the females. However, in two recent studies, no differences in non-reproductive traits were revealed for male and female trees. This discrepancy of the results could be associated with experimental design: different species and genotypes, stress conditions, types of plant materials, sampling sizes. Knowledge of sex-specific differences is crucial for basic and applied research in Populus species.

Thidiazuron: A potent cytokinin for efficient plant regeneration in Himalayan poplar (Populus ciliata Wall. using leaf explants

Directory of Open Access Journals (Sweden)

Gaurav Aggarwal

2012-11-01

Full Text Available Populus species are important resource for certain branches of industry and have special roles for scientific study on biological and agricultural systems. The present investigation was undertaken with an objective of enhancing the frequency of plant regeneration in Himalayan poplar (Populus ciliata Wall.. The effect of Thiadizuron (TDZ alone and in combination with adenine and α-Naphthalene acetic acid (NAA were studied on the regeneration potential of leaf explants. A high efficiency of shoot regeneration was observed in leaf (80.00% explants on MS basal medium supplemented with 0.024 mg/l TDZ and 79.7 mg/l adenine. Elongation and multiplication of shoots were obtained on Murashige and Skoog (MS basal medium, containing 0.5 mg/l 6. Benzyl aminopurine (BAP + 0.2mg/l Indole 3-acetic acid (IAA + 0.3 mg/l Gibberellic acid (GA3. High frequency root regeneration from in vitro developed shoots was observed on MS basal medium supplemented with 0.10 mg/l Indole 3-butyric acid(IBA. Maximum of the in vitro rooted plantlets were well accomplished to the mixture of sand: soil (1:1 and exhibited similar morphology with the field plants. A high efficiency plant regeneration protocol has been developedfrom leaf explants in Himalayan poplar (Populus ciliata Wall..

Dragon TIS Spotter: An Arabidopsis-derived predictor of translation initiation sites in plants

KAUST Repository

Magana-Mora, Arturo; Ashoor, Haitham; Jankovic, Boris R.; Kamau, Allan; Awara, Karim; Chowdhary, Rajesh; Archer, John A.C.; Bajic, Vladimir B.

2012-01-01

In higher eukaryotes, the identification of translation initiation sites (TISs) has been focused on finding these signals in cDNA or mRNA sequences. Using Arabidopsis thaliana (A.t.) information, we developed a prediction tool for signals within genomic sequences of plants that correspond to TISs. Our tool requires only genome sequence, not expressed sequences. Its sensitivity/specificity is for A.t. (90.75%/92.2%), for Vitis vinifera (66.8%/94.4%) and for Populus trichocarpa (81.6%/94.4%), which suggests that our tool can be used in annotation of different plant genomes. We provide a list of features used in our model. Further study of these features may improve our understanding of mechanisms of the translation initiation. The Author(s) 2012. Published by Oxford University Press.

Dragon TIS Spotter: An Arabidopsis-derived predictor of translation initiation sites in plants

KAUST Repository

Magana-Mora, Arturo

2012-10-30

In higher eukaryotes, the identification of translation initiation sites (TISs) has been focused on finding these signals in cDNA or mRNA sequences. Using Arabidopsis thaliana (A.t.) information, we developed a prediction tool for signals within genomic sequences of plants that correspond to TISs. Our tool requires only genome sequence, not expressed sequences. Its sensitivity/specificity is for A.t. (90.75%/92.2%), for Vitis vinifera (66.8%/94.4%) and for Populus trichocarpa (81.6%/94.4%), which suggests that our tool can be used in annotation of different plant genomes. We provide a list of features used in our model. Further study of these features may improve our understanding of mechanisms of the translation initiation. The Author(s) 2012. Published by Oxford University Press.

Elevated atmospheric CO2 concentration leads to increased whole-plant isoprene emission in hybrid aspen (Populus tremula × Populus tremuloides).

Science.gov (United States)

Sun, Zhihong; Niinemets, Ülo; Hüve, Katja; Rasulov, Bahtijor; Noe, Steffen M

2013-05-01

Effects of elevated atmospheric [CO2] on plant isoprene emissions are controversial. Relying on leaf-scale measurements, most models simulating isoprene emissions in future higher [CO2] atmospheres suggest reduced emission fluxes. However, combined effects of elevated [CO2] on leaf area growth, net assimilation and isoprene emission rates have rarely been studied on the canopy scale, but stimulation of leaf area growth may largely compensate for possible [CO2] inhibition reported at the leaf scale. This study tests the hypothesis that stimulated leaf area growth leads to increased canopy isoprene emission rates. We studied the dynamics of canopy growth, and net assimilation and isoprene emission rates in hybrid aspen (Populus tremula × Populus tremuloides) grown under 380 and 780 μmol mol(-1) [CO2]. A theoretical framework based on the Chapman-Richards function to model canopy growth and numerically compare the growth dynamics among ambient and elevated atmospheric [CO2]-grown plants was developed. Plants grown under elevated [CO2] had higher C : N ratio, and greater total leaf area, and canopy net assimilation and isoprene emission rates. During ontogeny, these key canopy characteristics developed faster and stabilized earlier under elevated [CO2]. However, on a leaf area basis, foliage physiological traits remained in a transient state over the whole experiment. These results demonstrate that canopy-scale dynamics importantly complements the leaf-scale processes, and that isoprene emissions may actually increase under higher [CO2] as a result of enhanced leaf area production. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

Production costs for SRIC Populus biomass

International Nuclear Information System (INIS)

Strauss, C.H.

1991-01-01

Production costs for short rotation, intensive culture (SRIC) Populus biomass were developed from commercial-sized plantations under investigation throughout the US. Populus hybrid planted on good quality agricultural sites at a density of 850 cuttings/acre was projected to yield an average of 7 ovendry (OD) tons/acre/year. Discounted cash-flow analysis of multiple rotations showed preharvest production costs of $14/ton (OD). Harvesting and transportation expenses would increase the delivered cost to $35/ton (OD). Although this total cost compared favorably with the regional market price for aspen (Populus tremuloides), future investments in SRIC systems will require the development of biomass energy markets

Hsf and Hsp gene families in Populus: genome-wide identification, organization and correlated expression during development and in stress responses.

Science.gov (United States)

Zhang, Jin; Liu, Bobin; Li, Jianbo; Zhang, Li; Wang, Yan; Zheng, Huanquan; Lu, Mengzhu; Chen, Jun

2015-03-14

Heat shock proteins (Hsps) are molecular chaperones that are involved in many normal cellular processes and stress responses, and heat shock factors (Hsfs) are the transcriptional activators of Hsps. Hsfs and Hsps are widely coordinated in various biological processes. Although the roles of Hsfs and Hsps in stress responses have been well characterized in Arabidopsis, their roles in perennial woody species undergoing various environmental stresses remain unclear. Here, a comprehensive identification and analysis of Hsf and Hsp families in poplars is presented. In Populus trichocarpa, we identified 42 paralogous pairs, 66.7% resulting from a whole genome duplication. The gene structure and motif composition are relatively conserved in each subfamily. Microarray and quantitative real-time RT-PCR analyses showed that most of the Populus Hsf and Hsp genes are differentially expressed upon exposure to various stresses. A coexpression network between Populus Hsf and Hsp genes was generated based on their expression. Coordinated relationships were validated by transient overexpression and subsequent qPCR analyses. The comprehensive analysis indicates that different sets of PtHsps are downstream of particular PtHsfs and provides a basis for functional studies aimed at revealing the roles of these families in poplar development and stress responses.

Characterization of the photosynthetic induction response in a Populus species with stomata barely responding to light changes.

Science.gov (United States)

Tang, Y; Liang, N

2000-08-01

The photosynthetic induction response is constrained by stomatal and biochemical limitations. However, leaves in some plants like Populus koreana x trichocarpa cv. Peace (a hybrid clone) may have little stomatal limitation because their stomata barely respond to changes in photon flux density (PFD). We examined the induction responses of leaves of well-watered and dehydrated P. koreana x trichocarpa plants grown in a high-light or a low-light regime. With an increase in PFD from 50 to 500 micromol m(-2) s(-1), steady-state stomatal conductance (g(s)) increased by only 0.25-8.2%, regardless of the initial g(s), but steady-state assimilation rate (A) increased by 550-1810%. Photosynthetic induction times required to reach 50% (IT50) and 90% (IT90) of A at high PFD were 60-90 s and 210-360 s, respectively. Examination of the dynamic relationships between A and g(s), and between A and intercellular CO2 concentration, indicated that the induction limitation was imposed completely by the biochemical components within 30-40 s after the PFD increase. Values of IT50 and IT90 were significantly higher in low-light leaves than in high-light leaves, whereas the induction state at 60 s and the induction efficiency at 60 and 120 s after the increase in PFD were lower in low-light leaves than in high-light leaves. Dehydration reduced leaf water potential (psi) significantly, resulting in a significantly decreased initial g(s). Leaf water potential had no significant effects on induction time in high-light leaves, but a low psi significantly reduced the induction time in low-light leaves. We conclude that the photosynthetic induction response was limited almost completely by biochemical components because the stomata barely responded to light changes. The biochemical limitation appeared to be higher in low-light leaves than in high-light leaves. Mild water stress may have reduced steady-state A and g(s), but it had little effect on the photosynthetic induction response in high

Functional genomic analysis supports conservation of function among cellulose synthase-like a gene family members and suggests diverse roles of mannans in plants

DEFF Research Database (Denmark)

Liepman, Aaron H; Nairn, C Joseph; Willats, William G T

2007-01-01

from Arabidopsis (Arabidopsis thaliana), guar (Cyamopsis tetragonolobus), and Populus trichocarpa catalyze beta-1,4-mannan and glucomannan synthase reactions in vitro. Mannan polysaccharides and homologs of CslA genes appear to be present in all lineages of land plants analyzed to date. In many plants......, the CslA genes are members of extended multigene families; however, it is not known whether all CslA proteins are glucomannan synthases. CslA proteins from diverse land plant species, including representatives of the mono- and dicotyledonous angiosperms, gymnosperms, and bryophytes, were produced...... they are prevalent at cell junctions and in buds. Taken together, these results demonstrate that members of the CslA gene family from diverse plant species encode glucomannan synthases and support the hypothesis that mannans function in metabolic networks devoted to other cellular processes in addition to cell wall...

Populus species from diverse habitats maintain high night-time conductance under drought.

Science.gov (United States)

Cirelli, Damián; Equiza, María Alejandra; Lieffers, Victor James; Tyree, Melvin Thomas

2016-02-01

We investigated the interspecific variability in nocturnal whole-plant stomatal conductance under well-watered and drought conditions in seedlings of four species of Populus from habitats characterized by abundant water supply (mesic and riparian) or from drier upland sites. The study was carried out to determine whether (i) nocturnal conductance varies across different species of Populus according to their natural habitat, (ii) nocturnal conductance is affected by water stress similarly to daytime conductance based on species habitat and (iii) differences in conductance among species could be explained partly by differences in stomatal traits. We measured whole-plant transpiration and conductance (G) of greenhouse-grown seedlings using an automated high-resolution gravimetric technique. No relationship was found between habitat preference and daytime G (GD), but night-time G (GN) was on average 1.5 times higher in riparian and mesic species (P. deltoides Bartr. ex Marsh. and P. trichocarpa Torr. & Gray) than in those from drier environments (P. tremuloides Michx. and P. × petrowskyana Schr.). GN was not significantly reduced under drought in riparian species. Upland species restricted GN significantly in response to drought, but it was still at least one order of magnitude greater that the cuticular conductance until leaf death was imminent. Under both well-watered and drought conditions, GN declined with increasing vapour pressure deficit (D). Also, a small increase in GN towards the end of the night period was observed in P. deltoides and P. × petrowskyana, suggesting the involvement of endogenous regulation. The anatomical analyses indicated a positive correlation between G and variable stomatal pore index among species and revealed that stomata are not likely to be leaky but instead seem capable of complete occlusion, which raises the question of the possible physiological role of the significant GN observed under drought. Further comparisons among

Genomic organization of plant aminopropyl transferases.

Science.gov (United States)

Rodríguez-Kessler, Margarita; Delgado-Sánchez, Pablo; Rodríguez-Kessler, Gabriela Theresia; Moriguchi, Takaya; Jiménez-Bremont, Juan Francisco

2010-07-01

Aminopropyl transferases like spermidine synthase (SPDS; EC 2.5.1.16), spermine synthase and thermospermine synthase (SPMS, tSPMS; EC 2.5.1.22) belong to a class of widely distributed enzymes that use decarboxylated S-adenosylmethionine as an aminopropyl donor and putrescine or spermidine as an amino acceptor to form in that order spermidine, spermine or thermospermine. We describe the analysis of plant genomic sequences encoding SPDS, SPMS, tSPMS and PMT (putrescine N-methyltransferase; EC 2.1.1.53). Genome organization (including exon size, gain and loss, as well as intron number, size, loss, retention, placement and phase, and the presence of transposons) of plant aminopropyl transferase genes were compared between the genomic sequences of SPDS, SPMS and tSPMS from Zea mays, Oryza sativa, Malus x domestica, Populus trichocarpa, Arabidopsis thaliana and Physcomitrella patens. In addition, the genomic organization of plant PMT genes, proposed to be derived from SPDS during the evolution of alkaloid metabolism, is illustrated. Herein, a particular conservation and arrangement of exon and intron sequences between plant SPDS, SPMS and PMT genes that clearly differs with that of ACL5 genes, is shown. The possible acquisition of the plant SPMS exon II and, in particular exon XI in the monocot SPMS genes, is a remarkable feature that allows their differentiation from SPDS genes. In accordance with our in silico analysis, functional complementation experiments of the maize ZmSPMS1 enzyme (previously considered to be SPDS) in yeast demonstrated its spermine synthase activity. Another significant aspect is the conservation of intron sequences among SPDS and PMT paralogs. In addition the existence of microsynteny among some SPDS paralogs, especially in P. trichocarpa and A. thaliana, supports duplication events of plant SPDS genes. Based in our analysis, we hypothesize that SPMS genes appeared with the divergence of vascular plants by a processes of gene duplication and the

Laboratory-scale measurements of N2O and CH4 emissions from hybrid poplars (Populus deltoides x Populus nigra).

Science.gov (United States)

McBain, M C; Warland, J S; McBride, R A; Wagner-Riddle, C

2004-12-01

The purpose of this study was to determine whether or not young hybrid poplar (Populus deltoides x Populus nigra) could transport landfill biogas internally from the root zone to the atmosphere, thereby acting as conduits for landfill gas release. Fluxes of methane (CH4) and nitrous oxide (N2O) from the seedlings to the atmosphere were measured under controlled conditions using dynamic flux chambers and a tunable diode laser trace gas analyser (TDLTGA). Nitrous oxide was emitted from the seedlings, but only when extremely high soil N2O concentrations were applied to the root zone. In contrast, no detectable emissions of CH4 were measured in a similar experimental trial. Visible plant morphological responses, characteristic of flood-tolerant trees attempting to cope with the negative effects of soil hypoxia, were observed during the CH4 experiments. Leaf chlorosis, leaf abscission and adventitious roots were all visible plant responses. In addition, seedling survival was observed to be highest in the biogas 'hot spot' areas of a local municipal solid waste landfill involved in this study. Based on the available literature, these observations suggest that CH4 can be transported internally by Populus deltoides x Populus nigra seedlings in trace amounts, although future research is required to fully test this hypothesis.

Protein (Viridiplantae): 224169381 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 5297 3694:5297 predicted protein Populus trichocarpa MMINVVFAADSGLGSDAVFAADAEIGSDAVFAADSGLGSDAVFAADAEIGSDAVFAADSGLGSDAVFAADSGLVFAA...DSGLGNDAVFAADSGLGSDAVFAADAEIDSDAVFAADSGMGSDAAFAADSGLGSDAVFAADAEISSDAVFAADSGLGSDAVFAA...HFLIGSDAVFAADAEIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRGKTDFR ...

Establishment and early management of Populus species in southern Sweden

OpenAIRE

Mc Carthy, Rebecka

2016-01-01

Populus species are among the most productive tree species in Sweden. Interest in growing them has increased during the 21st century due to political goals to increase the share of renewable energy and to increase the proportion of hardwood species in forests. Populus species have been shown to be potentially profitable, but currently they are mostly planted on abandoned agricultural land. There is a lack of knowledge about the establishment of Populus species on forest sites. There is also a...

Protein (Viridiplantae): 224094212 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 5297 3694:5297 predicted protein Populus trichocarpa MMMNAVFAADAEIGSDAVFAADSGLGSDAVFAADFGLGSDAVFAADAEIGSDAVFAA...DSGLGSDTAFTTDTEIGSNTVFAAHFLIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRVFAADAEIGSDAVFAADSGLGSEAVFAADSGLGSDAVFAA...DAEIGSDAVFAADSGLGSDAVFAADSGLGSDAVFAADAEIGSDKVFAADSGLGSDAVFAADSGLGSHAVFAADAEIGSDAVFAADSGLGSDAVFAA...DSGLGSDAAFTTDTEIGSDTVFAAHFLIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRGKNWF ...

Evaluation of two hybrid poplar clones as constructed wetland plant species for treating saline water high in boron and selenium, or waters only high in boron

Science.gov (United States)

Wetland mesocosms were constructed to assess two salt- and B-tolerant hybrid poplar clones (Populus trichocarpa ×P. deltoides×P. nigra '345-1' and '347-14') for treating saline water high in boron (B) and selenium (Se). In addition, a hydroponic experiment was performed to test the B tolerance and B...

Initial spacing of poplars and willows grown as arable coppice

Energy Technology Data Exchange (ETDEWEB)

Armstrong, A.; Johns, C.

1997-11-01

Two clones of poplar and two clones of willow were grown at two sites, on a three year cutting cycle, at six different square spacings, between 0.8 metres and 1.5 metres. The two willow clones 'Bowles hybrid' and 'Dasyclados' were planted at both sites. The poplar clones Populus interamericana 'Beaupre' and Populus trichocarpa 'Columbia River'' were planted at Wishanger in Hampshire. The poplar clones Populus interamericana 'Boelare' and Populus trichocarpa 'Trichobel' were planted at Downham Market in Norfolk. The highest yield of 17.55 oven dry tonnes per hectare (odt/ha/annum) was obtained from 'Bowles hybrid', at the closest spacing, grown on a water meadow adjacent to the River Wey at Wishanger. The highest yield for all clones at both sites was achieved at the closest spacing (in this first rotation). There was a significant linear effect. One of the most interesting observations was that when comparing the gradient of the linear relationship, within species, the gradient was steeper for the higher yielding clone. This was particularly so for the willows. This would suggest that higher yielding clones are more tolerant of crowding, or, that upright Salix viminalis make better use of close space than the more spreading Salix dasyclados. The new Salix x Salix schwerinnii hybrids should therefore also be responsive to closer spacing. The same effect was observed for the poplars at Wishanger only, but the difference was not as dramatic. There was a suggestion from the highest yielding poplar plots that optimum yield may still be obtained at the currently recommended spacing of 1.0 metre x 1.0 metre. (author)

Allelopathic potential of populus euphratica olivier

International Nuclear Information System (INIS)

Sher, Z.; Hussain, F.; Ahmad, B.; Wahab, M.

2011-01-01

Populus euphratica Olivier is frequently cultivated deciduous tree in Pakistan on agricultural land for its shade, fodder, timber and fuel wood. A relatively reduced under storey is often observed below it. Therefore the present study was conducted to assess the allelopathic potential of Populus euphratica against some crop species. Plant material of Populus euphratica were collected from the agriculture fields of Lahor, District Swabi in 2008 and were dried at room temperature (258 deg. C-308 deg. C). Allelopathic studies conducted by using aqueous extracts from various parts including young leaves, mature leaves, bark, litter and mulching in various experiments invariably retarded the germination, plumule, radical growth, fresh and dry weight of Sorghum vulgare Perse, Setaria italica (L.) P. Beauv and Triticum aestivum L., in laboratory experiments. The aqueous extracts obtained after 48 h were more inhibitory than 24 h. Leaves were more toxic than bark. Litter and mulching experiments also proved to be inhibitory. It is suggested that the various assayed parts of Populus euphratica have strong allelopathic potential at least against the tested species. Further investigation is required to see its allelopathic behavior under field condition against its associated species and to identify the toxic principles. (author)

The SWEET gene family in Hevea brasiliensis - its evolution and expression compared with four other plant species.

Science.gov (United States)

Sui, Jin-Lei; Xiao, Xiao-Hu; Qi, Ji-Yan; Fang, Yong-Jun; Tang, Chao-Rong

2017-12-01

SWEET proteins play an indispensable role as a sugar efflux transporter in plant development and stress responses. The SWEET genes have previously been characterized in several plants. Here, we present a comprehensive analysis of this gene family in the rubber tree, Hevea brasiliensis . There are 36 members of the SWEET gene family in this species, making it one of the largest families in plant genomes sequenced so far. Structure and phylogeny analyses of these genes in Hevea and in other species demonstrated broad evolutionary conservation. RNA-seq analyses revealed that SWEET2, 16, and 17 might represent the main evolutionary direction of SWEET genes in plants. Our results in Hevea suggested the involvement of HbSWEET1a , 2e , 2f , and 3b in phloem loading, HbSWEET10a and 16b in laticifer sugar transport , and HbSWEET9a in nectary-specific sugar transport. Parallel studies of RNA-seq analyses extended to three other plant species ( Manihot esculenta , Populus trichocarpa , and Arabidopsis thaliana ) produced findings which implicated MeSWEET10a, 3a, and 15b in M. esculenta storage root development, and the involvement of PtSWEET16b and PtSWEET16d in P. trichocarpa xylem development. RT-qPCR results further revealed that HbSWEET10a, 16b, and 1a play important roles in phloem sugar transport. The results from this study provide a foundation not only for further investigation into the functionality of the SWEET gene family in Hevea, especially in its sugar transport for latex production, but also for related studies of this gene family in the plant kingdom.

Protein (Viridiplantae): 761681 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 3688:2831 ... 238069:2831 ... 3689:2831 ... 3694:2831 ... caprice family protein Populus trichocarpa MDRRRKKQAKTTSCCSEQEVSSIEWEFINMSEQEEDLIYRMHNLVGDRWALIAGRIPGRKAEEIERFWLMRHGEGFASRRREQKRCHS

Dragon TIS Spotter: an Arabidopsis-derived predictor of translation initiation sites in plants.

Science.gov (United States)

Magana-Mora, Arturo; Ashoor, Haitham; Jankovic, Boris R; Kamau, Allan; Awara, Karim; Chowdhary, Rajesh; Archer, John A C; Bajic, Vladimir B

2013-01-01

In higher eukaryotes, the identification of translation initiation sites (TISs) has been focused on finding these signals in cDNA or mRNA sequences. Using Arabidopsis thaliana (A.t.) information, we developed a prediction tool for signals within genomic sequences of plants that correspond to TISs. Our tool requires only genome sequence, not expressed sequences. Its sensitivity/specificity is for A.t. (90.75%/92.2%), for Vitis vinifera (66.8%/94.4%) and for Populus trichocarpa (81.6%/94.4%), which suggests that our tool can be used in annotation of different plant genomes. We provide a list of features used in our model. Further study of these features may improve our understanding of mechanisms of the translation initiation. Our tool is implemented as an artificial neural network. It is available as a web-based tool and, together with the source code, the list of features, and data used for model development, is accessible at http://cbrc.kaust.edu.sa/dts.

Multiple factors affect pest and pathogen damage on 31 Populus clones in South Carolina

Science.gov (United States)

David R. Coyle; Mark D. Coleman; Jaclin A. Durant; Lee A. Newman

2006-01-01

Populus species and hybrids have many practical applications, but there is a paucity of data regarding selections that perform well in the southeastern US. We compared pest susceptibility of 31 Populus clones over 3 years in South Carolina, USA. Cuttings were planted in spring 2001 on two study sites. Clones planted in the...

Alternative splicing studies of the reactive oxygen species gene network in Populus reveal two isoforms of high-isoelectric-point superoxide dismutase.

Science.gov (United States)

Srivastava, Vaibhav; Srivastava, Manoj Kumar; Chibani, Kamel; Nilsson, Robert; Rouhier, Nicolas; Melzer, Michael; Wingsle, Gunnar

2009-04-01

Recent evidence has shown that alternative splicing (AS) is widely involved in the regulation of gene expression, substantially extending the diversity of numerous proteins. In this study, a subset of expressed sequence tags representing members of the reactive oxygen species gene network was selected from the PopulusDB database to investigate AS mechanisms in Populus. Examples of all known types of AS were detected, but intron retention was the most common. Interestingly, the closest Arabidopsis (Arabidopsis thaliana) homologs of half of the AS genes identified in Populus are not reportedly alternatively spliced. Two genes encoding the protein of most interest in our study (high-isoelectric-point superoxide dismutase [hipI-SOD]) have been found in black cottonwood (Populus trichocarpa), designated PthipI-SODC1 and PthipI-SODC2. Analysis of the expressed sequence tag libraries has indicated the presence of two transcripts of PthipI-SODC1 (hipI-SODC1b and hipI-SODC1s). Alignment of these sequences with the PthipI-SODC1 gene showed that hipI-SODC1b was 69 bp longer than hipI-SODC1s due to an AS event involving the use of an alternative donor splice site in the sixth intron. Transcript analysis showed that the splice variant hipI-SODC1b was differentially expressed, being clearly expressed in cambial and xylem, but not phloem, regions. In addition, immunolocalization and mass spectrometric data confirmed the presence of hipI-SOD proteins in vascular tissue. The functionalities of the spliced gene products were assessed by expressing recombinant hipI-SOD proteins and in vitro SOD activity assays.

Growth of Populus and Salix Species under Compost Leachate Irrigation

Directory of Open Access Journals (Sweden)

Tooba Abedi

2014-12-01

Full Text Available According to the known broad variation in remediation capacity, three plant species were used in the experiment: two fast growing poplar’s clones - Populus deltoides, Populus euramericana, and willows Salix alba. Populus and Salix cuttings were collected from the nursery of the Populus Research Center of Safrabasteh in the eastern part of Guilan province at north of Iran. The Populus clones were chosen because of their high biomass production capacity and willow- because it is native in Iran. The highest diameter growth rate was exhibited for all three plant species by the 1:1 treatment with an average of 0.26, 0.22 and 0.16 cm in eight months period for P. euroamericana, P. deltoides and S. alba, respectively. Over a period of eight months a higher growth rate of height was observed in (P and (1:1 treatment for S. alba (33.70 and 15.77 cm, respectively and in (C treatment for P. deltoides (16.51 cm. P. deltoides and S. alba produced significantly (p<0.05 smaller aboveground biomass in (P treatment compared to all species. P. deltoides exhibited greater mean aboveground biomass in the (1:1 treatment compared to other species. There were significant differences (p<0.05 in the growth of roots between P. deltoides, P. euramericana and S. alba in all of the treatments.

PHYTOREMEDIATION OF CHLORPYRIFOS BY POPULUS AND SALIX

OpenAIRE

Young Lee, Keum; Strand, Stuart E.; Doty, Sharon L.

2012-01-01

Chlorpyrifos is one of the commonly used organophosphorus insecticides that are implicated in serious environmental and human health problems. To evaluate plant potential for uptake of chlorpyrifos, several plant species of poplar (Populus sp.) and willow (Salix sp.) were investigated. Chlorpyrifos was taken up from nutrient solution by all seven plant species. Significant amounts of chlorpyrifos accumulated in plant tissues, and roots accumulated higher concentrations of chlorpyrifos than di...

Characterization of genomic sequence showing strong association with polyembryony among diverse Citrus species and cultivars, and its synteny with Vitis and Populus.

Science.gov (United States)

Nakano, Michiharu; Shimada, Takehiko; Endo, Tomoko; Fujii, Hiroshi; Nesumi, Hirohisa; Kita, Masayuki; Ebina, Masumi; Shimizu, Tokurou; Omura, Mitsuo

2012-02-01

Polyembryony, in which multiple somatic nucellar cell-derived embryos develop in addition to the zygotic embryo in a seed, is common in the genus Citrus. Previous genetic studies indicated polyembryony is mainly determined by a single locus, but the underlying molecular mechanism is still unclear. As a step towards identification and characterization of the gene or genes responsible for nucellar embryogenesis in Citrus, haplotype-specific physical maps around the polyembryony locus were constructed. By sequencing three BAC clones aligned on the polyembryony haplotype, a single contiguous draft sequence consisting of 380 kb containing 70 predicted open reading frames (ORFs) was reconstructed. Single nucleotide polymorphism genotypes detected in the sequenced genomic region showed strong association with embryo type in Citrus, indicating a common polyembryony locus is shared among widely diverse Citrus cultivars and species. The arrangement of the predicted ORFs in the characterized genomic region showed high collinearity to the genomic sequence of chromosome 4 of Vitis vinifera and linkage group VI of Populus trichocarpa, suggesting that the syntenic relationship among these species is conserved even though V. vinifera and P. trichocarpa are non-apomictic species. This is the first study to characterize in detail the genomic structure of an apomixis locus determining adventitious embryony. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Production potential of 36 poplar clones grown at medium length rotation in Denmark

DEFF Research Database (Denmark)

Nielsen, Ulrik Brauner; Madsen, Palle; Hansen, Jon Kehlet

2014-01-01

years. The estimated mean annual increment of above ground biomass ranged from 1 to 9 Mg ha−1 yr−1 at age 13 years. A hybrid clone O.P. 42 (synonyms Hybrid 275, NE 42) Populus maximowiczii × trichocarpa, performed best, but also clones of the species Populus trichocarpa had a high biomass production....... In general the hybrids using P. maximowiczii as a parent were well performing. Lowest production had pure species Populus nigra and Populus deltoides as well as their hybrids. The choice of species hybrid combination had a very strong impact on biomass production, but less influence on quality and health......The importance of choosing suitable clones for production of timber and biomass has long been recognized. The aims of this study were to describe the genetic variation and production potential among 36 poplar clones grown in a rotation of 5–13 years and evaluate the different species and hybrid...

Alternative Splicing Studies of the Reactive Oxygen Species Gene Network in Populus Reveal Two Isoforms of High-Isoelectric-Point Superoxide Dismutase1[C][W

Science.gov (United States)

Srivastava, Vaibhav; Srivastava, Manoj Kumar; Chibani, Kamel; Nilsson, Robert; Rouhier, Nicolas; Melzer, Michael; Wingsle, Gunnar

2009-01-01

Recent evidence has shown that alternative splicing (AS) is widely involved in the regulation of gene expression, substantially extending the diversity of numerous proteins. In this study, a subset of expressed sequence tags representing members of the reactive oxygen species gene network was selected from the PopulusDB database to investigate AS mechanisms in Populus. Examples of all known types of AS were detected, but intron retention was the most common. Interestingly, the closest Arabidopsis (Arabidopsis thaliana) homologs of half of the AS genes identified in Populus are not reportedly alternatively spliced. Two genes encoding the protein of most interest in our study (high-isoelectric-point superoxide dismutase [hipI-SOD]) have been found in black cottonwood (Populus trichocarpa), designated PthipI-SODC1 and PthipI-SODC2. Analysis of the expressed sequence tag libraries has indicated the presence of two transcripts of PthipI-SODC1 (hipI-SODC1b and hipI-SODC1s). Alignment of these sequences with the PthipI-SODC1 gene showed that hipI-SODC1b was 69 bp longer than hipI-SODC1s due to an AS event involving the use of an alternative donor splice site in the sixth intron. Transcript analysis showed that the splice variant hipI-SODC1b was differentially expressed, being clearly expressed in cambial and xylem, but not phloem, regions. In addition, immunolocalization and mass spectrometric data confirmed the presence of hipI-SOD proteins in vascular tissue. The functionalities of the spliced gene products were assessed by expressing recombinant hipI-SOD proteins and in vitro SOD activity assays. PMID:19176719

Earthworms, arthropods and plant litter decomposition in aspen (Populus tremuloides) and lodgepole pine(Pinus contorta) forests in Colorado, USA

Science.gov (United States)

Grizelle Gonzalez; Timothy R. Seastedt; Zugeily Donato

2003-01-01

We compared the abundance and community composition of earthworms, soil macroarthropods, and litter microarthropods to test faunal effects on plant litter decomposition rates in two forests in the subalpine in Colorado, USA. Litterbags containing recently senesced litter of Populus tremuloides (aspen) and Pinus contorta (lodgepole pine) were placed in aspen and pine...

PtrWRKY73, a salicylic acid-inducible poplar WRKY transcription factor, is involved in disease resistance in Arabidopsis thaliana.

Science.gov (United States)

Duan, Yanjiao; Jiang, Yuanzhong; Ye, Shenglong; Karim, Abdul; Ling, Zhengyi; He, Yunqiu; Yang, Siqi; Luo, Keming

2015-05-01

A salicylic acid-inducible WRKY gene, PtrWRKY73, from Populus trichocarpa , was isolated and characterized. Overexpression of PtrWRKY73 in Arabidopsis thaliana increased resistance to biotrophic pathogens but reduced resistance against necrotrophic pathogens. WRKY transcription factors are commonly involved in plant defense responses. However, limited information is available about the roles of the WRKY genes in poplar defense. In this study, we isolated a salicylic acid (SA)-inducible WRKY gene, PtrWRKY73, from Populus trichocarpa, belonging to group I family and containing two WRKY domains, a D domain and an SP cluster. PtrWRKY73 was expressed predominantly in roots, old leaves, sprouts and stems, especially in phloem and its expression was induced in response to treatment with exogenous SA. PtrWRKY73 was localized to the nucleus of plant cells and exhibited transcriptional activation. Overexpression of PtrWRKY73 in Arabidopsis thaliana resulted in increased resistance to a virulent strain of the bacterial pathogen Pseudomonas syringae (PstDC3000), but more sensitivity to the necrotrophic fungal pathogen Botrytis cinerea. The SA-mediated defense-associated genes, such as PR1, PR2 and PAD4, were markedly up-regulated in transgenic plants overexpressing PtrWRKY73. Arabidopsis non-expressor of PR1 (NPR1) was not affected, whereas a defense-related gene PAL4 had reduced in PtrWRKY73 overexpressor plants. Together, these results indicated that PtrWRKY73 plays a positive role in plant resistance to biotrophic pathogens but a negative effect on resistance against necrotrophic pathogens.

Exploration of plant genomes in the FLAGdb++ environment

Directory of Open Access Journals (Sweden)

Leplé Jean-Charles

2011-03-01

Full Text Available Abstract Background In the contexts of genomics, post-genomics and systems biology approaches, data integration presents a major concern. Databases provide crucial solutions: they store, organize and allow information to be queried, they enhance the visibility of newly produced data by comparing them with previously published results, and facilitate the exploration and development of both existing hypotheses and new ideas. Results The FLAGdb++ information system was developed with the aim of using whole plant genomes as physical references in order to gather and merge available genomic data from in silico or experimental approaches. Available through a JAVA application, original interfaces and tools assist the functional study of plant genes by considering them in their specific context: chromosome, gene family, orthology group, co-expression cluster and functional network. FLAGdb++ is mainly dedicated to the exploration of large gene groups in order to decipher functional connections, to highlight shared or specific structural or functional features, and to facilitate translational tasks between plant species (Arabidopsis thaliana, Oryza sativa, Populus trichocarpa and Vitis vinifera. Conclusion Combining original data with the output of experts and graphical displays that differ from classical plant genome browsers, FLAGdb++ presents a powerful complementary tool for exploring plant genomes and exploiting structural and functional resources, without the need for computer programming knowledge. First launched in 2002, a 15th version of FLAGdb++ is now available and comprises four model plant genomes and over eight million genomic features.

Barcoding poplars (Populus L. from western China.

Directory of Open Access Journals (Sweden)

Jianju Feng

plants, especially for taxonomic groups that have complex evolutionary histories (e.g. Populus.

Efficient Agrobacterium-Mediated Transformation of Hybrid Poplar Populus davidiana Dode × Populus bollena Lauche

Directory of Open Access Journals (Sweden)

Xue Han

2013-01-01

Full Text Available Poplar is a model organism for high in vitro regeneration in woody plants. We have chosen a hybrid poplar Populus davidiana Dode × Populus bollena Lauche. By optimizing the Murashige and Skoog medium with (0.3 mg/L 6-benzylaminopurine and (0.08 mg/L naphthaleneacetic acid, we have achieved the highest frequency (90% for shoot regeneration from poplar leaves. It was also important to improve the transformation efficiency of poplar for genetic breeding and other applications. In this study, we found a significant improvement of the transformation frequency by controlling the leaf age. Transformation efficiency was enhanced by optimizing the Agrobacterium concentration (OD600 = 0.8–1.0 and an infection time (20–30 min. According to transmission electron microscopy observations, there were more Agrobacterium invasions in the 30-day-old leaf explants than in 60-day-old and 90-day-old explants. Using the green fluorescent protein (GFP marker, the expression of MD–GFP fusion proteins in the leaf, shoot, and root of hybrid poplar P. davidiana Dode × P. bollena Lauche was visualized for confirmation of transgene integration. Southern and Northern blot analysis also showed the integration of T-DNA into the genome and gene expression of transgenic plants. Our results suggest that younger leaves had higher transformation efficiency (~30% than older leaves (10%.

November 06, 2016 Prof. Appa Rao Podile FASc, FNASc, FNAAS ...

Indian Academy of Sciences (India)

User

2016-11-06

Nov 6, 2016 ... Isolated as a root endophyte from Populus trichocarpa. Promotes ... Domain architecture. Chitin. Hydrolysis. TG Chitobiase Chitosan hydrolysis ... Only increased hydrolysis. Group II. Catalytic groove. Phe - 64. Trp. More TG ...

Developmental and environmental regulation of Aquaporin gene expression across Populus species: divergence or redundancy?

Science.gov (United States)

Cohen, David; Bogeat-Triboulot, Marie-Béatrice; Vialet-Chabrand, Silvère; Merret, Rémy; Courty, Pierre-Emmanuel; Moretti, Sébastien; Bizet, François; Guilliot, Agnès; Hummel, Irène

2013-01-01

Aquaporins (AQPs) are membrane channels belonging to the major intrinsic proteins family and are known for their ability to facilitate water movement. While in Populus trichocarpa, AQP proteins form a large family encompassing fifty-five genes, most of the experimental work focused on a few genes or subfamilies. The current work was undertaken to develop a comprehensive picture of the whole AQP gene family in Populus species by delineating gene expression domain and distinguishing responsiveness to developmental and environmental cues. Since duplication events amplified the poplar AQP family, we addressed the question of expression redundancy between gene duplicates. On these purposes, we carried a meta-analysis of all publicly available Affymetrix experiments. Our in-silico strategy controlled for previously identified biases in cross-species transcriptomics, a necessary step for any comparative transcriptomics based on multispecies design chips. Three poplar AQPs were not supported by any expression data, even in a large collection of situations (abiotic and biotic constraints, temporal oscillations and mutants). The expression of 11 AQPs was never or poorly regulated whatever the wideness of their expression domain and their expression level. Our work highlighted that PtTIP1;4 was the most responsive gene of the AQP family. A high functional divergence between gene duplicates was detected across species and in response to tested cues, except for the root-expressed PtTIP2;3/PtTIP2;4 pair exhibiting 80% convergent responses. Our meta-analysis assessed key features of aquaporin expression which had remained hidden in single experiments, such as expression wideness, response specificity and genotype and environment interactions. By consolidating expression profiles using independent experimental series, we showed that the large expansion of AQP family in poplar was accompanied with a strong divergence of gene expression, even if some cases of functional redundancy

Developmental and environmental regulation of Aquaporin gene expression across Populus species: divergence or redundancy?

Directory of Open Access Journals (Sweden)

David Cohen

Full Text Available Aquaporins (AQPs are membrane channels belonging to the major intrinsic proteins family and are known for their ability to facilitate water movement. While in Populus trichocarpa, AQP proteins form a large family encompassing fifty-five genes, most of the experimental work focused on a few genes or subfamilies. The current work was undertaken to develop a comprehensive picture of the whole AQP gene family in Populus species by delineating gene expression domain and distinguishing responsiveness to developmental and environmental cues. Since duplication events amplified the poplar AQP family, we addressed the question of expression redundancy between gene duplicates. On these purposes, we carried a meta-analysis of all publicly available Affymetrix experiments. Our in-silico strategy controlled for previously identified biases in cross-species transcriptomics, a necessary step for any comparative transcriptomics based on multispecies design chips. Three poplar AQPs were not supported by any expression data, even in a large collection of situations (abiotic and biotic constraints, temporal oscillations and mutants. The expression of 11 AQPs was never or poorly regulated whatever the wideness of their expression domain and their expression level. Our work highlighted that PtTIP1;4 was the most responsive gene of the AQP family. A high functional divergence between gene duplicates was detected across species and in response to tested cues, except for the root-expressed PtTIP2;3/PtTIP2;4 pair exhibiting 80% convergent responses. Our meta-analysis assessed key features of aquaporin expression which had remained hidden in single experiments, such as expression wideness, response specificity and genotype and environment interactions. By consolidating expression profiles using independent experimental series, we showed that the large expansion of AQP family in poplar was accompanied with a strong divergence of gene expression, even if some cases of

Genotyping-by-sequencing for Populus population genomics: an assessment of genome sampling patterns and filtering approaches.

Directory of Open Access Journals (Sweden)

Martin P Schilling

Full Text Available Continuing advances in nucleotide sequencing technology are inspiring a suite of genomic approaches in studies of natural populations. Researchers are faced with data management and analytical scales that are increasing by orders of magnitude. With such dramatic advances comes a need to understand biases and error rates, which can be propagated and magnified in large-scale data acquisition and processing. Here we assess genomic sampling biases and the effects of various population-level data filtering strategies in a genotyping-by-sequencing (GBS protocol. We focus on data from two species of Populus, because this genus has a relatively small genome and is emerging as a target for population genomic studies. We estimate the proportions and patterns of genomic sampling by examining the Populus trichocarpa genome (Nisqually-1, and demonstrate a pronounced bias towards coding regions when using the methylation-sensitive ApeKI restriction enzyme in this species. Using population-level data from a closely related species (P. tremuloides, we also investigate various approaches for filtering GBS data to retain high-depth, informative SNPs that can be used for population genetic analyses. We find a data filter that includes the designation of ambiguous alleles resulted in metrics of population structure and Hardy-Weinberg equilibrium that were most consistent with previous studies of the same populations based on other genetic markers. Analyses of the filtered data (27,910 SNPs also resulted in patterns of heterozygosity and population structure similar to a previous study using microsatellites. Our application demonstrates that technically and analytically simple approaches can readily be developed for population genomics of natural populations.

Changes in photosynthesis, mesophyll conductance to CO2, and isoprenoid emissions in Populus nigra plants exposed to excess nickel

International Nuclear Information System (INIS)

Velikova, Violeta; Tsonev, Tsonko; Loreto, Francesco; Centritto, Mauro

2011-01-01

Poplar (Populus nigra) plants were grown hydroponically with 30 and 200 μM Ni (Ni 30 and Ni 200 ). Photosynthesis limitations and isoprenoid emissions were investigated in two leaf types (mature and developing). Ni stress significantly decreased photosynthesis, and this effect depended on the leaf Ni content, which was lower in mature than in developing leaves. The main limitations to photosynthesis were attributed to mesophyll conductance and metabolism impairment. In Ni-stressed developing leaves, isoprene emission was significantly stimulated. We attribute such stimulation to the lower chloroplastic [CO 2 ] than in control leaves. However chloroplastic [CO 2 ] did not control isoprene emission in mature leaves. Ni stress induced the emission of cis-β-ocimene in mature leaves, and of linalool in both leaf types. Induced biosynthesis and emission of isoprenoids reveal the onset of antioxidant processes that may also contribute to reduce Ni stress, especially in mature poplar leaves. - Graphical abstract: Visible damage caused by Ni treatment. 1 - Ni 0 (control plants); 2 - Ni 200 ; M = mature and D = developing Populus nigra leaves. Display Omitted Highlights: → We study the effect of Ni pollution on photosynthesis and isoprenoid emissions. → Ni stress significantly decreases photosynthesis. The main limitations are attributed to mesophyll conductance and metabolism impairment. → Constitutive isoprene emission was significantly stimulated in Ni-stressed leaves. Exposure to enhanced Ni concentration induces cis-beta-ocimene and linalool emissions. - The study reveals consequences of Ni stress on plant physiology, namely increasing diffusional limitation to photosynthesis and isoprenoid emissions.

Constitutively elevated salicylic acid levels alter photosynthesis and oxidative state but not growth in transgenic populus.

Science.gov (United States)

Xue, Liang-Jiao; Guo, Wenbing; Yuan, Yinan; Anino, Edward O; Nyamdari, Batbayar; Wilson, Mark C; Frost, Christopher J; Chen, Han-Yi; Babst, Benjamin A; Harding, Scott A; Tsai, Chung-Jui

2013-07-01

Salicylic acid (SA) has long been implicated in plant responses to oxidative stress. SA overproduction in Arabidopsis thaliana leads to dwarfism, making in planta assessment of SA effects difficult in this model system. We report that transgenic Populus tremula × alba expressing a bacterial SA synthase hyperaccumulated SA and SA conjugates without negative growth consequences. In the absence of stress, endogenously elevated SA elicited widespread metabolic and transcriptional changes that resembled those of wild-type plants exposed to oxidative stress-promoting heat treatments. Potential signaling and oxidative stress markers azelaic and gluconic acids as well as antioxidant chlorogenic acids were strongly coregulated with SA, while soluble sugars and other phenylpropanoids were inversely correlated. Photosynthetic responses to heat were attenuated in SA-overproducing plants. Network analysis identified potential drivers of SA-mediated transcriptome rewiring, including receptor-like kinases and WRKY transcription factors. Orthologs of Arabidopsis SA signaling components NON-EXPRESSOR OF PATHOGENESIS-RELATED GENES1 and thioredoxins were not represented. However, all members of the expanded Populus nucleoredoxin-1 family exhibited increased expression and increased network connectivity in SA-overproducing Populus, suggesting a previously undescribed role in SA-mediated redox regulation. The SA response in Populus involved a reprogramming of carbon uptake and partitioning during stress that is compatible with constitutive chemical defense and sustained growth, contrasting with the SA response in Arabidopsis, which is transient and compromises growth if sustained.

Herbivore-induced poplar cytochrome P450 enzymes of the CYP71 family convert aldoximes to nitriles which repel a generalist caterpillar.

Science.gov (United States)

Irmisch, Sandra; Clavijo McCormick, Andrea; Günther, Jan; Schmidt, Axel; Boeckler, Gerhard Andreas; Gershenzon, Jonathan; Unsicker, Sybille B; Köllner, Tobias G

2014-12-01

Numerous plant species emit volatile nitriles upon herbivory, but the biosynthesis as well as the relevance of these nitrogenous compounds in plant-insect interactions remains unknown. Populus trichocarpa has been shown to produce a complex blend of nitrogenous volatiles, including aldoximes and nitriles, after herbivore attack. The aldoximes were previously reported to be derived from amino acids by the action of cytochrome P450 enzymes of the CYP79 family. Here we show that nitriles are derived from aldoximes by another type of P450 enzyme in P. trichocarpa. First, feeding of deuterium-labeled phenylacetaldoxime to poplar leaves resulted in incorporation of the label into benzyl cyanide, demonstrating that poplar volatile nitriles are derived from aldoximes. Then two P450 enzymes, CYP71B40v3 and CYP71B41v2, were characterized that produce aliphatic and aromatic nitriles from their respective aldoxime precursors. Both possess typical P450 sequence motifs but do not require added NADPH or cytochrome P450 reductase for catalysis. Since both enzymes are expressed after feeding by gypsy moth caterpillars, they are likely to be involved in herbivore-induced volatile nitrile emission in P. trichocarpa. Olfactometer experiments showed that these volatile nitriles have a strong repellent activity against gypsy moth caterpillars, suggesting they play a role in induced direct defense against poplar herbivores. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

Capturing the Alternative Cleavage and Polyadenylation Sites of 14 NAC Genes in Populus Using a Combination of 3′-RACE and High-Throughput Sequencing

Directory of Open Access Journals (Sweden)

Haoran Wang

2018-03-01

Full Text Available Detection of complex splice sites (SSs and polyadenylation sites (PASs of eukaryotic genes is essential for the elucidation of gene regulatory mechanisms. Transcriptome-wide studies using high-throughput sequencing (HTS have revealed prevalent alternative splicing (AS and alternative polyadenylation (APA in plants. However, small-scale and high-depth HTS aimed at detecting genes or gene families are very few and limited. We explored a convenient and flexible method for profiling SSs and PASs, which combines rapid amplification of 3′-cDNA ends (3′-RACE and HTS. Fourteen NAC (NAM, ATAF1/2, CUC2 transcription factor genes of Populus trichocarpa were analyzed by 3′-RACE-seq. Based on experimental reproducibility, boundary sequence analysis and reverse transcription PCR (RT-PCR verification, only canonical SSs were considered to be authentic. Based on stringent criteria, candidate PASs without any internal priming features were chosen as authentic PASs and assumed to be PAS-rich markers. Thirty-four novel canonical SSs, six intronic/internal exons and thirty 3′-UTR PAS-rich markers were revealed by 3′-RACE-seq. Using 3′-RACE and real-time PCR, we confirmed that three APA transcripts ending in/around PAS-rich markers were differentially regulated in response to plant hormones. Our results indicate that 3′-RACE-seq is a robust and cost-effective method to discover SSs and label active regions subjected to APA for genes or gene families. The method is suitable for small-scale AS and APA research in the initial stage.

Exploiting the transcriptome of Euphrates Poplar, Populus euphratica (Salicaceae to develop and characterize new EST-SSR markers and construct an EST-SSR database.

Directory of Open Access Journals (Sweden)

Fang K Du

Full Text Available BACKGROUND: Microsatellite markers or Simple Sequence Repeats (SSRs are the most popular markers in population/conservation genetics. However, the development of novel microsatellite markers has been impeded by high costs, a lack of available sequence data and technical difficulties. New species-specific microsatellite markers were required to investigate the evolutionary history of the Euphratica tree, Populus euphratica, the only tree species found in the desert regions of Western China and adjacent Central Asian countries. METHODOLOGY/PRINCIPAL FINDINGS: A total of 94,090 non-redundant Expressed Sequence Tags (ESTs from P. euphratica comprising around 63 Mb of sequence data were searched for SSRs. 4,202 SSRs were found in 3,839 ESTs, with 311 ESTs containing multiple SSRs. The most common motif types were trinucleotides (37% and hexanucleotides (33% repeats. We developed primer pairs for all of the identified EST-SSRs (eSSRs and selected 673 of these pairs at random for further validation. 575 pairs (85% gave successful amplification, of which, 464 (80.7% were polymorphic in six to 24 individuals from natural populations across Northern China. We also tested the transferability of the polymorphic eSSRs to nine other Populus species. In addition, to facilitate the use of these new eSSR markers by other researchers, we mapped them onto Populus trichocarpa scaffolds in silico and compiled our data into a web-based database (http://202.205.131.253:8080/poplar/resources/static_page/index.html. CONCLUSIONS: The large set of validated eSSRs identified in this work will have many potential applications in studies on P. euphratica and other poplar species, in fields such as population genetics, comparative genomics, linkage mapping, QTL, and marker-assisted breeding. Their use will be facilitated by their incorporation into a user-friendly web-based database.

Changes in photosynthesis, mesophyll conductance to CO{sub 2}, and isoprenoid emissions in Populus nigra plants exposed to excess nickel

Energy Technology Data Exchange (ETDEWEB)

Velikova, Violeta, E-mail: violet@obzor.bio21.bas.bg [Bulgarian Academy of Sciences, Acad. M. Popov Institute of Plant Physiology, Acad. G. Bonchev, Bl. 21, 1113 Sofia (Bulgaria); Tsonev, Tsonko [Bulgarian Academy of Sciences, Acad. M. Popov Institute of Plant Physiology, Acad. G. Bonchev, Bl. 21, 1113 Sofia (Bulgaria); Loreto, Francesco [Consiglio Nazionale delle Ricerche, Istituto per la Protezione delle Piante, Via Madonna del Piano 10, 50019 Sesto Fiorentino, Firenze (Italy); Centritto, Mauro [Consiglio Nazionale delle Ricerche, Istituto di Biologia Agroambientale e Forestale, 00015 Monterotondo Scalo (RM) (Italy)

2011-05-15

Poplar (Populus nigra) plants were grown hydroponically with 30 and 200 {mu}M Ni (Ni{sub 30} and Ni{sub 200}). Photosynthesis limitations and isoprenoid emissions were investigated in two leaf types (mature and developing). Ni stress significantly decreased photosynthesis, and this effect depended on the leaf Ni content, which was lower in mature than in developing leaves. The main limitations to photosynthesis were attributed to mesophyll conductance and metabolism impairment. In Ni-stressed developing leaves, isoprene emission was significantly stimulated. We attribute such stimulation to the lower chloroplastic [CO{sub 2}] than in control leaves. However chloroplastic [CO{sub 2}] did not control isoprene emission in mature leaves. Ni stress induced the emission of cis-{beta}-ocimene in mature leaves, and of linalool in both leaf types. Induced biosynthesis and emission of isoprenoids reveal the onset of antioxidant processes that may also contribute to reduce Ni stress, especially in mature poplar leaves. - Graphical abstract: Visible damage caused by Ni treatment. 1 - Ni{sub 0} (control plants); 2 - Ni{sub 200}; M = mature and D = developing Populus nigra leaves. Display Omitted Highlights: > We study the effect of Ni pollution on photosynthesis and isoprenoid emissions. > Ni stress significantly decreases photosynthesis. The main limitations are attributed to mesophyll conductance and metabolism impairment. > Constitutive isoprene emission was significantly stimulated in Ni-stressed leaves. Exposure to enhanced Ni concentration induces cis-beta-ocimene and linalool emissions. - The study reveals consequences of Ni stress on plant physiology, namely increasing diffusional limitation to photosynthesis and isoprenoid emissions.

Genetic basis of aboveground productivity in two native Populus species and their hybrids.

Science.gov (United States)

Lojewski, Nathan R; Fischer, Dylan G; Bailey, Joseph K; Schweitzer, Jennifer A; Whitham, Thomas G; Hart, Stephen C

2009-09-01

Demonstration of genetic control over riparian tree productivity has major implications for responses of riparian systems to shifting environmental conditions and effects of genetics on ecosystems in general. We used field studies and common gardens, applying both molecular and quantitative techniques, to compare plot-level tree aboveground net primary productivity (ANPP(tree)) and individual tree growth rate constants in relation to plant genetic identity in two naturally occurring Populus tree species and their hybrids. In field comparisons of four cross types (Populus fremontii S. Wats., Populus angustifolia James, F(1) hybrids and backcross hybrids) across 11 natural stands, productivity was greatest for P. fremontii trees, followed by hybrids and lowest in P. angustifolia. A similar pattern was observed in four common gardens across a 290 m elevation and 100 km environmental gradient. Despite a doubling in productivity across the common gardens, the relative differences among the cross types remained constant. Using clonal replicates in a common garden, we found ANPP(tree) to be a heritable plant trait (i.e., broad-sense heritability), such that plant genetic factors explained between 38% and 82% of the variation in ANPP(tree). Furthermore, analysis of the genetic composition among individual tree genotypes using restriction fragment length polymorphism molecular markers showed that genetically similar trees also exhibited similar ANPP(tree). These findings indicate strong genetic contributions to natural variation in ANPP with important ecological implications.

Wood property variation in Populus

Science.gov (United States)

Dean W. Einspahr; Miles K. Benson; John R. Peckham

1968-01-01

The use of bigtooth aspen (Populus grandidentata Michx.), quaking aspen (P. tremuloides Michx.), and cottonwood (P. deltoides Bartr.) by the pulp and paper industry has increased greatly during the past decade. This expanded use has stimulated research on the genetic improvement of Populus. For the past 12 years...

Evaluation of Populus and Salix continuously irrigated with landfill leachate I. Genotype-specific elemental phytoremediation.

Science.gov (United States)

Zalesny, Ronald S; Bauer, Edmund O

2007-01-01

There is a need for the identification and selection of specific tree genotypes that can sequester elements from contaminated soils, with elevated rates of uptake. We irrigated Populus (DN17, DN182, DN34, NM2, NM6) and Salix (94003, 94012, S287, S566, SX61) genotypes planted in large soil-filled containers with landfill leachate or municipal water and tested for differences in inorganic element concentrations (P, K, Ca, Mg, S, Zn, B, Mn, Fe, Cu, Al, Na, and Cl) in the leaves, stems, and roots. Trees were irrigated with leachate or water during the final 12 wk of the 18-wk study. Genotype-specific uptake existed. For genera, tissue concentrations exhibited four responses. First, Populus had the greatest uptake of P, K, S, Cu, and Cl. Second, Salix exhibited the greatest uptake of Zn, B, Fe, and Al. Third, Salix had greater concentrations of Ca and Mg in leaves, while Populus had greater concentrations in stems and roots. Fourth, Populus had greater concentrations of Mn and Na in leaves and stems, while Salix had greater concentrations in roots. Populus deltoides x P. nigra clones exhibited better overall phytoremediation than the P. nigra x P. maximowiczii genotypes tested. Phytoremediation for S. purpurea clones 94003 and 94012 was generally less than for other Salix genotypes. Overall, concentrations of elements in the leaves, stems, and roots corroborated those in the plant-sciences literature. Uptake was dependent upon the specific genotype for most elements. Our results corroborated the need for further testing and selecting of specific clones for various phytoremediation needs, while providing a baseline for future researchers developing additional studies and resource managers conducting on-site remediation.

Overexpression of PtABCC1 contributes to mercury tolerance and accumulation in Arabidopsis and poplar.

Science.gov (United States)

Sun, Liping; Ma, Yifeng; Wang, Huihong; Huang, Weipeng; Wang, Xiaozhu; Han, Li; Sun, Wanmei; Han, Erqin; Wang, Bangjun

2018-03-18

Mercury (Hg) is a highly biotoxic heavy metal that contaminates the environment. Phytoremediation is a green technology for environmental remediation and is used to clean up Hg contaminated soil in recent years. In this study, we isolated an ATP-binding cassette (ABC) transporter gene PtABCC1 from Populus trichocarpa and overexpressed it in Arabidopsis and poplar. The transgenic plants conferred higher Hg tolerance than wild type (WT) plants, and overexpression of PtABCC1 could lead to 26-72% or 7-160% increase of Hg accumulation in Arabidopsis or poplar plants, respectively. These results demonstrated that PtABCC1 plays a crucial role in enhancing tolerance and accumulation to Hg in plants, which provides a promising way for phytoremediation of Hg contamination. Copyright © 2018 Elsevier Inc. All rights reserved.

Diversification and expression of the PIN, AUX/LAX and ABCB families of putative auxin transporters in Populus

Directory of Open Access Journals (Sweden)

Nicola eCarraro

2012-02-01

Full Text Available Intercellular transport of the plant hormone auxin is mediated by three families of membrane-bound protein carriers, with the PIN and ABCB families coding primarily for efflux proteins and the AUX/LAX family coding for influx proteins. In the last decade our understanding of gene and protein function for these transporters in Arabidopsis has expanded rapidly but very little is known about their role in woody plant development. Here we present a comprehensive account of all three families in the model woody species Populus, including chromosome distribution, protein structure, quantitative gene expression, and evolutionary relationships. The PIN and AUX/LAX gene families in Populus comprise 16 and 8 members respectively, and show evidence for the retention of paralogs following a relatively recent whole genome duplication. There is also evidence for differential expression across tissues within many gene pairs. The ABCB family is previously undescribed in Populus and includes 20 members, showing a much deeper evolutionary history including both tandem and whole genome duplication as well as probable loss. A striking number of these transporters are expressed in developing Populus stems and we suggest that evolutionary and structural relationships with known auxin transporters in Arabidopsis can point toward candidate genes for further study in Populus. This is especially important for the ABCBs, which is a large family and includes members in Arabidopsis that are able to transport other substrates in addition to auxin. Protein modeling, sequence alignment and expression data all point to ABCB1.1 as a likely auxin transport protein in Populus. Given that basipetal auxin flow through the cambial zone shapes the development of woody stems, it is important that we identify the full complement of proteins involved in this process. This work should lay the foundation for studies targeting specific proteins for functional characterization and in situ

Constitutively Elevated Salicylic Acid Levels Alter Photosynthesis and Oxidative State but Not Growth in Transgenic Populus[C][W

Science.gov (United States)

Xue, Liang-Jiao; Guo, Wenbing; Yuan, Yinan; Anino, Edward O.; Nyamdari, Batbayar; Wilson, Mark C.; Frost, Christopher J.; Chen, Han-Yi; Babst, Benjamin A.; Harding, Scott A.; Tsai, Chung-Jui

2013-01-01

Salicylic acid (SA) has long been implicated in plant responses to oxidative stress. SA overproduction in Arabidopsis thaliana leads to dwarfism, making in planta assessment of SA effects difficult in this model system. We report that transgenic Populus tremula × alba expressing a bacterial SA synthase hyperaccumulated SA and SA conjugates without negative growth consequences. In the absence of stress, endogenously elevated SA elicited widespread metabolic and transcriptional changes that resembled those of wild-type plants exposed to oxidative stress-promoting heat treatments. Potential signaling and oxidative stress markers azelaic and gluconic acids as well as antioxidant chlorogenic acids were strongly coregulated with SA, while soluble sugars and other phenylpropanoids were inversely correlated. Photosynthetic responses to heat were attenuated in SA-overproducing plants. Network analysis identified potential drivers of SA-mediated transcriptome rewiring, including receptor-like kinases and WRKY transcription factors. Orthologs of Arabidopsis SA signaling components NON-EXPRESSOR OF PATHOGENESIS-RELATED GENES1 and thioredoxins were not represented. However, all members of the expanded Populus nucleoredoxin-1 family exhibited increased expression and increased network connectivity in SA-overproducing Populus, suggesting a previously undescribed role in SA-mediated redox regulation. The SA response in Populus involved a reprogramming of carbon uptake and partitioning during stress that is compatible with constitutive chemical defense and sustained growth, contrasting with the SA response in Arabidopsis, which is transient and compromises growth if sustained. PMID:23903318

Construction of a full-length cDNA library and analysis of expressed ...

African Journals Online (AJOL)

... in the GenBank databases. Cluster analysis allowed the identification of 61 unique sequences. These genes were classified into six types by Gene Ontology (GO) annotation. The results also indicated that unigenes of C. capsularis have higher homology to Populus trichocarpa, Ricinus communis and Corchorus olitorius.

Performance of Salix viminalis and Populus nigra x Populus maximowiczii in short rotation intensive culture under high irrigation

Energy Technology Data Exchange (ETDEWEB)

Fillion, Maud; Brisson, Jacques [Departement de Sciences biologiques, Universite de Montreal, C.P. 6128, succ. Centre-ville, Montreal, Quebec (Canada); Institut de recherche en biologie vegetale, 4101 Sherbrooke East, Montreal, Quebec (Canada); Teodorescu, Traian I.; Labrecque, Michel [Institut de recherche en biologie vegetale, 4101 Sherbrooke East, Montreal, Quebec (Canada); Sauve, Sebastien [Departement de chimie, Universite de Montreal, C.P. 6128, succursale Centre-ville, Montreal, Quebec (Canada)

2009-09-15

On a plantation established in 2004 from stem cuttings at a density of 20,000 trees per hectare, we investigated growth and nutritional plant response to a high hydraulic regime for two species (Salix viminalis and Populus nigra x Populus maximowiczii), using a comparative approach with measurements from irrigated and control plots. The plantation was irrigated from June to September 2005 with about 140 mm per day. The equivalent of 120 Kg NO{sub 3}-N, 40 Kg P{sub 2}O{sub 5}-P and 85 Kg K{sub 2}O-K per hectare per year was applied by means of irrigation with wastewater. No mortality occurred and stem biomass production of both poplar and willow species were not statistically different on irrigated and control areas. However, S. viminalis revealed to be more tolerant to flooded conditions since these corresponded more closely to its nutritional requirements (foliar concentration of 20 mgN g{sup -1}). The capacity of S. viminalis to withstand waterlogged conditions could play an important role in the sustainability of a plantation for the filtration of effluent at low pollutant concentration. (author)

Geochemical peculiarities of black poplar leaves (Populus nigra L.) in the sites with heavy metals intensive fallouts

Science.gov (United States)

Yalaltdinova, Albina; Baranovskaya, Natalya; Rikhvanov, Leonid; Matveenko, Irina

2013-04-01

The article deals with the content of 28 chemical elements in the leaves ash of black poplar (Populus nigra L.) growing in Ust-Kamenogorsk city area. It is the major industrial center of Kazakhstan Republic on the territory where the industrial giants of non-ferrous metallurgy and nuclear energy are situated. Comparative analysis with the similar data obtained from leaves ash of Populus nigra L. in Tomsk, Ekibastuz, and Pavlodar cities has revealed that in comparison with other urban areas, leaves ash of black poplar (Populus nigra L.) from Ust-Kamenogorsk city is characterized by elevated concentration rates of Ta, U, Zn, Ag, As, Sb, Br, Sr and Na. Within the city, the sites and areas with abnormal contents of typomorphic pollutants have been revealed. In the central part of the city, in the vicinity of lead-zinc plant and Ulba metallurgical plant, the highest concentrations of Ta, U, Zn, Ag, Au, As, Sb, Cr and Fe were marked. In the northeast, where the titanium-magnesium plant is located, elevated concentrations of Br and Sr were stated. Thus, the impact of major city enterprises which are the main sources of heavy metals is reflected in the element composition. Zn, As, Sb, Ag and Au comes from lead-zinc plant and its refinery plants, while Ulba metallurgical plant can be considered source of Ta and U in the environment, producing tantalum and fuel pellets for nuclear power plants. These companies, due to the current objective circumstances, are located in the central part of the city, have a significant negative effect on the environment and form the risk factors for human health.

The Eucalyptus grandis R2R3-MYB transcription factor family: evidence for woody growth-related evolution and function.

Science.gov (United States)

Soler, Marçal; Camargo, Eduardo Leal Oliveira; Carocha, Victor; Cassan-Wang, Hua; San Clemente, Hélène; Savelli, Bruno; Hefer, Charles A; Paiva, Jorge A Pinto; Myburg, Alexander A; Grima-Pettenati, Jacqueline

2015-06-01

The R2R3-MYB family, one of the largest transcription factor families in higher plants, controls a wide variety of plant-specific processes including, notably, phenylpropanoid metabolism and secondary cell wall formation. We performed a genome-wide analysis of this superfamily in Eucalyptus, one of the most planted hardwood trees world-wide. A total of 141 predicted R2R3-MYB sequences identified in the Eucalyptus grandis genome sequence were subjected to comparative phylogenetic analyses with Arabidopsis thaliana, Oryza sativa, Populus trichocarpa and Vitis vinifera. We analysed features such as gene structure, conserved motifs and genome location. Transcript abundance patterns were assessed by RNAseq and validated by high-throughput quantitative PCR. We found some R2R3-MYB subgroups with expanded membership in E. grandis, V. vinifera and P. trichocarpa, and others preferentially found in woody species, suggesting diversification of specific functions in woody plants. By contrast, subgroups containing key genes regulating lignin biosynthesis and secondary cell wall formation are more conserved across all of the species analysed. In Eucalyptus, R2R3-MYB tandem gene duplications seem to disproportionately affect woody-preferential and woody-expanded subgroups. Interestingly, some of the genes belonging to woody-preferential subgroups show higher expression in the cambial region, suggesting a putative role in the regulation of secondary growth. © 2014 The Authors New Phytologist © 2014 New Phytologist Trust.

Cavitation vulnerability in roots and shoots: does Populus euphratica Oliv., a poplar from arid areas of Central Asia, differ from other poplar species?

Science.gov (United States)

Hukin, D; Cochard, H; Dreyer, E; Le Thiec, D; Bogeat-Triboulot, M B

2005-08-01

Populus euphratica is a poplar species growing in arid regions of Central Asia, where its distribution remains nevertheless restricted to river-banks or to areas with an access to deep water tables. To test whether the hydraulic architecture of this species differs from that of other poplars with respect to this ecological distribution, the vulnerability to cavitation of P. euphratica was compared with that of P. alba and of P. trichocarpa x koreana. The occurrence of a potential hydraulic segmentation through cavitation was also investigated by assessing the vulnerability of roots, stems, and leaf mid-rib veins. Cryo-scanning electron microscopy (cryo-SEM) was used to assess the level of embolism in fine roots and leaf mid-ribs and a low pressure flowmeter (LPFM) was used for stems and main roots. The cryo-SEM technique was validated against LPFM measurements on paired samples. In P. alba and P. trichocarpa x koreana, leaf mid-ribs were more vulnerable to cavitation than stems and roots. In P. euphratica, leaf mid-ribs and stems were equally vulnerable and, contrary to what has been observed in other species, roots were significantly less vulnerable than shoots. P. euphratica was by far the most vulnerable. The water potential inducing 50% loss of conductivity in stems was close to -0.7 MPa, against approximately -1.45 MPa for the two others species. Such a large vulnerability was confirmed by recording losses of conductivity during a gradual drought. Moreover, significant stem embolism was recorded before stomatal closure, indicating the lack of an efficient safety margin for hydraulic functions in this species. Embolism was not reversed by rewatering. These observations are discussed with respect to the ecology of P. euphratica.

Genetic Modification of Lignin in Hybrid Poplar (Populus alba × Populus tremula) Does Not Substantially Alter Plant Defense or Arthropod Communities.

Science.gov (United States)

Buhl, Christine; Meilan, Richard; Lindroth, Richard L

2017-05-01

Lignin impedes access to cellulose during biofuel production and pulping but trees can be genetically modified to improve processing efficiency. Modification of lignin may have nontarget effects on mechanical and chemical resistance and subsequent arthropod community responses with respect to pest susceptibility and arthropod biodiversity. We quantified foliar mechanical and chemical resistance traits in lignin-modified and wild-type (WT) poplar (Populus alba × Populus tremula) grown in a plantation and censused arthropods present on these trees to determine total abundance, as well as species richness, diversity and community composition. Our results indicate that mechanical resistance was not affected by lignin modification and only one genetic construct resulted in a (modest) change in chemical resistance. Arthropod abundance and community composition were consistent across modified and WT trees, but transgenics produced using one construct exhibited higher species richness and diversity relative to the WT. Our findings indicate that modification of lignin in poplar does not negatively affect herbivore resistance traits or arthropod community response, and may even result in a source of increased genetic diversity in trees and arthropod communities. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Estimation of in situ mating systems in wild sorghum (Sorghum bicolor (L.) Moench) in .... is one of the novel chromosome regions influencing dough-mixing strength. ... Validation of PPP1R12B as a candidate gene for childhood asthma in Russians ... Genomewide analysis of the chitinase gene family in Populus trichocarpa.

VEGETATIVNO RAZMNOŽEVANJE TOPOLOV (Populus spp.) S POTAKNJENCI

OpenAIRE

Sternad, Rebeka

2010-01-01

Raziskava je bila opravljena na treh vrstah topolov: črnem topolu (Populus nigra L.), belem topolu (Populus alba L.) in trepetliki (Populus tremula L.). Namen diplomskega dela je bil proučiti ukoreninjenje potaknjencev topolov glede na okolje koreninjenja, termin potikanja in vrsto uporabljenega substrata. Zeleni in pololeseneli potaknjenci so bili večinoma nabrani v okolici celjske regije in Žalca. Koreninjeni so bili v šestih terminih (od junija do septembra) v okolju meglenja in neposredne...

Subcellular localization of cadmium in hyperaccumulator Populus ...

African Journals Online (AJOL)

In this study, subcellular localization of cadmium in hyperaccumulator grey poplar (Populus × canescens) was investigated by the transmission electron microscopy (TEM) method. Young Populus × canescens were grown and hydroponic experiments were conducted under four Cd2+ concentrations (10, 30, 50, and 70 μM) ...

Conservation, Divergence, and Genome-Wide Distribution of PAL and POX A Gene Families in Plants.

Science.gov (United States)

Rawal, H C; Singh, N K; Sharma, T R

2013-01-01

Genome-wide identification and phylogenetic and syntenic comparison were performed for the genes responsible for phenylalanine ammonia lyase (PAL) and peroxidase A (POX A) enzymes in nine plant species representing very diverse groups like legumes (Glycine max and Medicago truncatula), fruits (Vitis vinifera), cereals (Sorghum bicolor, Zea mays, and Oryza sativa), trees (Populus trichocarpa), and model dicot (Arabidopsis thaliana) and monocot (Brachypodium distachyon) species. A total of 87 and 1045 genes in PAL and POX A gene families, respectively, have been identified in these species. The phylogenetic and syntenic comparison along with motif distributions shows a high degree of conservation of PAL genes, suggesting that these genes may predate monocot/eudicot divergence. The POX A family genes, present in clusters at the subtelomeric regions of chromosomes, might be evolving and expanding with higher rate than the PAL gene family. Our analysis showed that during the expansion of POX A gene family, many groups and subgroups have evolved, resulting in a high level of functional divergence among monocots and dicots. These results will act as a first step toward the understanding of monocot/eudicot evolution and functional characterization of these gene families in the future.

Conservation, Divergence, and Genome-Wide Distribution of PAL and POX A Gene Families in Plants

Directory of Open Access Journals (Sweden)

H. C. Rawal

2013-01-01

Full Text Available Genome-wide identification and phylogenetic and syntenic comparison were performed for the genes responsible for phenylalanine ammonia lyase (PAL and peroxidase A (POX A enzymes in nine plant species representing very diverse groups like legumes (Glycine max and Medicago truncatula, fruits (Vitis vinifera, cereals (Sorghum bicolor, Zea mays, and Oryza sativa, trees (Populus trichocarpa, and model dicot (Arabidopsis thaliana and monocot (Brachypodium distachyon species. A total of 87 and 1045 genes in PAL and POX A gene families, respectively, have been identified in these species. The phylogenetic and syntenic comparison along with motif distributions shows a high degree of conservation of PAL genes, suggesting that these genes may predate monocot/eudicot divergence. The POX A family genes, present in clusters at the subtelomeric regions of chromosomes, might be evolving and expanding with higher rate than the PAL gene family. Our analysis showed that during the expansion of POX A gene family, many groups and subgroups have evolved, resulting in a high level of functional divergence among monocots and dicots. These results will act as a first step toward the understanding of monocot/eudicot evolution and functional characterization of these gene families in the future.

Bud removal affects shoot, root, and callus development of hardwood Populus cuttings

Science.gov (United States)

A.H. Wiese; J.A. Zalesny; D.M. Donner; Ronald S., Jr. Zalesny

2006-01-01

The inadvertent removal and/or damage of buds during processing and planting of hardwood poplar (Populus spp.) cuttings are a concern because of their potential impact on shoot and root development during establishment. The objective of the current study was to test for differences in shoot dry mass, root dry mass, number of roots, length of the...

A census of nuclear cyanobacterial recruits in the plant kingdom.

Directory of Open Access Journals (Sweden)

Szabolcs Makai

Full Text Available The plastids and mitochondria of the eukaryotic cell are of endosymbiotic origin. These events occurred ~2 billion years ago and produced significant changes in the genomes of the host and the endosymbiont. Previous studies demonstrated that the invasion of land affected plastids and mitochondria differently and that the paths of mitochondrial integration differed between animals and plants. Other studies examined the reasons why a set of proteins remained encoded in the organelles and were not transferred to the nuclear genome. However, our understanding of the functional relations of the transferred genes is insufficient. In this paper, we report a high-throughput phylogenetic analysis to identify genes of cyanobacterial origin for plants of different levels of complexity: Arabidopsis thaliana, Chlamydomonas reinhardtii, Physcomitrella patens, Populus trichocarpa, Selaginella moellendorffii, Sorghum bicolor, Oryza sativa, and Ostreococcus tauri. Thus, a census of cyanobacterial gene recruits and a study of their function are presented to better understand the functional aspects of plastid symbiogenesis. From algae to angiosperms, the GO terms demonstrated a gradual expansion over functionally related genes in the nuclear genome, beginning with genes related to thylakoids and photosynthesis, followed by genes involved in metabolism, and finally with regulation-related genes, primarily in angiosperms. The results demonstrate that DNA is supplied to the nuclear genome on a permanent basis with no regard to function, and only what is needed is kept, which thereby expands on the GO space along the related genes.

A genomics investigation of partitioning into and among flavonoid-derived condensed tannins for carbon sequestration in Populus

Energy Technology Data Exchange (ETDEWEB)

Harding, Scott, A; Tsai, Chung-jui; Lindroth, Richard, L

2013-03-24

The project set out to use comparative (genotype and treatment) and transgenic approaches to investigate the determinants of condensed tannin (CT) accrual and chemical variability in Populus. CT type and amount are thought to effect the decomposition of plant detritus in the soil, and thereby the sequestering of carbon in the soil. The stated objectives were: 1. Genome-wide transcriptome profiling (microarrays) to analyze structural gene, transcription factor and metabolite control of CT partitioning; 2. Transcriptomic (microarray) and chemical analysis of ontogenetic effects on CT and PG partitioning; and 3. Transgenic manipulation of flavonoid biosynthetic pathway genes to modify the control of CT composition. Objective 1: A number of approaches for perturbing CT content and chemistry were tested in Objective 1, and those included nitrogen deficit, leaf wounding, drought, and salicylic acid spraying. Drought had little effect on CTs in the genotypes we used. Plants exhibited unpredictability in their response to salicylic acid spraying, leading us to abandon its use. Reduced plant nitrogen status and leaf wounding caused reproducible and magnitudinally striking increases in leaf CT content. Microarray submissions to NCBI from those experiments are the following: GSE ID 14515: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 1979. Public on Jan 04, 2010; Contributor(s) Harding SA, Tsai C GSE ID 14893: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 3200. Public on Feb 19, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16783 Wound-induced gene expression changes in Populus: 1 week; clone RM5. Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16785 Wound-induced gene expression changes in Populus: 90 hours; clone RM5 Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C Although CT amount changed in response to treatments, CT composition was essentially

Multilocus analysis of nucleotide variation and speciation in three closely related Populus (Salicaceae) species.

Science.gov (United States)

Du, Shuhui; Wang, Zhaoshan; Ingvarsson, Pär K; Wang, Dongsheng; Wang, Junhui; Wu, Zhiqiang; Tembrock, Luke R; Zhang, Jianguo

2015-10-01

Historical tectonism and climate oscillations can isolate and contract the geographical distributions of many plant species, and they are even known to trigger species divergence and ultimately speciation. Here, we estimated the nucleotide variation and speciation in three closely related Populus species, Populus tremuloides, P. tremula and P. davidiana, distributed in North America and Eurasia. We analysed the sequence variation in six single-copy nuclear loci and three chloroplast (cpDNA) fragments in 497 individuals sampled from 33 populations of these three species across their geographic distributions. These three Populus species harboured relatively high levels of nucleotide diversity and showed high levels of nucleotide differentiation. Phylogenetic analysis revealed that P. tremuloides diverged earlier than the other two species. The cpDNA haplotype network result clearly illustrated the dispersal route from North America to eastern Asia and then into Europe. Molecular dating results confirmed that the divergence of these three species coincided with the sundering of the Bering land bridge in the late Miocene and a rapid uplift of the Qinghai-Tibetan Plateau around the Miocene/Pliocene boundary. Vicariance-driven successful allopatric speciation resulting from historical tectonism and climate oscillations most likely played roles in the formation of the disjunct distributions and divergence of these three Populus species. © 2015 John Wiley & Sons Ltd.

Shifting dominance of riparian Populus and Tamarix along gradients of flow alteration in western North American rivers.

Science.gov (United States)

Merritt, David M; Poff, N LeRoy

2010-01-01

Tamarix ramosissima is a naturalized, nonnative plant species which has become widespread along riparian corridors throughout the western United States. We test the hypothesis that the distribution and success of Tamarix result from human modification of river-flow regimes. We conducted a natural experiment in eight ecoregions in arid and semiarid portions of the western United States, measuring Tamarix and native Populus recruitment and abundance at 64 sites along 13 perennial rivers spanning a range of altered flow regimes. We quantified biologically relevant attributes of flow alteration as an integrated measure (the index of flow modification, IFM), which was then used to explain between-site variation in abundance and recruitment of native and nonnative riparian plant species. We found the likelihood of successful recruitment of Tamarix to be highest along unregulated river reaches and to remain high across a gradient of regulated flows. Recruitment probability for Populus, in contrast, was highest under free-flowing conditions and declined abruptly under even slight flow modification (IFM > 0.1). Adult Tamarix was most abundant at intermediate levels of IFM. Populus abundance declined sharply with modest flow regulation (IFM > 0.2) and was not present at the most flow-regulated sites. Dominance of Tamarix was highest along rivers with the most altered flow regimes. At the 16 least regulated sites, Tamarix and Populus were equally abundant. Given observed patterns of Tamarix recruitment and abundance, we infer that Tamarix would likely have naturalized, spread, and established widely in riparian communities in the absence of dam construction, diversions, and flow regulation in western North America. However, Tamarix dominance over native species would likely be less extensive in the absence of human alteration of river-flow regimes. Restoration that combines active mechanical removal of established stands of Tamarix with a program of flow releases conducive to

The optimization of sewage sludge and effluent disposal on energy crops of short rotation hybrid poplar

Energy Technology Data Exchange (ETDEWEB)

Moffat, A.J.; Armstrong, A.T. [Forest Research, Farnham (United Kingdom); Ockleston, J. [Thames Water Utilities Ltd., Reading (United Kingdom)

2001-07-01

An experiment was set up to test the effect of sewage sludge application and waste water irrigation on the biomass production of two poplar varieties, Populus trichocarpa x P. deltoides ''Beaupre'', and Populus trichocarpa ''Trichobel''. Three sludge applications were examined factorially with two irrigation regimes (with and without), over the two final years of a three-year rotation. The effects of treatment on soil and soil water were monitored, and the amount of heavy metals removed in the biomass was quantified. Irrigation had a significant effect on biomass of both poplar varieties, with Beaupre yielding more than Trichobel. Sludge application was not effective in increasing biomass yield, but the experiment was valuable in identifying that modest amounts of sludge (approximately 100 m{sup 3} ha{sup -1} yr{sup -1}) were acceptable environmentally and did not compromise biomass production. Cadmium uptake was detected in the poplar biomass, but the amounts were small and insufficient for poplar to be used in phytoremediation of metal-contaminated land. (author)

[Seasonal variation of Tamarix ramosissima and Populus euphratica water potentials in southern fringe of Taklamakan Desert].

Science.gov (United States)

Zeng, Fanjiang; Zhang, Ximing; Li, Xiangyi; Foetzki, Andrea; Runge, Michael

2005-08-01

The measurement of the seasonal and diurnal variations of Tamarix ramosissima and Populus euphratica water potentials in the southern fringe of Taklamakan Desert indicated that there was no apparent water stress for the two species during their growth period, with little change of predawn water potential and some extent decrease of midday water potential. Irrigation once or thinning had no significant effects on the water status of the plants, while groundwater appeared to be a prerequisite for the survival and growth of these species. It is very important to ensure a stable groundwater table for the restoration of Tamarix ramosissima and Populus euphratica in this area.

Biochemical basis of drought tolerance in hybrid Populus grown under field production conditions. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Tschaplinski, T.J.; Tuskan, G.A. [Oak Ridge National Lab., TN (United States); Wierman, C. [Boise Cascade Corp., Wallula, WA (United States)

1997-04-01

The purpose of this cooperative effort was to assess the use of osmotically active compounds as molecular selection criteria for drought tolerance in Populus in a large-scale field trial. It is known that some plant species, and individuals within a plant species, can tolerate increasing stress associated with reduced moisture availability by accumulating solutes. The biochemical matrix of such metabolites varies among species and among individuals. The ability of Populus clones to tolerate drought has equal value to other fiber producers, i.e., the wood products industry, where irrigation is used in combination with other cultural treatments to obtain high dry weight yields. The research initially involved an assessment of drought stress under field conditions and characterization of changes in osmotic constitution among the seven clones across the six moisture levels. The near-term goal was to provide a mechanistic basis for clonal differences in productivity under various irrigation treatments over time.

Selecting and utilizing Populus and Salix for landfill covers: implications for leachate irrigation.

Science.gov (United States)

Zalesny, Ronald S; Bauer, Edmund O

2007-01-01

The success of using Populus and Salix for phytoremediation has prompted further use of leachate as a combination of irrigation and fertilization for the trees. A common protocol for such efforts has been to utilize a limited number of readily-available genotypes with decades of deployment in other applications, such as fiber or windbreaks. However, it may be possible to increase phytoremediation success with proper genotypic screening and selection, followed by the field establishment of clones that exhibited favorable potential for cleanup of specific contaminants. There is an overwhelming need for testing and subsequent deployment of diverse Populus and Salix genotypes, given current availability of clonal material and the inherent genetic variation among and within these genera. Therefore, we detail phyto-recurrent selection, a method that consists of revising and combining crop and tree improvement protocols to meet the objective of utilizing superior Populus and Salix clones for remediation applications. Although such information is lacking for environmental clean-up technologies, centuries of plant selection success in agronomy, horticulture, and forestry validate the need for similar approaches in phytoremediation. We bridge the gap between these disciplines by describing project development, clone selection, tree establishment, and evaluation of success metrics in the context of their importance to utilizing trees for phytoremediation.

The nitrate transporter (NRT gene family in poplar.

Directory of Open Access Journals (Sweden)

Hua Bai

Full Text Available Nitrate is an important nutrient required for plant growth. It also acts as a signal regulating plant development. Nitrate is actively taken up and transported by nitrate transporters (NRT, which form a large family with many members and distinct functions. In contrast to Arabidopsis and rice there is little information about the NRT family in woody plants such as Populus. In this study, a comprehensive analysis of the Populus NRT family was performed. Sixty-eight PtNRT1/PTR, 6 PtNRT2, and 5 PtNRT3 genes were identified in the P. trichocarpa genome. Phylogenetic analysis confirmed that the genes of the NRT family are divided into three clades: NRT1/PTR with four subclades, NRT2, and NRT3. Topological analysis indicated that all members of PtNRT1/PTR and PtNRT2 have 8 to 12 trans-membrane domains, whereas the PtNRT3 proteins have no or up to two trans-membrane domains. Four PtNRT3 members were predicted as secreted proteins. Microarray analyses revealed tissue-specific expression patterns of PtNRT genes with distinct clusters of NRTs for roots, for the elongation zone of the apical stem segment and the developing xylem and a further cluster for leaves, bark and wood. A comparison of different poplar species (P. trichocarpa, P. tremula, P. euphratica, P. fremontii x P. angustifolia, and P. x canescens showed that the tissue-specific patterns of the NRT genes varied to some extent with species. Bioinformatic analysis of putative cis-regulatory elements in the promoter regions of PtNRT family retrieved motifs suggesting the regulation of the NRT genes by N metabolism, by energy and carbon metabolism, and by phytohormones and stress. Multivariate analysis suggested that the combination and abundance of motifs in distinct promoters may lead to tissue-specificity. Our genome wide analysis of the PtNRT genes provides a valuable basis for functional analysis towards understanding the role of nitrate transporters for tree growth.

Cadmium accumulation and growth responses of a poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil

Energy Technology Data Exchange (ETDEWEB)

Wu Fuzhong [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China); Yang Wanqin, E-mail: scyangwq@163.com [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China); Zhang Jian; Zhou Liqiang [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China)

2010-05-15

To characterize the phytoextraction efficiency of a hybrid poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil, a pot experiment in field was carried out in Sichuan basin, western China. After one growing period, the poplar accumulated the highest of 541.98 {+-} 19.22 and 576.75 {+-} 40.55 {mu}g cadmium per plant with 110.77 {+-} 12.68 and 202.54 {+-} 19.12 g dry mass in these contaminated purple soil and alluvial soil, respectively. Higher phytoextraction efficiency with higher cadmium concentration in tissues was observed in poplar growing in purple soil than that in alluvial soil at relative lower soil cadmium concentration. The poplar growing in alluvial soil had relative higher tolerance ability with lower reduction rates of morphological and growth characters than that in purple soil, suggesting that the poplar growing in alluvial soil might display the higher phytoextraction ability when cadmium contamination level increased. Even so, the poplars exhibited obvious cadmium transport from root to shoot in both soils regardless of cadmium contamination levels. It implies that this examined poplar can extract more cadmium than some hyperaccumulators. The results indicated that metal phytoextraction using the poplar can be applied to clean up soils moderately contaminated by cadmium in these purple soil and alluvial soil.

Use of belowground growing degree days to predict rooting of dormant hardwood cuttings of Populus

Science.gov (United States)

R.S., Jr. Zalesny; E.O. Bauer; D.E. Riemenschneider

2004-01-01

Planting Populus cuttings based on calendar days neglects soil temperature extremes and does not promote rooting based on specific genotypes. Our objectives were to: 1) test the biological efficacy of a thermal index based on belowground growing degree days (GDD) across the growing period, 2) test for interactions between belowground GDD and clones,...

Rooting of hybrid clones of Populus tremula L. x P. tremuloides Michx. by stem cuttings derived from micropropagated plants

Energy Technology Data Exchange (ETDEWEB)

Qibin Yu [Univ. of Helsinki (Finland). Dept. of Plant Biology; Maentylae, N. [Univ. of Turku (Finland). Dept. of Biology, Plant Physiology and Molecular Biology; Salonen, M. [Finnish Forest Research Inst., Laeyliaeinen (Finland). Haapastensyrjae Breeding Station

2001-07-01

Propagation costs could be cut by replacing part of the micropropagation process with steps involving more traditional techniques. This study explored possibilities for improving existing vegetative propagation techniques for aspen using stem cuttings obtained from micropropagated plants. Vegetative propagation through stem cuttings was studied in 10 micropropagated hybrid aspen clones (Populus tremula L. x P. tremuloides Michx). Cuttings containing one axillary bud were harvested from the same donor plants twice during the growing season: the first harvest in May and the second harvest in July. Rooting percentage was correlated positively with root length, number of roots and height of cutting plant but negatively with length of rooting. The average rooting percentage was 53% in the first harvest and 27% in second harvest. Indole-3-butyric acid treatments (1.2 mM) significantly improved rooting in the second harvest, but not in the first harvest, suggesting different endogenous auxin levels in the cuttings. A significant variation for most traits related to rooting ability was found among the clones, indicating that clonal effects play an important role in the propagation of aspen. Thus, clones with a good response in shoot growth and rooting could be exploited in large-scale propagation using stem cuttings.

Inheritance of compartmentalization of wounds in sweetgum (Liquidambar styraciflua L.) and eastern cottonwood (Populus deltoides Bartr.)

Science.gov (United States)

P. W. Garrett; W. K. Randall; A. L. Shigo; W. C. Shortle

1979-01-01

Studies of half-sib progeny tests of sweetgum (Liquidambar styraciflua) and clonal plantings of eastern cottonwood (Populus deltoides) in Mississippi indicate that rate of wound closure and size of discolored columns associated with the wounds are both heritable traits. Both are independent of stem diameter, which was used as a...

Growth and biomass of Populus irrigated with landfill leachate

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny; David R. Coyle; Richard B. Hall

2007-01-01

Resource managers are challenged with waste disposal and leachate produced from its degradation. Poplar (Populus spp.) trees offer an opportunity for ecological leachate disposal as an irrigation source for managed tree systems. Our objective was to irrigate Populus trees with municipal solid waste landfill leachate or fertilized well water (control...

Diversity of Pseudomonas Genomes, Including Populus-Associated Isolates, as Revealed by Comparative Genome Analysis.

Science.gov (United States)

Jun, Se-Ran; Wassenaar, Trudy M; Nookaew, Intawat; Hauser, Loren; Wanchai, Visanu; Land, Miriam; Timm, Collin M; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A; Ussery, David W

2016-01-01

The Pseudomonas genus contains a metabolically versatile group of organisms that are known to occupy numerous ecological niches, including the rhizosphere and endosphere of many plants. Their diversity influences the phylogenetic diversity and heterogeneity of these communities. On the basis of average amino acid identity, comparative genome analysis of >1,000 Pseudomonas genomes, including 21 Pseudomonas strains isolated from the roots of native Populus deltoides (eastern cottonwood) trees resulted in consistent and robust genomic clusters with phylogenetic homogeneity. All Pseudomonas aeruginosa genomes clustered together, and these were clearly distinct from other Pseudomonas species groups on the basis of pangenome and core genome analyses. In contrast, the genomes of Pseudomonas fluorescens were organized into 20 distinct genomic clusters, representing enormous diversity and heterogeneity. Most of our 21 Populus-associated isolates formed three distinct subgroups within the major P. fluorescens group, supported by pathway profile analysis, while two isolates were more closely related to Pseudomonas chlororaphis and Pseudomonas putida. Genes specific to Populus-associated subgroups were identified. Genes specific to subgroup 1 include several sensory systems that act in two-component signal transduction, a TonB-dependent receptor, and a phosphorelay sensor. Genes specific to subgroup 2 contain hypothetical genes, and genes specific to subgroup 3 were annotated with hydrolase activity. This study justifies the need to sequence multiple isolates, especially from P. fluorescens, which displays the most genetic variation, in order to study functional capabilities from a pangenomic perspective. This information will prove useful when choosing Pseudomonas strains for use to promote growth and increase disease resistance in plants. Copyright © 2015 Jun et al.

Macro- and micro-nutrient concentration in leaf, woody, and root tissue of Populus irrigated with landfill leachate

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Bart T. Sexton; Richard B. Hall

2007-01-01

Landfill leachate offers an opportunity to supply water and plant nutritional benefits at a lower cost than traditional sources. Information about nutrient uptake and distribution into tissues of Populus irrigated with landfill leachate helps increase biomass production along with evaluating the impacts of leachate chemistry on tree health.

Genome Sequence of the Plant Growth Promoting Endophytic Bacterium Enterobacter sp. 638

Science.gov (United States)

Taghavi, Safiyh; van der Lelie, Daniel; Hoffman, Adam; Zhang, Yian-Biao; Walla, Michael D.; Vangronsveld, Jaco; Newman, Lee; Monchy, Sébastien

2010-01-01

Enterobacter sp. 638 is an endophytic plant growth promoting gamma-proteobacterium that was isolated from the stem of poplar (Populus trichocarpa×deltoides cv. H11-11), a potentially important biofuel feed stock plant. The Enterobacter sp. 638 genome sequence reveals the presence of a 4,518,712 bp chromosome and a 157,749 bp plasmid (pENT638-1). Genome annotation and comparative genomics allowed the identification of an extended set of genes specific to the plant niche adaptation of this bacterium. This includes genes that code for putative proteins involved in survival in the rhizosphere (to cope with oxidative stress or uptake of nutrients released by plant roots), root adhesion (pili, adhesion, hemagglutinin, cellulose biosynthesis), colonization/establishment inside the plant (chemiotaxis, flagella, cellobiose phosphorylase), plant protection against fungal and bacterial infections (siderophore production and synthesis of the antimicrobial compounds 4-hydroxybenzoate and 2-phenylethanol), and improved poplar growth and development through the production of the phytohormones indole acetic acid, acetoin, and 2,3-butanediol. Metabolite analysis confirmed by quantitative RT–PCR showed that, the production of acetoin and 2,3-butanediol is induced by the presence of sucrose in the growth medium. Interestingly, both the genetic determinants required for sucrose metabolism and the synthesis of acetoin and 2,3-butanediol are clustered on a genomic island. These findings point to a close interaction between Enterobacter sp. 638 and its poplar host, where the availability of sucrose, a major plant sugar, affects the synthesis of plant growth promoting phytohormones by the endophytic bacterium. The availability of the genome sequence, combined with metabolome and transcriptome analysis, will provide a better understanding of the synergistic interactions between poplar and its growth promoting endophyte Enterobacter sp. 638. This information can be further exploited to

Cadmium accumulation and growth responses of a poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil

International Nuclear Information System (INIS)

Wu Fuzhong; Yang Wanqin; Zhang Jian; Zhou Liqiang

2010-01-01

To characterize the phytoextraction efficiency of a hybrid poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil, a pot experiment in field was carried out in Sichuan basin, western China. After one growing period, the poplar accumulated the highest of 541.98 ± 19.22 and 576.75 ± 40.55 μg cadmium per plant with 110.77 ± 12.68 and 202.54 ± 19.12 g dry mass in these contaminated purple soil and alluvial soil, respectively. Higher phytoextraction efficiency with higher cadmium concentration in tissues was observed in poplar growing in purple soil than that in alluvial soil at relative lower soil cadmium concentration. The poplar growing in alluvial soil had relative higher tolerance ability with lower reduction rates of morphological and growth characters than that in purple soil, suggesting that the poplar growing in alluvial soil might display the higher phytoextraction ability when cadmium contamination level increased. Even so, the poplars exhibited obvious cadmium transport from root to shoot in both soils regardless of cadmium contamination levels. It implies that this examined poplar can extract more cadmium than some hyperaccumulators. The results indicated that metal phytoextraction using the poplar can be applied to clean up soils moderately contaminated by cadmium in these purple soil and alluvial soil.

Transport and use of CO2 in the xylem sap of Populus deltoides

International Nuclear Information System (INIS)

Stringer, J.W.; Kimmerer, T.W.

1990-01-01

Results of recent experiments indicate an internal cycling of respiratory CO 2 in woody plants. The CO 2 concentration of xylem sap expressed from the twigs of field grown Populus deltoides ranged from .14 to .50 mM. The pH of the xylem sap was 5.7 to 6.7, providing a significant bicarbonate concentration in many samples. Total dissolved inorganic carbon (DIC = CO 2 + H 2 CO 3 + HCO 3 - ) was 0.5 mM to 1.3 mM. Results from the analysis of xylem sap of 10 other species of woody plants were similar. To determine the fate of DIC delivered to the leaves of Populus deltoides, excised leaves were fed 1mM NaHCO 3 (2 μCi NaH 14 CO 3 ml -1 ). Less than 0.4% of the label escaped from the leaves, and ≥93% was fixed. Of the carbon fixed 56% of the 14 C was found in the petiole and midrib, and 14% was in the major veins, with the remaining 30% in the minor veins and lamina. Shading of the peptiole and midrib of leaves decreased the amount of fixed carbon in these tissues to 38% and increased the amount in the lamina to 55%

Zinc accumulation potential and toxicity threshold determined for a metal-accumulating Populus canescens clone in a dose-response study

Energy Technology Data Exchange (ETDEWEB)

Langer, Ingrid [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria); Krpata, Doris [Institute of Microbiology, Innsbruck University, Technikerstrasse 25, A-6020 Innsbruck (Austria); Fitz, Walter J.; Wenzel, Walter W. [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria); Schweiger, Peter F., E-mail: peter.schweiger@boku.ac.a [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria)

2009-10-15

The effect of increasing soil Zn concentrations on growth and Zn tissue concentrations of a metal-accumulating aspen clone was examined in a dose-response study. Plants were grown in a soil with a low native Zn content which was spiked with Zn salt solutions and subsequently aged. Plant growth was not affected by NH{sub 4}NO{sub 3}-extractable soil Zn concentrations up to 60 mug Zn g{sup -1} soil, but it was completely inhibited at extractable concentrations above 90 mug Zn g{sup -1} soil. From these data an effective concentration of 68.5 mug extractable Zn g{sup -1} soil was calculated at which plant growth was reduced by 50%. The obtained information on toxicity threshold concentrations, and the relation between plant Zn accumulation and extractable soil Zn concentrations may be used to assess the suitability of the investigated Populus canescens clone for various phytoremediation strategies. The potential risk of metal transfer into food webs associated with P. canescens stands on Zn-polluted sites may also be estimated. - Quantitative information about the concentration-dependent Zn accumulation of Populus canescens contributes to assess its suitability for phytoremediation.

Differential expression of poplar sucrose nonfermenting1-related protein kinase 2 genes in response to abiotic stress and abscisic acid.

Science.gov (United States)

Yu, Xiang; Takebayashi, Arika; Demura, Taku; Ohtani, Misato

2017-09-01

Knowledge on the responses of woody plants to abiotic stress can inform strategies to breed improved tree varieties and to manage tree species for environmental conservation and the production of lignocellulosic biomass. In this study, we examined the expression patterns of poplar (Populus trichocarpa) genes encoding members of the sucrose nonfermenting1-related protein kinase 2 (SnRK2) family, which are core components of the abiotic stress response. The P. trichocarpa genome contains twelve SnRK2 genes (PtSnRK2.1- PtSnRK2.12) that can be divided into three subclasses (I-III) based on the structures of their encoded kinase domains. We found that PtSnRK2s are differentially expressed in various organs. In MS medium-grown plants, all of the PtSnRK2 genes were significantly upregulated in response to abscisic acid (ABA) treatment, whereas osmotic and salt stress treatments induced only some (four and seven, respectively) of the PtSnRK2 genes. By contrast, soil-grown plants showed increased expression of most PtSnRK2 genes under drought and salt treatments, but not under ABA treatment. In soil-grown plants, drought stress induced SnRK2 subclass II genes in all tested organs (leaves, stems, and roots), whereas subclass III genes tended to be upregulated in leaves only. These results suggest that the PtSnRK2 genes are involved in abiotic stress responses, are at least partially activated by ABA, and show organ-specific responses.

Effects of summer and winter harvesting on element phytoextraction efficiency of Salix and Populus clones planted on contaminated soil.

Science.gov (United States)

Kubátová, Pavla; Száková, Jiřina; Břendová, Kateřina; Kroulíková-Vondráčková, Stanislava; Mercl, Filip; Tlustoš, Pavel

2018-04-16

The clones of fast-growing trees (FGTs) were investigated for phytoextraction of soil contaminated with risk elements (REs), especially Cd, Pb, and Zn. As a main experimental factor, the potential effect of biomass harvesting time was assessed. The field experiment with two Salix clones (S1 - (Salix schwerinii × Salix viminalis) × S. viminalis, S2 - S. × smithiana) and two Populus clones (P1 - Populus maximowiczii × Populus nigra, P2 - P. nigra) was established in April 2009. Shoots of all clones were first harvested in February 2012. After two further growing seasons, the first half of the trees was harvested in September 2013 before leaf fall (summer harvest) and the second half in February 2014 (winter harvest). Remediation factors (RFs) for all clones and all REs (except Pb for clone S1) were higher in the summer harvest. The highest annual RFs for Cd and for Zn (1.34 and 0.67%, respectively) were found for clone S2 and were significantly higher than other clones. Although no increased mortality of trees harvested in the summer was detected in the following season, the effect of summer harvesting on the phytoextraction potential of FGTs clones should be investigated in long-term studies.

Towards a map of the Populus biomass protein-protein interaction network

Energy Technology Data Exchange (ETDEWEB)

Beers, Eric [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Brunner, Amy [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Helm, Richard [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Dickerman, Allan [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States)

2015-07-31

Biofuels can be produced from a variety of plant feedstocks. The value of a particular feedstock for biofuels production depends in part on the degree of difficulty associated with the extraction of fermentable sugars from the plant biomass. The wood of trees is potentially a rich source fermentable sugars. However, the sugars in wood exist in a tightly cross-linked matrix of cellulose, hemicellulose, and lignin, making them largely recalcitrant to release and fermentation for biofuels production. Before breeders and genetic engineers can effectively develop plants with reduced recalcitrance to fermentation, it is necessary to gain a better understanding of the fundamental biology of the mechanisms responsible for wood formation. Regulatory, structural, and enzymatic proteins are required for the complicated process of wood formation. To function properly, proteins must interact with other proteins. Yet, very few of the protein-protein interactions necessary for wood formation are known. The main objectives of this project were to 1) identify new protein-protein interactions relevant to wood formation, and 2) perform in-depth characterizations of selected protein-protein interactions. To identify relevant protein-protein interactions, we cloned a set of approximately 400 genes that were highly expressed in the wood-forming tissue (known as secondary xylem) of poplar (Populus trichocarpa). We tested whether the proteins encoded by these biomass genes interacted with each other in a binary matrix design using the yeast two-hybrid (Y2H) method for protein-protein interaction discovery. We also tested a subset of the 400 biomass proteins for interactions with all proteins present in wood-forming tissue of poplar in a biomass library screen design using Y2H. Together, these two Y2H screens yielded over 270 interactions involving over 75 biomass proteins. For the second main objective we selected several interacting pairs or groups of interacting proteins for in

Repeated unidirectional introgression towards Populus balsamifera in contact zones of exotic and native poplars

NARCIS (Netherlands)

Thompson, S.L.; Lamothe, M.; Meirmans, P.G.; Périnet, P.; Isabel, N.

2010-01-01

As the evolutionary significance of hybridization is largely dictated by its extent beyond the first generation, we broadly surveyed patterns of introgression across a sympatric zone of two native poplars (Populus balsamifera, Populus deltoides) in Quebec, Canada within which European exotic Populus

Functional Gene Discovery and Characterization of Genes and Alleles Affecting Wood Biomass Yield and Quality in Populus

Energy Technology Data Exchange (ETDEWEB)

Busov, Victor [Michigan Technological Univ., Houghton, MI (United States)

2017-02-12

Adoption of biofuels as economically and environmentally viable alternative to fossil fuels would require development of specialized bioenergy varieties. A major goal in the breeding of such varieties is the improvement of lignocellulosic biomass yield and quality. These are complex traits and understanding the underpinning molecular mechanism can assist and accelerate their improvement. This is particularly important for tree bioenergy crops like poplars (species and hybrids from the genus Populus), for which breeding progress is extremely slow due to long generation cycles. A variety of approaches have been already undertaken to better understand the molecular bases of biomass yield and quality in poplar. An obvious void in these undertakings has been the application of mutagenesis. Mutagenesis has been instrumental in the discovery and characterization of many plant traits including such that affect biomass yield and quality. In this proposal we use activation tagging to discover genes that can significantly affect biomass associated traits directly in poplar, a premier bioenergy crop. We screened a population of 5,000 independent poplar activation tagging lines under greenhouse conditions for a battery of biomass yield traits. These same plants were then analyzed for changes in wood chemistry using pyMBMS. As a result of these screens we have identified nearly 800 mutants, which are significantly (P<0.05) different when compared to wild type. Of these majority (~700) are affected in one of ten different biomass yield traits and 100 in biomass quality traits (e.g., lignin, S/G ration and C6/C5 sugars). We successfully recovered the position of the tag in approximately 130 lines, showed activation in nearly half of them and performed recapitulation experiments with 20 genes prioritized by the significance of the phenotype. Recapitulation experiments are still ongoing for many of the genes but the results are encouraging. For example, we have shown successful

The polyphenol oxidase gene family in land plants: Lineage-specific duplication and expansion

Directory of Open Access Journals (Sweden)

Tran Lan T

2012-08-01

Full Text Available Abstract Background Plant polyphenol oxidases (PPOs are enzymes that typically use molecular oxygen to oxidize ortho-diphenols to ortho-quinones. These commonly cause browning reactions following tissue damage, and may be important in plant defense. Some PPOs function as hydroxylases or in cross-linking reactions, but in most plants their physiological roles are not known. To better understand the importance of PPOs in the plant kingdom, we surveyed PPO gene families in 25 sequenced genomes from chlorophytes, bryophytes, lycophytes, and flowering plants. The PPO genes were then analyzed in silico for gene structure, phylogenetic relationships, and targeting signals. Results Many previously uncharacterized PPO genes were uncovered. The moss, Physcomitrella patens, contained 13 PPO genes and Selaginella moellendorffii (spike moss and Glycine max (soybean each had 11 genes. Populus trichocarpa (poplar contained a highly diversified gene family with 11 PPO genes, but several flowering plants had only a single PPO gene. By contrast, no PPO-like sequences were identified in several chlorophyte (green algae genomes or Arabidopsis (A. lyrata and A. thaliana. We found that many PPOs contained one or two introns often near the 3’ terminus. Furthermore, N-terminal amino acid sequence analysis using ChloroP and TargetP 1.1 predicted that several putative PPOs are synthesized via the secretory pathway, a unique finding as most PPOs are predicted to be chloroplast proteins. Phylogenetic reconstruction of these sequences revealed that large PPO gene repertoires in some species are mostly a consequence of independent bursts of gene duplication, while the lineage leading to Arabidopsis must have lost all PPO genes. Conclusion Our survey identified PPOs in gene families of varying sizes in all land plants except in the genus Arabidopsis. While we found variation in intron numbers and positions, overall PPO gene structure is congruent with the phylogenetic

Cloning and characterization of an AUX/IAA gene in Populus davidiana x P. alba var. Pyramidalis and the correlation between its time-course expression and the levels of indole-3-acetic in saplings inoculated with Trichoderma

International Nuclear Information System (INIS)

Yao, Z.; Baloch, A.M.; Zhai, T.; Jiang, C.; Liu, Z.; Zhang, R.

2018-01-01

Poda AUX/IAA gene, encoding an early-stage responsive protein to auxin in Populus davidiana x P. alba var. pyramidalis (Shanxin poplar), was cloned. The length of mRNA transcript of Poda AUX/IAA was 741bp, encoding a 248-amino-acid protein product, Poda AUX/IAA ORF analysis suggested that Poda AUX/IAA contained one conserved domain (pfam02309). Predicted molecular weight of Poda AUX/IAA was found to be 27kDa and its theoretical isoelectric point was determined as 8.21. Poda AUX/IAA was predicted to be a hydrophilic nucleoprotein and its multi-sequence alignment analysis showed that it shares high identity in four conserved domains with eight AUX/IAA proteins in other Populus species and these sequences of Poda AUX/IAA shared highest similarity with Pt-IAA14.1 in P. trichocarpa. In this study, we found that Poda AUX/IAA was expressed in both leaves and roots of Shanxin poplar. Three strains of Trichoderma asperellum were used to inoculate Shanxin poplar saplings. Inoculated saplings were cultured for 72 h. It was then found that IAA levels in both leaves and roots of inoculated saplings gradually increased and time-course expression patterns of PodaAUX/IAA was changed along with IAA levels. Results of Pearson correlation analysis demonstrated a negative correlation between expression levels of Poda AUX/IAA and IAA levels in both leaves and roots of Shanxin poplar saplings when compared with control. Negative correlation in inoculated saplings were less significant, probably as a result of Trichoderma inducing. (author)

Dicty_cDB: VHD854 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available N AC187854 |AC187854.2 Populus trichocarpa clone Pop1-11B14, complete sequence. 38 0.15 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...itrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent

Detection of a variable number of ribosomal DNA loci by fluorescent in situ hybridization in Populus species.

Science.gov (United States)

Prado, E A; Faivre-Rampant, P; Schneider, C; Darmency, M A

1996-10-01

Fluorescent in situ hybridization (FISH) was applied to related Populus species (2n = 19) in order to detect rDNA loci. An interspecific variability in the number of hybridization sites was revealed using as probe an homologous 25S clone from Populus deltoides. The application of image analysis methods to measure fluorescence intensity of the hybridization signals has enabled us to characterize major and minor loci in the 18S-5.8S-25S rDNA. We identified one pair of such rDNA clusters in Populus alba; two pairs, one major and one minor, in both Populus nigra and P. deltoides; and three pairs in Populus balsamifera, (two major and one minor) and Populus euroamericana (one major and two minor). FISH results are in agreement with those based on RFLP analysis. The pBG13 probe containing 5S sequence from flax detected two separate clusters corresponding to the two size classes of units that coexist within 5S rDNA of most Populus species. Key words : Populus spp., fluorescent in situ hybridization, FISH, rDNA variability, image analysis.

Leaf, woody, and root biomass of Populus irrigated with landfill leachate

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny; D.R. Coyle; R.B. Hall

2007-01-01

Poplar (Populus spp.) trees can be utilized for ecological leachate disposal when applied as an irrigation source for managed tree systems. Our objective was to evaluate differences in tree height, diameter, volume, and biomass of leaf, stem, branch, and root tissues of Populus trees after two seasons of irrigation with municipal...

Genome-wide survey and characterization of the WRKY gene family in Populus trichocarpa.

Science.gov (United States)

He, Hongsheng; Dong, Qing; Shao, Yuanhua; Jiang, Haiyang; Zhu, Suwen; Cheng, Beijiu; Xiang, Yan

2012-07-01

WRKY transcription factors participate in diverse physiological and developmental processes in plants. They have highly conserved WRKYGQK amino acid sequences in their N-termini, followed by the novel zinc-finger-like motifs, Cys₂His₂ or Cys₂HisCys. To date, numerous WRKY genes have been identified and characterized in a number of herbaceous species. Survey and characterization of WRKY genes in a ligneous species would facilitate a better understanding of the evolutionary processes and functions of this gene family. In this study, 104 poplar WRKY genes (PtWRKY) were identified in the latest poplar genome sequence. According to their structural features, the predicted members were divided into the previously defined groups I-III, as described in rice. In addition, chromosomal localization of the genes demonstrated that there might be WRKY gene hot spots in 2.3 Mb regions on chromosome 14. Furthermore, approximately 83% (86 out of 104) WRKY genes participated in gene duplication events, including 69% (29 out of 42) gene pairs which exhibited segmental duplication. Using semi-quantitative RT-PCR, the expression patterns of subgroup III genes were investigated under different stresses [cold, drought, salinity and salicylic acid (SA)]. The data revealed that these genes presented different expression levels in response to various stress conditions. Expression analysis exhibited PtWRKY76 gene induced markedly in 0.1 mM SA or 25% PEG-6000 treatment. The results presented here provide a fundamental clue for cloning specific function genes in further studies and applications. This study identified 104 poplar WRKY genes and demonstrated WRKY gene hot spots on chromosome 14. Furthermore, semi-quantitative RT-PCR showed variable stress responses in subgroup III.

Trade-offs between xylem hydraulic properties, wood anatomy and yield in Populus.

Science.gov (United States)

Hajek, Peter; Leuschner, Christoph; Hertel, Dietrich; Delzon, Sylvain; Schuldt, Bernhard

2014-07-01

Trees face the dilemma that achieving high plant productivity is accompanied by a risk of drought-induced hydraulic failure due to a trade-off in the trees' vascular system between hydraulic efficiency and safety. By investigating the xylem anatomy of branches and coarse roots, and measuring branch axial hydraulic conductivity and vulnerability to cavitation in 4-year-old field-grown aspen plants of five demes (Populus tremula L. and Populus tremuloides Michx.) differing in growth rate, we tested the hypotheses that (i) demes differ in wood anatomical and hydraulic properties, (ii) hydraulic efficiency and safety are related to xylem anatomical traits, and (iii) aboveground productivity and hydraulic efficiency are negatively correlated to cavitation resistance. Significant deme differences existed in seven of the nine investigated branch-related anatomical and hydraulic traits but only in one of the four coarse-root-related anatomical traits; this likely is a consequence of high intra-plant variation in root morphology and the occurrence of a few 'high-conductivity roots'. Growth rate was positively related to branch hydraulic efficiency (xylem-specific conductivity) but not to cavitation resistance; this indicates that no marked trade-off exists between cavitation resistance and growth. Both branch hydraulic safety and hydraulic efficiency significantly depended on vessel size and were related to the genetic distance between the demes, while the xylem pressure causing 88% loss of hydraulic conductivity (P88 value) was more closely related to hydraulic efficiency than the commonly used P50 value. Deme-specific variation in the pit membrane structure may explain why vessel size was not directly linked to growth rate. We conclude that branch hydraulic efficiency is an important growth-influencing trait in aspen, while the assumed trade-off between productivity and hydraulic safety is weak. © The Author 2014. Published by Oxford University Press. All rights reserved

Structure and evolution of the plant cation diffusion facilitator family of ion transporters

Directory of Open Access Journals (Sweden)

Zanis Michael J

2011-03-01

Full Text Available Abstract Background Members of the cation diffusion facilitator (CDF family are integral membrane divalent cation transporters that transport metal ions out of the cytoplasm either into the extracellular space or into internal compartments such as the vacuole. The spectrum of cations known to be transported by proteins of the CDF family include Zn, Fe, Co, Cd, and Mn. Members of this family have been identified in prokaryotes, eukaryotes, and archaea, and in sequenced plant genomes. CDF families range in size from nine members in Selaginella moellendorffii to 19 members in Populus trichocarpa. Phylogenetic analysis suggests that the CDF family has expanded within plants, but a definitive plant CDF family phylogeny has not been constructed. Results Representative CDF members were annotated from diverse genomes across the Viridiplantae and Rhodophyta lineages and used to identify phylogenetic relationships within the CDF family. Bayesian phylogenetic analysis of CDF amino acid sequence data supports organizing land plant CDF family sequences into 7 groups. The origin of the 7 groups predates the emergence of land plants. Among these, 5 of the 7 groups are likely to have originated at the base of the tree of life, and 2 of 7 groups appear to be derived from a duplication event prior to or coincident with land plant evolution. Within land plants, local expansion continues within select groups, while several groups are strictly maintained as one gene copy per genome. Conclusions Defining the CDF gene family phylogeny contributes to our understanding of this family in several ways. First, when embarking upon functional studies of the members, defining primary groups improves the predictive power of functional assignment of orthologous/paralogous genes and aids in hypothesis generation. Second, defining groups will allow a group-specific sequence motif to be generated that will help define future CDF family sequences and aid in functional motif

Dicty_cDB: VHC611 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available one UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.4 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington ...72513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl... Populus trichocarpa clone Pop1-11B14, complete sequence. 38 0.30 5 CX072513 |CX0

Vapour pressure deficit during growth has little impact on genotypic differences of transpiration efficiency at leaf and whole-plant level: an example from Populus nigra L.

Science.gov (United States)

Rasheed, Fahad; Dreyer, Erwin; Richard, Béatrice; Brignolas, Franck; Brendel, Oliver; Le Thiec, Didier

2015-04-01

Poplar genotypes differ in transpiration efficiency (TE) at leaf and whole-plant level under similar conditions. We tested whether atmospheric vapour pressure deficit (VPD) affected TE to the same extent across genotypes. Six Populus nigra genotypes were grown under two VPD. We recorded (1) (13)C content in soluble sugars; (2) (18)O enrichment in leaf water; (3) leaf-level gas exchange; and (4) whole-plant biomass accumulation and water use. Whole-plant and intrinsic leaf TE and (13)C content in soluble sugars differed significantly among genotypes. Stomatal conductance contributed more to these differences than net CO2 assimilation rate. VPD increased water use and reduced whole-plant TE. It increased intrinsic leaf-level TE due to a decline in stomatal conductance. It also promoted higher (18)O enrichment in leaf water. VPD had no genotype-specific effect. We detected a deviation in the relationship between (13)C in leaf sugars and (13)C predicted from gas exchange and the standard discrimination model. This may be partly due to genotypic differences in mesophyll conductance, and to its lack of sensitivity to VPD. Leaf-level (13)C discrimination was a powerful predictor of the genetic variability of whole-plant TE irrespective of VPD during growth. © 2014 John Wiley & Sons Ltd.

Prevalent Role of Gene Features in Determining Evolutionary Fates of Whole-Genome Duplication Duplicated Genes in Flowering Plants1[W][OA

Science.gov (United States)

Jiang, Wen-kai; Liu, Yun-long; Xia, En-hua; Gao, Li-zhi

2013-01-01

The evolution of genes and genomes after polyploidization has been the subject of extensive studies in evolutionary biology and plant sciences. While a significant number of duplicated genes are rapidly removed during a process called fractionation, which operates after the whole-genome duplication (WGD), another considerable number of genes are retained preferentially, leading to the phenomenon of biased gene retention. However, the evolutionary mechanisms underlying gene retention after WGD remain largely unknown. Through genome-wide analyses of sequence and functional data, we comprehensively investigated the relationships between gene features and the retention probability of duplicated genes after WGDs in six plant genomes, Arabidopsis (Arabidopsis thaliana), poplar (Populus trichocarpa), soybean (Glycine max), rice (Oryza sativa), sorghum (Sorghum bicolor), and maize (Zea mays). The results showed that multiple gene features were correlated with the probability of gene retention. Using a logistic regression model based on principal component analysis, we resolved evolutionary rate, structural complexity, and GC3 content as the three major contributors to gene retention. Cluster analysis of these features further classified retained genes into three distinct groups in terms of gene features and evolutionary behaviors. Type I genes are more prone to be selected by dosage balance; type II genes are possibly subject to subfunctionalization; and type III genes may serve as potential targets for neofunctionalization. This study highlights that gene features are able to act jointly as primary forces when determining the retention and evolution of WGD-derived duplicated genes in flowering plants. These findings thus may help to provide a resolution to the debate on different evolutionary models of gene fates after WGDs. PMID:23396833

Mitochondrial DNA variation and genetic relationships of Populus species.

Science.gov (United States)

Barrett, J W; Rajora, O P; Yeh, F C; Dancik, B P; Strobeck, C

1993-02-01

We examined variation in and around the region coding for the cytochrome c oxidase I (coxI) and ATPase 6 (atp6) genes in the mitochondrial genomes of four Populus species (P. nigra, P. deltoides, P. maximowiczii, and P. tremuloides) and the natural hybrid P. x canadensis (P. deltoides x P. nigra). Total cellular DNAs of these poplars were digested with 16 restriction endonucleases and probed with maize mtDNA-specific probes (CoxI and Atp6). The only variant observed for Atp6 was interspecific, with P. maximowiczii separated from the other species as revealed by EcoRI digestions. No intraspecific mtDNA variation was observed among individuals of P. nigra, P. maximowiczii, P. x canadensis, or P. tremuloides for the CoxI probe. However, two varieties of P. deltoides were distinct because of a single site change in the KpnI digestions, demonstrating that P. deltoides var. deltoides (eastern cottonwood) and var. occidentalis (plains cottonwood) have distinct mitochondrial genomes in the region of the coxI gene. Populus x canadensis shared the same restriction fragment patterns as its suspected maternal parent P. deltoides. Nucleotide substitutions per base in and around the coxI and atp6 genes among the Populus species and the hybrid ranged from 0.0017 to 0.0077. The interspecific estimates of nucleotide substitution per base suggested that P. tremuloides was furthest removed from P. deltoides and P. x canadensis and least diverged from P. nigra. Populus maximowiczii was placed between these two clusters.

A novel bHLH transcription factor PebHLH35 from Populus euphratica confers drought tolerance through regulating stomatal development, photosynthesis and growth in Arabidopsis

Energy Technology Data Exchange (ETDEWEB)

Dong, Yan [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Liaoning Forestry Vocational-Technical College, Shenyang 110101 (China); Wang, Congpeng; Han, Xiao; Tang, Sha; Liu, Sha [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Xia, Xinli, E-mail: xiaxl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Yin, Weilun, E-mail: yinwl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China)

2014-07-18

Highlights: • PebHLH35 is firstly cloned from Populus euphratica and characterized its functions. • PebHLH35 is important for earlier seedling establishment and vegetative growth. • PebHLH35 enhances tolerance to drought by regulating growth. • PebHLH35 enhances tolerance to drought by regulating stomatal development. • PebHLH35 enhances tolerance to drought by regulating photosynthesis and transpiration. - Abstract: Plant basic helix-loop-helix (bHLH) transcription factors (TFs) are involved in a variety of physiological processes including the regulation of plant responses to various abiotic stresses. However, few drought-responsive bHLH family members in Populus have been reported. In this study, a novel bHLH gene (PebHLH35) was cloned from Populus euphratica. Expression analysis in P. euphratica revealed that PebHLH35 was induced by drought and abscisic acid. Subcellular localization studies using a PebHLH35-GFP fusion showed that the protein was localized to the nucleus. Ectopic overexpression of PebHLH35 in Arabidopsis resulted in a longer primary root, more leaves, and a greater leaf area under well-watered conditions compared with vector control plants. Notably, PebHLH35 overexpression lines showed enhanced tolerance to water-deficit stress. This finding was supported by anatomical and physiological analyses, which revealed a reduced stomatal density, stomatal aperture, transpiration rate, and water loss, and a higher chlorophyll content and photosynthetic rate. Our results suggest that PebHLH35 functions as a positive regulator of drought stress responses by regulating stomatal density, stomatal aperture, photosynthesis and growth.

A novel bHLH transcription factor PebHLH35 from Populus euphratica confers drought tolerance through regulating stomatal development, photosynthesis and growth in Arabidopsis

International Nuclear Information System (INIS)

Dong, Yan; Wang, Congpeng; Han, Xiao; Tang, Sha; Liu, Sha; Xia, Xinli; Yin, Weilun

2014-01-01

Highlights: • PebHLH35 is firstly cloned from Populus euphratica and characterized its functions. • PebHLH35 is important for earlier seedling establishment and vegetative growth. • PebHLH35 enhances tolerance to drought by regulating growth. • PebHLH35 enhances tolerance to drought by regulating stomatal development. • PebHLH35 enhances tolerance to drought by regulating photosynthesis and transpiration. - Abstract: Plant basic helix-loop-helix (bHLH) transcription factors (TFs) are involved in a variety of physiological processes including the regulation of plant responses to various abiotic stresses. However, few drought-responsive bHLH family members in Populus have been reported. In this study, a novel bHLH gene (PebHLH35) was cloned from Populus euphratica. Expression analysis in P. euphratica revealed that PebHLH35 was induced by drought and abscisic acid. Subcellular localization studies using a PebHLH35-GFP fusion showed that the protein was localized to the nucleus. Ectopic overexpression of PebHLH35 in Arabidopsis resulted in a longer primary root, more leaves, and a greater leaf area under well-watered conditions compared with vector control plants. Notably, PebHLH35 overexpression lines showed enhanced tolerance to water-deficit stress. This finding was supported by anatomical and physiological analyses, which revealed a reduced stomatal density, stomatal aperture, transpiration rate, and water loss, and a higher chlorophyll content and photosynthetic rate. Our results suggest that PebHLH35 functions as a positive regulator of drought stress responses by regulating stomatal density, stomatal aperture, photosynthesis and growth

The Relationship between Insect Resistance and Tree Age of Transgenic Triploid Populus tomentosa Plants.

Science.gov (United States)

Ren, Yachao; Zhang, Jun; Wang, Guiying; Liu, Xiaojie; Li, Li; Wang, Jinmao; Yang, Minsheng

2018-01-01

To explore the stability of insect resistance during the development of transgenic insect-resistant trees, this study investigated how insect resistance changes as transgenic trees age. We selected 19 transgenic insect-resistant triploid Populus tomentosa lines as plant material. The presence of exogenous genes and Cry1Ac protein expression were verified using polymerase chain reaction (PCR) and enzyme-linked immunosorbent assay (ELISA) analyses. The toxicity for Clostera anachoreta and Lymantria dispar was evaluated by feeding fresh leaves to first instar larvae after the trees were planted in the field for 2 years and after the sixth year. Results of PCR showed that the exogenous genes had a long-term presence in the poplar genome. ELISA analyses showed significant differences existed on the 6-year-old transgenic lines. The insect-feeding experiment demonstrated significant differences in the mortality rates of C. anachoreta and L. dispar among different transgenic lines. The average corrected mortality rates of C. anachoreta and L. dispar ranged from 5.6-98.7% to 35.4-7.2% respectively. The larval mortality rates differed significantly between the lines at different ages. Up to 52.6% of 1-year-old transgenic lines and 42.1% of 2-year-old transgenic lines caused C. anachoreta larval mortality rates to exceed 80%, whereas only 26.3% of the 6-year-old transgenic lines. The mortality rates of L. dispar exhibited the same trend: 89.5% of 1-year-old transgenic lines and 84.2% of 2-year-old transgenic lines caused L. dispar larval mortality rates to exceed 80%; this number decreased to 63.2% for the 6-year-old plants. The proportion of 6-year-old trees with over 80% larval mortality rates was clearly lower than that of the younger trees. The death distribution of C. anachoreta in different developmental stages also showed the larvae that fed on the leaves of 1-year-old trees were killed mostly during L 1 and L 2 stages, whereas the proportion of larvae that died in L 3

The Plant Genome Integrative Explorer Resource: PlantGenIE.org.

Science.gov (United States)

Sundell, David; Mannapperuma, Chanaka; Netotea, Sergiu; Delhomme, Nicolas; Lin, Yao-Cheng; Sjödin, Andreas; Van de Peer, Yves; Jansson, Stefan; Hvidsten, Torgeir R; Street, Nathaniel R

2015-12-01

Accessing and exploring large-scale genomics data sets remains a significant challenge to researchers without specialist bioinformatics training. We present the integrated PlantGenIE.org platform for exploration of Populus, conifer and Arabidopsis genomics data, which includes expression networks and associated visualization tools. Standard features of a model organism database are provided, including genome browsers, gene list annotation, Blast homology searches and gene information pages. Community annotation updating is supported via integration of WebApollo. We have produced an RNA-sequencing (RNA-Seq) expression atlas for Populus tremula and have integrated these data within the expression tools. An updated version of the ComPlEx resource for performing comparative plant expression analyses of gene coexpression network conservation between species has also been integrated. The PlantGenIE.org platform provides intuitive access to large-scale and genome-wide genomics data from model forest tree species, facilitating both community contributions to annotation improvement and tools supporting use of the included data resources to inform biological insight. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

Identification and allelic dissection uncover roles of lncRNAs in secondary growth of Populus tomentosa.

Science.gov (United States)

Zhou, Daling; Du, Qingzhang; Chen, Jinhui; Wang, Qingshi; Zhang, Deqiang

2017-10-01

Long non-coding RNAs (lncRNAs) function in various biological processes. However, their roles in secondary growth of plants remain poorly understood. Here, 15,691 lncRNAs were identified from vascular cambium, developing xylem, and mature xylem of Populus tomentosa with high and low biomass using RNA-seq, including 1,994 lncRNAs that were differentially expressed (DE) among the six libraries. 3,569 cis-regulated and 3,297 trans-regulated protein-coding genes were predicted as potential target genes (PTGs) of the DE lncRNAs to participate in biological regulation. Then, 476 and 28 lncRNAs were identified as putative targets and endogenous target mimics (eTMs) of Populus known microRNAs (miRNAs), respectively. Genome re-sequencing of 435 individuals from a natural population of P. tomentosa found 34,015 single nucleotide polymorphisms (SNPs) within 178 lncRNA loci and 522 PTGs. Single-SNP associations analysis detected 2,993 associations with 10 growth and wood-property traits under additive and dominance model. Epistasis analysis identified 17,656 epistatic SNP pairs, providing evidence for potential regulatory interactions between lncRNAs and their PTGs. Furthermore, a reconstructed epistatic network, representing interactions of 8 lncRNAs and 15 PTGs, might enrich regulation roles of genes in the phenylpropanoid pathway. These findings may enhance our understanding of non-coding genes in plants. © The Author 2017. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

Effects of hybridization and evolutionary constraints on secondary metabolites: the genetic architecture of phenylpropanoids in European populus species.

Science.gov (United States)

Caseys, Celine; Stritt, Christoph; Glauser, Gaetan; Blanchard, Thierry; Lexer, Christian

2015-01-01

The mechanisms responsible for the origin, maintenance and evolution of plant secondary metabolite diversity remain largely unknown. Decades of phenotypic studies suggest hybridization as a key player in generating chemical diversity in plants. Knowledge of the genetic architecture and selective constraints of phytochemical traits is key to understanding the effects of hybridization on plant chemical diversity and ecological interactions. Using the European Populus species P. alba (White poplar) and P. tremula (European aspen) and their hybrids as a model, we examined levels of inter- and intraspecific variation, heritabilities, phenotypic correlations, and the genetic architecture of 38 compounds of the phenylpropanoid pathway measured by liquid chromatography and mass spectrometry (UHPLC-MS). We detected 41 quantitative trait loci (QTL) for chlorogenic acids, salicinoids and flavonoids by genetic mapping in natural hybrid crosses. We show that these three branches of the phenylpropanoid pathway exhibit different geographic patterns of variation, heritabilities, and genetic architectures, and that they are affected differently by hybridization and evolutionary constraints. Flavonoid abundances present high species specificity, clear geographic structure, and strong genetic determination, contrary to salicinoids and chlorogenic acids. Salicinoids, which represent important defence compounds in Salicaceae, exhibited pronounced genetic correlations on the QTL map. Our results suggest that interspecific phytochemical differentiation is concentrated in downstream sections of the phenylpropanoid pathway. In particular, our data point to glycosyltransferase enzymes as likely targets of rapid evolution and interspecific differentiation in the 'model forest tree' Populus.

Effects of hybridization and evolutionary constraints on secondary metabolites: the genetic architecture of phenylpropanoids in European populus species.

Directory of Open Access Journals (Sweden)

Celine Caseys

Full Text Available The mechanisms responsible for the origin, maintenance and evolution of plant secondary metabolite diversity remain largely unknown. Decades of phenotypic studies suggest hybridization as a key player in generating chemical diversity in plants. Knowledge of the genetic architecture and selective constraints of phytochemical traits is key to understanding the effects of hybridization on plant chemical diversity and ecological interactions. Using the European Populus species P. alba (White poplar and P. tremula (European aspen and their hybrids as a model, we examined levels of inter- and intraspecific variation, heritabilities, phenotypic correlations, and the genetic architecture of 38 compounds of the phenylpropanoid pathway measured by liquid chromatography and mass spectrometry (UHPLC-MS. We detected 41 quantitative trait loci (QTL for chlorogenic acids, salicinoids and flavonoids by genetic mapping in natural hybrid crosses. We show that these three branches of the phenylpropanoid pathway exhibit different geographic patterns of variation, heritabilities, and genetic architectures, and that they are affected differently by hybridization and evolutionary constraints. Flavonoid abundances present high species specificity, clear geographic structure, and strong genetic determination, contrary to salicinoids and chlorogenic acids. Salicinoids, which represent important defence compounds in Salicaceae, exhibited pronounced genetic correlations on the QTL map. Our results suggest that interspecific phytochemical differentiation is concentrated in downstream sections of the phenylpropanoid pathway. In particular, our data point to glycosyltransferase enzymes as likely targets of rapid evolution and interspecific differentiation in the 'model forest tree' Populus.

The differential response of photosynthesis to high temperature for a boreal and temperate Populus species relates to differences in Rubisco activation and Rubisco activase properties.

Science.gov (United States)

Hozain, Moh'd I; Salvucci, Michael E; Fokar, Mohamed; Holaday, A Scott

2010-01-01

Significant inhibition of photosynthesis occurs at temperatures only a few degrees (plants, whereas similar studies with trees have been limited in number. As temperature is a major factor limiting the geographic ranges of most plants, the aim of this study was to use two Populus species adapted to contrasting thermal environments for determining the factors that constrain photosynthetic assimilation (A) under moderate heat stress in tree species. Consistent with its native range in temperate regions, Populus deltoides Bartr. ex Marsh. exhibited a significantly higher temperature optimum for A than did Populus balsamifera L., a boreal species. The higher A exhibited by P. deltoides at 33-40 degrees C compared to that for P. balsamifera was associated with a higher activation state of Rubisco and correlated with a higher ATPase activity of Rubisco activase. The temperature response of minimal chlorophyll a fluorescence for darkened leaves was similar for both species and was not consistent with a thylakoid lipid phase change contributing to the decline in A in the range of 30-40 degrees C. Taken together, these data support the idea that the differences in the temperature response of A for the two Populus species could be attributed to the differences in the response of Rubisco activation and ultimately to the thermal properties of Rubisco activase. That the primary sequence of Rubisco activase differed between the species, especially in regions associated with ATPase activity and Rubisco recognition, indicates that the genotypic differences in Rubisco activase might underlie the differences in the heat sensitivity of Rubisco activase and photosynthesis at moderately high temperatures.

Phytoremediation of landfill leachate using Populus

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Richard B. Hall; Bart Sexton

2006-01-01

Proper genotype selection is required for successful phytoremediation. We selected eight Populus clones (NC13460, NC14018, DM115, NC14104, NC14106, DN5, NM2, NM6) of four genomic groups after three cycles of phyto-recurrent selection for a field trial that began June 2005 at the Oneida County Landfill in Rhinelander, WI, USA.

Roles of gibberellin catabolism and signaling in growth and physiological response to drought and short-day photoperiods in Populus trees.

Directory of Open Access Journals (Sweden)

Christine Zawaski

Full Text Available Survival and productivity of perennial plants in temperate zones are dependent on robust responses to prolonged and seasonal cycles of unfavorable conditions. Here we report whole-genome microarray, expression, physiological, and transgenic evidence in hybrid poplar (Populus tremula × Populus alba showing that gibberellin (GA catabolism and repressive signaling mediates shoot growth inhibition and physiological adaptation in response to drought and short-day (SD induced bud dormancy. Both water deprivation and SDs elicited activation of a suite of poplar GA2ox and DELLA encoding genes. Poplar transgenics with up-regulated GA 2-oxidase (GA2ox and DELLA domain proteins showed hypersensitive growth inhibition in response to both drought and SDs. In addition, the transgenic plants displayed greater drought resistance as evidenced by increased pigment concentrations (chlorophyll and carotenoid and reductions in electrolyte leakage (EL. Comparative transcriptome analysis using whole-genome microarray showed that the GA-deficiency and GA-insensitivity, SD-induced dormancy, and drought response in poplar share a common regulon of 684 differentially-expressed genes, which suggest GA metabolism and signaling plays a role in plant physiological adaptations in response to alterations in environmental factors. Our results demonstrate that GA catabolism and repressive signaling represents a major route for control of growth and physiological adaptation in response to immediate or imminent adverse conditions.

Biomass and genotype × environment interactions of Populus energy crops in the midwestern United States

Science.gov (United States)

Ronald S., Jr. Zalesny; Richard B. Hall; Jill A. Zalesny; Bernard G. McMahon; William E. Berguson; Glen R. Stanosz

2009-01-01

Using Populus feedstocks for biofuels, bioenergy, and bioproducts is becoming economically feasible as global fossil fuel prices increase. Maximizing Populus biomass production across regional landscapes largely depends on understanding genotype × environment interactions, given broad genetic variation at strategic (...

Patterns of genetic diversity and differentiation in resistance gene clusters of two hybridizing European Populus species

OpenAIRE

Casey, Céline; Stölting, Kai N.; Barbará, Thelma; González-Martínez, Santiago C.; Lexer, Christian

2015-01-01

Resistance genes (R-genes) are essential for long-lived organisms such as forest trees, which are exposed to diverse herbivores and pathogens. In short-lived model species, R-genes have been shown to be involved in species isolation. Here, we studied more than 400 trees from two natural hybrid zones of the European Populus species Populus alba and Populus tremula for microsatellite markers located in three R-gene clusters, including one cluster situated in the incipient sex chromosome region....

Total Content of Polyphenols and Antioxidant Activity of Different Melliferous Plants

Directory of Open Access Journals (Sweden)

Claudia Pasca

2016-01-01

Full Text Available In this study polyphenols content and antioxidant activity of melliferous plants for the following: mint (Mentha pulegium, burdock (Arctium lappa, comfrey (Symphytum officinale, plantain (Pantago lanceolata, thyme (Thymus vulgaris, sage (Salvia officinalis, marigold (Calendula officinalis, small marshmallow (Althaea officinalis, echinacea (Echinaceea angustifolia and black popular (Populus nigra were investigated, using two different extraction methods. High content of polyphenols and flavones were extracted from Populus nigra, with an average of both extractions 23.14 mg GAE/g and 78.07 mg QE/g flavones. Among the studied plants, Arctium lappa registered the highest antioxidant activity (0.129 mmol Trolox/mL in alcoholic extract and Echinaceea angustifolia with a value of 0.122 mmol Trolox/mL in aqueous extract. The lowest values were recorded for the antioxidant activity of Althaea officinalis (alcoholic extract and Arctium lappa (aqueous extract. The results show that Arctium lappa, Echinaceea angustifolia and Populus nigra can be considered melliferous plants for their high biologically active compounds potential and bee products (honey and pollen that having the composition of these plants will have high antioxidant and antibacterial properties.

Het geslacht Populus in verband met zijn beteekenis voor de houtteelt = The genus populus and its significance in silviculture

NARCIS (Netherlands)

Houtzagers, G.

1937-01-01

The genus Populus L. can be divided into 5 sections. This study deals with the classification and description of the species and varieties of the section Aigeiros Duby (black poplars), which contains almost all the important cultivated types in the Netherlands. The botanical information was

Kinetic modeling of batch fermentation for Populus hydrolysate tolerant mutant and wild type strains of Clostridium thermocellum.

Science.gov (United States)

Linville, Jessica L; Rodriguez, Miguel; Mielenz, Jonathan R; Cox, Chris D

2013-11-01

The extent of inhibition of two strains of Clostridium thermocellum by a Populus hydrolysate was investigated. A Monod-based model of wild type (WT) and Populus hydrolysate tolerant mutant (PM) strains of the cellulolytic bacterium C. thermocellum was developed to quantify growth kinetics in standard media and the extent of inhibition to a Populus hydrolysate. The PM was characterized by a higher growth rate (μmax=1.223 vs. 0.571 h(-1)) and less inhibition (KI,gen=0.991 vs. 0.757) in 10% v/v Populus hydrolysate compared to the WT. In 17.5% v/v Populus hydrolysate inhibition of PM increased slightly (KI,gen=0.888), whereas the WT was strongly inhibited and did not grow in a reproducible manner. Of the individual inhibitors tested, 4-hydroxybenzoic acid was the most inhibitory, followed by galacturonic acid. The PM did not have a greater ability to detoxify the hydrolysate than the WT. Copyright © 2013 Elsevier Ltd. All rights reserved.

A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

Energy Technology Data Exchange (ETDEWEB)

Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

2014-04-14

Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

Energy Technology Data Exchange (ETDEWEB)

Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

2015-04-15

Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

Characterization of Developmental- and Stress-Mediated Expression of Cinnamoyl-CoA Reductase in Kenaf (Hibiscus cannabinus L.)

Science.gov (United States)

Lim, Hyoun-Sub; Park, Sang-Un; Bae, Hyeun-Jong; Natarajan, Savithiry

2014-01-01

Cinnamoyl-CoA reductase (CCR) is an important enzyme for lignin biosynthesis as it catalyzes the first specific committed step in monolignol biosynthesis. We have cloned a full length coding sequence of CCR from kenaf (Hibiscus cannabinus L.), which contains a 1,020-bp open reading frame (ORF), encoding 339 amino acids of 37.37 kDa, with an isoelectric point (pI) of 6.27 (JX524276, HcCCR2). BLAST result found that it has high homology with other plant CCR orthologs. Multiple alignment with other plant CCR sequences showed that it contains two highly conserved motifs: NAD(P) binding domain (VTGAGGFIASWMVKLLLEKGY) at N-terminal and probable catalytic domain (NWYCYGK). According to phylogenetic analysis, it was closely related to CCR sequences of Gossypium hirsutum (ACQ59094) and Populus trichocarpa (CAC07424). HcCCR2 showed ubiquitous expression in various kenaf tissues and the highest expression was detected in mature flower. HcCCR2 was expressed differentially in response to various stresses, and the highest expression was observed by drought and NaCl treatments. PMID:24723816

Characterization of Developmental- and Stress-Mediated Expression of Cinnamoyl-CoA Reductase in Kenaf (Hibiscus cannabinus L.

Directory of Open Access Journals (Sweden)

Ritesh Ghosh

2014-01-01

Full Text Available Cinnamoyl-CoA reductase (CCR is an important enzyme for lignin biosynthesis as it catalyzes the first specific committed step in monolignol biosynthesis. We have cloned a full length coding sequence of CCR from kenaf (Hibiscus cannabinus L., which contains a 1,020-bp open reading frame (ORF, encoding 339 amino acids of 37.37 kDa, with an isoelectric point (pI of 6.27 (JX524276, HcCCR2. BLAST result found that it has high homology with other plant CCR orthologs. Multiple alignment with other plant CCR sequences showed that it contains two highly conserved motifs: NAD(P binding domain (VTGAGGFIASWMVKLLLEKGY at N-terminal and probable catalytic domain (NWYCYGK. According to phylogenetic analysis, it was closely related to CCR sequences of Gossypium hirsutum (ACQ59094 and Populus trichocarpa (CAC07424. HcCCR2 showed ubiquitous expression in various kenaf tissues and the highest expression was detected in mature flower. HcCCR2 was expressed differentially in response to various stresses, and the highest expression was observed by drought and NaCl treatments.

Examination of correlation between histidine and nickel absorption by Morus L., Robinia pseudoacacia L. and Populus nigra L. using HPLC-MS and ICP-MS.

Science.gov (United States)

Ozen, Sukran Akkus; Yaman, Mehmet

2016-08-02

In this study, HPLC-MS and ICP-MS methods were used for the determination of histidine and nickel in Morus L., Robinia pseudoacacia L., and Populus nigra L. leaves taken from industrial areas including Gaziantep and Bursa cities. In the determination of histidine by HPLC-MS, all of the system parameters such as flow rate of mobile phase, fragmentor potential, injection volume and column temperature were optimized and found to be 0.2 mL min(-1), 70 V, 15 µL, and 20°C, respectively. Under the optimum conditions, histidine was extracted from plant sample by distilled water at 90°C for 30 min. Concentrations of histidine as mg kg(-1) were found to be between 2-9 for Morus L., 6-13 for Robinia pseudoacacia L., and 2-10 for Populus nigra L. Concentrations of nickel were in the ranges of 5-10 mg kg(-1) for Morus L., 3-10 mg kg(-1) for Robinia pseudoacacia L., and 0.6-4 mg kg(-1) for Populus nigra L. A significant linear correlation (r = 0.78) between histidine and Ni was observed for Populus nigra L., whereas insignificant linear correlation for Robinia pseudoacacia L. (r = 0.22) were seen. Limits of detection (LOD) and quantitation (LOQ) were found to be 0.025 mg Ni L(-1) and 0.075 mg Ni L(-1), respectively.

Populus (Salicaceae plantations

Directory of Open Access Journals (Sweden)

Gonzalo M. Romano

2013-01-01

Full Text Available Aunque los cultivos forestales son comunidades artificiales, modifican condiciones ambientales que pueden alterar la diversidad fúngica nativa. Se estudiaron los efectos del manejo forestal de una plantación de sauces (Salix y álamos (Populus sobre la biodiversidad de Agaromycetes durante un año en una isla del Delta del Paraná, Argentina. Se midieron el peso seco y el número de basidiomas. Se identificaron 28 especies pertenecientes a los Agaricomycetes: 26 especies de Agaricales, una de Polyporales y una de Russulales. Nuestros resultados sugieren que el manejo forestal de dicha plantación no afecta la abundancia ni la diversidad de basidiomas de Agaricomycetes.

Genome-wide investigation reveals high evolutionary rates in annual model plants.

Science.gov (United States)

Yue, Jia-Xing; Li, Jinpeng; Wang, Dan; Araki, Hitoshi; Tian, Dacheng; Yang, Sihai

2010-11-09

Rates of molecular evolution vary widely among species. While significant deviations from molecular clock have been found in many taxa, effects of life histories on molecular evolution are not fully understood. In plants, annual/perennial life history traits have long been suspected to influence the evolutionary rates at the molecular level. To date, however, the number of genes investigated on this subject is limited and the conclusions are mixed. To evaluate the possible heterogeneity in evolutionary rates between annual and perennial plants at the genomic level, we investigated 85 nuclear housekeeping genes, 10 non-housekeeping families, and 34 chloroplast genes using the genomic data from model plants including Arabidopsis thaliana and Medicago truncatula for annuals and grape (Vitis vinifera) and popular (Populus trichocarpa) for perennials. According to the cross-comparisons among the four species, 74-82% of the nuclear genes and 71-97% of the chloroplast genes suggested higher rates of molecular evolution in the two annuals than those in the two perennials. The significant heterogeneity in evolutionary rate between annuals and perennials was consistently found both in nonsynonymous sites and synonymous sites. While a linear correlation of evolutionary rates in orthologous genes between species was observed in nonsynonymous sites, the correlation was weak or invisible in synonymous sites. This tendency was clearer in nuclear genes than in chloroplast genes, in which the overall evolutionary rate was small. The slope of the regression line was consistently lower than unity, further confirming the higher evolutionary rate in annuals at the genomic level. The higher evolutionary rate in annuals than in perennials appears to be a universal phenomenon both in nuclear and chloroplast genomes in the four dicot model plants we investigated. Therefore, such heterogeneity in evolutionary rate should result from factors that have genome-wide influence, most likely those

Expression Patterns of ERF Genes Underlying Abiotic Stresses in Di-Haploid Populus simonii × P. nigra

Directory of Open Access Journals (Sweden)

Shengji Wang

2014-01-01

Full Text Available 176 ERF genes from Populus were identified by bioinformatics analysis, 13 of these in di-haploid Populus simonii × P. nigra were investigate by real-time RT-PCR, the results demonstrated that 13 ERF genes were highly responsive to salt stress, drought stress and ABA treatment, and all were expressed in root, stem, and leaf tissues, whereas their expression levels were markedly different in the various tissues. In roots, PthERF99, 110, 119, and 168 were primarily downregulated under drought and ABA treatment but were specifically upregulated under high salt condition. Interestingly, in poplar stems, all ERF genes showed the similar trends in expression in response to NaCl stress, drought stress, and ABA treatment, indicating that they may not play either specific or unique roles in stems in abiotic stress responses. In poplar leaves, PthERF168 was highly induced by ABA treatment, but was suppressed by high salinity and drought stresses, implying that PthERF168 participated in the ABA signaling pathway. The results of this study indicated that ERF genes could play essential but distinct roles in various plant tissues in response to different environment cues and hormonal treatment.

Micropropagation, genetic engineering, and molecular biology of Populus

Science.gov (United States)

N. B. Klopfenstein; Y. W. Chun; M. -S. Kim; M. A. Ahuja; M. C. Dillon; R. C. Carman; L. G. Eskew

1997-01-01

Thirty-four Populus biotechnology chapters, written by 85 authors, are comprised in 5 sections: 1) in vitro culture (micropropagation, somatic embryogenesis, protoplasts, somaclonal variation, and germplasm preservation); 2) transformation and foreign gene expression; 3) molecular biology (molecular/genetic characterization); 4) biotic and abiotic resistance (disease,...

The genome sequence of the North-European cucumber (Cucumis sativus L.) unravels evolutionary adaptation mechanisms in plants.

Science.gov (United States)

Wóycicki, Rafał; Witkowicz, Justyna; Gawroński, Piotr; Dąbrowska, Joanna; Lomsadze, Alexandre; Pawełkowicz, Magdalena; Siedlecka, Ewa; Yagi, Kohei; Pląder, Wojciech; Seroczyńska, Anna; Śmiech, Mieczysław; Gutman, Wojciech; Niemirowicz-Szczytt, Katarzyna; Bartoszewski, Grzegorz; Tagashira, Norikazu; Hoshi, Yoshikazu; Borodovsky, Mark; Karpiński, Stanisław; Malepszy, Stefan; Przybecki, Zbigniew

2011-01-01

Cucumber (Cucumis sativus L.), a widely cultivated crop, has originated from Eastern Himalayas and secondary domestication regions includes highly divergent climate conditions e.g. temperate and subtropical. We wanted to uncover adaptive genome differences between the cucumber cultivars and what sort of evolutionary molecular mechanisms regulate genetic adaptation of plants to different ecosystems and organism biodiversity. Here we present the draft genome sequence of the Cucumis sativus genome of the North-European Borszczagowski cultivar (line B10) and comparative genomics studies with the known genomes of: C. sativus (Chinese cultivar--Chinese Long (line 9930)), Arabidopsis thaliana, Populus trichocarpa and Oryza sativa. Cucumber genomes show extensive chromosomal rearrangements, distinct differences in quantity of the particular genes (e.g. involved in photosynthesis, respiration, sugar metabolism, chlorophyll degradation, regulation of gene expression, photooxidative stress tolerance, higher non-optimal temperatures tolerance and ammonium ion assimilation) as well as in distributions of abscisic acid-, dehydration- and ethylene-responsive cis-regulatory elements (CREs) in promoters of orthologous group of genes, which lead to the specific adaptation features. Abscisic acid treatment of non-acclimated Arabidopsis and C. sativus seedlings induced moderate freezing tolerance in Arabidopsis but not in C. sativus. This experiment together with analysis of abscisic acid-specific CRE distributions give a clue why C. sativus is much more susceptible to moderate freezing stresses than A. thaliana. Comparative analysis of all the five genomes showed that, each species and/or cultivars has a specific profile of CRE content in promoters of orthologous genes. Our results constitute the substantial and original resource for the basic and applied research on environmental adaptations of plants, which could facilitate creation of new crops with improved growth and yield in

Metabolic functions of Pseudomonas fluorescens strains from Populus deltoides depend on rhizosphere or endosphere isolation compartment

Directory of Open Access Journals (Sweden)

Collin M Timm

2015-10-01

Full Text Available The bacterial microbiota of plants is diverse, with 1,000s of operational taxonomic units (OTUs associated with any individual plant. In this work we investigate the differences between 19 sequenced Pseudomonas fluorescens strains, isolated from Populus deltoides rhizosphere and endosphere and which represent a single OTU, using phenotypic analysis, comparative genomics, and metabolic models. While no traits were exclusive to either endosphere or rhizosphere P. fluorescens isolates, multiple pathways relevant for plant-bacterial interactions are enriched in endosphere isolate genomes. Further, growth phenotypes such as phosphate solubilization, protease activity, denitrification and root growth promotion are biased towards endosphere isolates. Endosphere isolates have significantly more metabolic pathways for plant signaling compounds and an increased metabolic range that includes utilization of energy rich nucleotides and sugars, consistent with endosphere colonization. Rhizosphere P. fluorescens have fewer pathways representative of plant-bacterial interactions but show metabolic bias towards chemical substrates often found in root exudates. This work reveals the diverse functions that may contribute to colonization of the endosphere by bacteria and are enriched among closely related isolates.

Ex situ growth and biomass of Populus bioenergy crops irrigated and fertilized with landfill leachate

International Nuclear Information System (INIS)

Zalesny, Ronald S.; Wiese, Adam H.; Bauer, Edmund O.; Riemenschneider, Donald E.

2009-01-01

Merging traditional intensive forestry with waste management offers dual goals of fiber and bioenergy production, along with environmental benefits such as soil/water remediation and carbon sequestration. As part of an ongoing effort to acquire data about initial genotypic performance, we evaluated: (1) the early aboveground growth of trees belonging to currently utilized Populus genotypes subjected to irrigation with municipal solid waste landfill leachate or non-fertilized well water (control), and (2) the above- and below-ground biomass of the trees after 70 days of growth. We determined height, diameter, and number of leaves at 28, 42, 56, and 70 days after planting (DAP), along with stem, leaf, and root dry mass by testing six Populus clones (DN34, DN5, I4551, NC14104, NM2, NM6) grown in a greenhouse in a split-split plot, repeated measures design with two blocks, two treatments (whole-plots), six clones (sub-plots), and four sampling dates (sub-sub-plots, repeated measure). Treatments (leachate, water) were applied every other day beginning 42 DAP. The leachate-treated trees exhibited greater height, diameter, and number of leaves at 56 and 70 DAP (P 0.05). Overall, genotypic responses to the leachate treatment were clone-specific for all traits

Allocation to reproduction and relative reproductive costs in two species of dioecious Anacardiaceae with contrasting phenology.

Science.gov (United States)

Matsuyama, Shuhei; Sakimoto, Michinori

2008-06-01

The cost of reproduction in dioecious plants is often female-biased. However, several studies have reported no difference in costs of reproduction between the sexes. In this study, the relative reproductive allocation and costs at the shoot and whole-plant levels were examined in woody dioecious Rhus javanica and R. trichocarpa, in order to examine differences between types of phenophase (i.e. physiological stage of development). Male and female Rhus javanica and R. trichocarpa were sampled and the reproductive and vegetative allocation of the shoot were estimated by harvesting reproductive current-year shoots during flowering and fruiting. Measurements were made of the number of reproductive and total current-year shoots per whole plant, and of the basal area increment (BAI). The numbers of reproductive and total current-year shoots per 1-year-old shoot were counted in order to examine the costs in the following year at the shoot level. A female-biased annual reproductive allocation was found; however, the ratio of reproductive current-year shoots per tree and the BAI did not differ between sexes in Rhus javanica and R. trichocarpa. The percentage of 1-year-old shoots with at least one reproductive current-year shoot was significantly male-biased in R. trichocarpa, but not in R. javanica, indicating that there was a relative cost at the shoot level only in R. trichocarpa. The female-biased leaf mass per shoot, an indicator of compensation for costs, was only found in R. javanica. Relative reproductive costs at the shoot level were detected in Rhus trichocarpa, which has simultaneous leafing and flowering, but not in R. javanica, which has leafing followed by flowering. However, the costs for the whole-plant level were diminished in both species. The results suggest that the phenophase type may produce the different costs for R. javanica and R. trichocarpa through the development of a compensation mechanism.

Effects of Clone, Silvicultural, and Miticide Treatments on Cottonwood Leafcurl Mite (Acari: Eriophyidae) Damage in Plantation Populus

Science.gov (United States)

David R. Coyle

2002-01-01

Aculops lobuliferus (Keifer) is a little known pest of plantation Populus spp., which is capable of causing substantial damage. This is the First documented occurrence of A. lobuliferus in South Carolina. Previous anecdotal data indicated clonal variation in Populus susceptibility to A...

Qualitative variation in proanthocyanidin composition of Populus species and hybrids: genetics is the key.

Science.gov (United States)

Scioneaux, Ashley N; Schmidt, Michael A; Moore, Melissa A; Lindroth, Richard L; Wooley, Stuart C; Hagerman, Ann E

2011-01-01

The literature on proanthocyanidins (tannins) in ecological systems is dominated by quantitative studies. Despite evidence that the qualitative characteristics (subunit type, polymer chain length) of these complex polyphenolics are important determinants of biological activity, little is known about genetic and environmental controls on the type of proanthocyanidins produced by plants. We tested the hypothesis that genetics, season, developmental stage, and environment determine proanthocyanidin qualitative characteristics by using four Populus "cross types" (narrowleaf [P. angustifolia], Fremont [P. fremontii], F1 hybrids, and backcrosses to narrowleaf). We used thiolysis and HPLC analysis to characterize the proanthocyanidins, and found that genetics strongly control composition. The narrowleaf plants accumulate mixed procyanidin/prodelphinidins with average composition epicatechin(11)-epigallocatechin(8)-catechin(2)-catechin((terminal)). Backcross genotypes produce mixed procyanidin/prodelphinidins similar to narrowleaf, while Fremont makes procyanidin dimers, and the F1 plants contain procyanidin heptamers. Less striking effects were noted for genotype × environment, while season and developmental zone had little effect on proanthocyanidin composition or chain length. We discuss the metabolic and ecological consequences of differences in condensed tannin qualitative traits.

Genetic analysis of post-mating reproductive barriers in hybridizing European Populus species.

Science.gov (United States)

Macaya-Sanz, D; Suter, L; Joseph, J; Barbará, T; Alba, N; González-Martínez, S C; Widmer, A; Lexer, C

2011-10-01

Molecular genetic analyses of experimental crosses provide important information on the strength and nature of post-mating barriers to gene exchange between divergent populations, which are topics of great interest to evolutionary geneticists and breeders. Although not a trivial task in long-lived organisms such as trees, experimental interspecific recombinants can sometimes be created through controlled crosses involving natural F(1)'s. Here, we used this approach to understand the genetics of post-mating isolation and barriers to introgression in Populus alba and Populus tremula, two ecologically divergent, hybridizing forest trees. We studied 86 interspecific backcross (BC(1)) progeny and >350 individuals from natural populations of these species for up to 98 nuclear genetic markers, including microsatellites, indels and single nucleotide polymorphisms, and inferred the origin of the cytoplasm of the cross with plastid DNA. Genetic analysis of the BC(1) revealed extensive segregation distortions on six chromosomes, and >90% of these (12 out of 13) favored P. tremula donor alleles in the heterospecific genomic background. Since selection was documented during early diploid stages of the progeny, this surprising result was attributed to epistasis, cyto-nuclear coadaptation, heterozygote advantage at nuclear loci experiencing introgression or a combination of these. Our results indicate that gene flow across 'porous' species barriers affects these poplars and aspens beyond neutral, Mendelian expectations and suggests the mechanisms responsible. Contrary to expectations, the Populus sex determination region is not protected from introgression. Understanding the population dynamics of the Populus sex determination region will require tests based on natural interspecific hybrid zones.

Genotype differences in 13C discrimination between atmosphere and leaf matter match differences in transpiration efficiency at leaf and whole-plant levels in hybrid Populus deltoides x nigra.

Science.gov (United States)

Rasheed, Fahad; Dreyer, Erwin; Richard, Béatrice; Brignolas, Franck; Montpied, Pierre; Le Thiec, Didier

2013-01-01

(13) C discrimination between atmosphere and bulk leaf matter (Δ(13) C(lb) ) is frequently used as a proxy for transpiration efficiency (TE). Nevertheless, its relevance is challenged due to: (1) potential deviations from the theoretical discrimination model, and (2) complex time integration and upscaling from leaf to whole plant. Six hybrid genotypes of Populus deltoides×nigra genotypes were grown in climate chambers and tested for whole-plant TE (i.e. accumulated biomass/water transpired). Net CO(2) assimilation rates (A) and stomatal conductance (g(s) ) were recorded in parallel to: (1) (13) C in leaf bulk material (δ(13) C(lb) ) and in soluble sugars (δ(13) C(ss) ) and (2) (18) O in leaf water and bulk leaf material. Genotypic means of δ(13) C(lb) and δ(13) C(ss) were tightly correlated. Discrimination between atmosphere and soluble sugars was correlated with daily intrinsic TE at leaf level (daily mean A/g(s) ), and with whole-plant TE. Finally, g(s) was positively correlated to (18) O enrichment of bulk matter or water of leaves at individual level, but not at genotype level. We conclude that Δ(13) C(lb) captures efficiently the genetic variability of whole-plant TE in poplar. Nevertheless, scaling from leaf level to whole-plant TE requires to take into account water losses and respiration independent of photosynthesis, which remain poorly documented. © 2012 Blackwell Publishing Ltd.

Genetic Variation in Functional Traits Influences Arthropod Community Composition in Aspen (Populus tremula L.)

Science.gov (United States)

Robinson, Kathryn M.; Ingvarsson, Pär K.; Jansson, Stefan; Albrectsen, Benedicte R.

2012-01-01

We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp) collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores. PMID:22662190

Genetic variation in functional traits influences arthropod community composition in aspen (Populus tremula L..

Directory of Open Access Journals (Sweden)

Kathryn M Robinson

Full Text Available We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores.

Glycosylation-mediated phenylpropanoid partitioning in Populus tremuloides cell cultures

Directory of Open Access Journals (Sweden)

Babst Benjamin A

2009-12-01

Full Text Available Abstract Background Phenylpropanoid-derived phenolic glycosides (PGs and condensed tannins (CTs comprise large, multi-purpose non-structural carbon sinks in Populus. A negative correlation between PG and CT concentrations has been observed in several studies. However, the molecular mechanism underlying the relationship is not known. Results Populus cell cultures produce CTs but not PGs under normal conditions. Feeding salicyl alcohol resulted in accumulation of salicins, the simplest PG, in the cells, but not higher-order PGs. Salicin accrual reflected the stimulation of a glycosylation response which altered a number of metabolic activities. We utilized this suspension cell feeding system as a model for analyzing the possible role of glycosylation in regulating the metabolic competition between PG formation, CT synthesis and growth. Cells accumulated salicins in a dose-dependent manner following salicyl alcohol feeding. Higher feeding levels led to a decrease in cellular CT concentrations (at 5 or 10 mM, and a negative effect on cell growth (at 10 mM. The competition between salicin and CT formation was reciprocal, and depended on the metabolic status of the cells. We analyzed gene expression changes between controls and cells fed with 5 mM salicyl alcohol for 48 hr, a time point when salicin accumulation was near maximum and CT synthesis was reduced, with no effect on growth. Several stress-responsive genes were up-regulated, suggestive of a general stress response in the fed cells. Salicyl alcohol feeding also induced expression of genes associated with sucrose catabolism, glycolysis and the Krebs cycle. Transcript levels of phenylalanine ammonia lyase and most of the flavonoid pathway genes were reduced, consistent with down-regulated CT synthesis. Conclusions Exogenous salicyl alcohol was readily glycosylated in Populus cell cultures, a process that altered sugar utilization and phenolic partitioning in the cells. Using this system, we

Brine shrimp toxicity and antimalarial activity of some plants traditionally used in treatment of malaria in Msambweni district of Kenya.

Science.gov (United States)

Nguta, J M; Mbaria, J M

2013-07-30

In Kenya, most people especially in rural areas use traditional medicine and medicinal plants to treat many diseases including malaria. Malaria is of national concern in Kenya, in view of development of resistant strains of Plasmodium falciparum to drugs especially chloroquine, which had been effective and affordable. There is need for alternative and affordable therapy. Many antimalarial drugs have been derived from medicinal plants and this is evident from the reported antiplasmodial activity. The present study reports on the in vivo antimalarial activity and brine shrimp lethality of five medicinal plants traditionally used to treat malaria in Msambweni district, Kenya. A total of five aqueous crude extracts from different plant parts used in traditional medicine for the treatment of malaria were evaluated for their in vivo antimalarial activity using Plasmodium berghei infected Swiss mice and for their acute toxicity using Brine shrimp lethality test. The screened crude plant extracts suppressed parasitaemia as follows: Azadirachta indica (L) Burm. (Meliaceae), 3.1%; Dichrostachys cinerea (L) Wight et Arn (Mimosaceae), 6.3%; Tamarindus indica L. (Caesalpiniaceae), 25.1%; Acacia seyal Del. (Mimosaceae) 27.8% and Grewia trichocarpa Hochst ex A.Rich (Tiliaceae) 35.8%. In terms of toxicity, A.indica root bark extract had an LC50 of 285.8 µg/ml and was considered moderately toxic. T.indica stem bark extract and G.trichocarpa root extract had an LC50 of 516.4 and 545.8 µg/ml respectively and were considered to be weakly toxic while A.seyal and D.cinerea root extracts had a LC50>1000 µg/ml and were therefore considered to be non toxic. The results indicate that the aqueous extracts of the tested plants when used alone as monotherapy had antimalarial activity which was significantly different from that of chloroquine (P≤0.05). The results also suggest that the anecdotal efficacy of the above plants reported by the study community is related to synergism of

Successful grafting in poplar species (Populus spp.) breeding

Science.gov (United States)

A. Assibi Mahama; Brian Sparks; Ronald S., Zalesny; Richard B. Hall

2006-01-01

Poor rooting of Populus deltoides Bartr. ex Marsh hardwood cuttings often has contributed to delays in breeding progress as a result of failures of scion wood before and/or after pollination. Seventeen clones were used, and the study was conducted in the greenhouse to test an "intervenous feeding" (IV) method, along with three different...

Chloride and sodium uptake potential over an entire rotation of Populus irrigated with landfill leachate.

Science.gov (United States)

Zalesny, Jill A; Zalesny, Ronald S

2009-07-01

There is a need for information about the response of Populus genotypes to repeated application of high-salinity water and nutrient sources throughout an entire rotation. We have combined establishment biomass and uptake data with mid- and full-rotation growth data to project potential chloride (Cl-) and sodium (Na+) uptake for 2- to 11-year-old Populus in the north central United States. Our objectives were to identify potential levels of uptake as the trees developed and stages of plantation development that are conducive to variable application rates of high-salinity irrigation. The projected cumulative uptake of Cl- and Na+ during mid-rotation plantation development was stable 2 to 3 years after planting but increased steadily from year 3 to 6. Year six cumulative uptake ranged from 22 to 175 kg Cl- ha(-1) and 8 to 74 kg Na+ ha(-1), while annual uptake ranged from 8 to 54 kg Cl- ha(-1) yr(-1) and 3 to 23 kg Na+ ha(-1) yr(-1). Full-rotation uptake was greatest from 4 to 9 years (Cl-) and 4 to 8 years (Na+), with maximum levels of Cl- (32 kg ha(-1) yr(-1)) and Na+ (13 kg ha(-1) yr(-1)) occurring in year six. The relative uptake potential of Cl- and Na+ at peak accumulation (year six) was 2.7 times greater than at the end of the rotation.

Latitudinal variation in cold hardiness in introduced Tamarix and native Populus

Science.gov (United States)

Friedman, Jonathan M.; Roelle, James E.; Gaskin, John F.; Pepper, Alan E.; Manhart, James R.

2008-01-01

To investigate the evolution of clinal variation in an invasive plant, we compared cold hardiness in the introduced saltcedar (Tamarix ramosissima, Tamarix chinensis, and hybrids) and the native plains cottonwood (Populus deltoidessubsp. monilifera). In a shadehouse in Colorado (41°N), we grew plants collected along a latitudinal gradient in the central United States (29–48°N). On 17 occasions between September 2005 and June 2006, we determined killing temperatures using freeze-induced electrolyte leakage and direct observation. In midwinter, cottonwood survived cooling to −70°C, while saltcedar was killed at −33 to −47°C. Frost sensitivity, therefore, may limit northward expansion of saltcedar in North America. Both species demonstrated inherited latitudinal variation in cold hardiness. For example, from September through January killing temperatures for saltcedar from 29.18°N were 5–21°C higher than those for saltcedar from 47.60°N, and on September 26 and October 11, killing temperatures for cottonwood from 33.06°N were >43°C higher than those for cottonwood from 47.60°N. Analysis of nine microsatellite loci showed that southern saltcedars are more closely related to T. chinensis while northern plants are more closely related to T. ramosissima. Hybridization may have introduced the genetic variability necessary for rapid evolution of the cline in saltcedar cold hardiness.

Genome-Wide Analysis of a TaLEA-Introduced Transgenic Populus simonii × Populus nigra Dwarf Mutant

Directory of Open Access Journals (Sweden)

Jing Jiang

2012-03-01

Full Text Available A dwarf mutant (dwf1 was obtained among 15 transgenic lines, when TaLEA (Tamarix androssowii late embryogenesis abundant gene was introduced into Populus simonii × Populus nigra by Agrobacterium tumefaciens-mediated transformation. Under the same growth conditions, dwf1 height was significantly reduced compared with the wild type and the other transgenic lines. Because only one transgenic line (dwf1 displayed the dwarf phenotype, we considered that T-DNA insertion sites may play a role in the mutant formation. The mechanisms underlying this effect were investigated using TAIL-PCR (thermal asymmetric interlaced PCR and microarrays methods. According to the TAIL-PCR results, two flanking sequences located on chromosome IV and VIII respectively, were cloned. The results indicated the integration of two independent T-DNA copies. We searched for the potential genes near to the T-DNA insertions. The nearest gene was a putative poplar AP2 transcription factor (GI: 224073210. Expression analysis showed that AP2 was up-regulated in dwf1 compared with the wild type and the other transgenic lines. According to the microarrays results, a total of 537 genes involved in hydrolase, kinase and transcription factor activities, as well as protein and nucleotide binding, showed significant alterations in gene expression. These genes were expressed in more than 60 metabolic pathways, including starch, sucrose, galactose and glycerolipid metabolism and phenylpropanoids and flavonoid biosyntheses. Our transcriptome and T-DNA insertion sites analyses might provide some useful insights into the dwarf mutant formation.

Creation and genomic analysis of irradiation hybrids in Populus

Science.gov (United States)

Matthew S. Zinkgraf; K. Haiby; M.C. Lieberman; L. Comai; I.M. Henry; Andrew Groover

2016-01-01

Establishing efficient functional genomic systems for creating and characterizing genetic variation in forest trees is challenging. Here we describe protocols for creating novel gene-dosage variation in Populus through gamma-irradiation of pollen, followed by genomic analysis to identify chromosomal regions that have been deleted or inserted in...

Direct and indirect plant regeneration from various explants of ...

African Journals Online (AJOL)

user

2011-04-18

Apr 18, 2011 ... Populus species are important resource for certain branches of industry and have special roles for ... Key words: Poplar, tissue culture, regeneration, organogenesis. .... the best (90 to 100%) adaptation ratio in the plant growth.

AP2/EREBP transcription factors are part of gene regulatory networks and integrate metabolic, hormonal and environmental signals in stress acclimation and retrograde signalling.

Science.gov (United States)

Dietz, Karl-Josef; Vogel, Marc Oliver; Viehhauser, Andrea

2010-09-01

To optimize acclimation responses to environmental growth conditions, plants integrate and weigh a diversity of input signals. Signal integration within the signalling networks occurs at different sites including the level of transcription factor activation. Accumulating evidence assigns a major and diversified role in environmental signal integration to the family of APETALA 2/ethylene response element binding protein (AP2/EREBP) transcription factors. Presently, the Plant Transcription Factor Database 3.0 assigns 147 gene loci to this family in Arabidopsis thaliana, 200 in Populus trichocarpa and 163 in Oryza sativa subsp. japonica as compared to 13 to 14 in unicellular algae ( http://plntfdb.bio.uni-potsdam.de/v3.0/ ). AP2/EREBP transcription factors have been implicated in hormone, sugar and redox signalling in context of abiotic stresses such as cold and drought. This review exemplarily addresses present-day knowledge of selected AP2/EREBP with focus on a function in stress signal integration and retrograde signalling and defines AP2/EREBP-linked gene networks from transcriptional profiling-based graphical Gaussian models. The latter approach suggests highly interlinked functions of AP2/EREBPs in retrograde and stress signalling.

Early Events in Populus Hybrid and Fagus sylvatica Leaves Exposed to Ozone

Directory of Open Access Journals (Sweden)

R. Desotgiu

2010-01-01

Full Text Available This paper aims to investigate early responses to ozone in leaves of Fagus sylvatica (beech and Populus maximowiczii x Populus berolinensis (poplar. The experimental setup consisted of four open-air (OA plots, four charcoal-filtered (CF open-top chambers (OTCs, and four nonfiltered (NF OTCs. Qualitative and quantitative analyses were carried out on nonsymptomatic (CF and symptomatic (NF and OA leaves of both species. Qualitative analyses were performed applying microscopic techniques: Evans blue staining for detection of cell viability, CeCl3 staining of transmission electron microscope (TEM samples to detect the accumulation of H2O2, and multispectral fluorescence microimaging and microspectrofluorometry to investigate the accumulation of fluorescent phenolic compounds in the walls of the damaged cells. Quantitative analyses consisted of the analysis of the chlorophyll a fluorescence transients (fast kinetics. The early responses to ozone were demonstrated by the Evans blue and CeCl3 staining techniques that provided evidence of plant responses in both species 1 month before foliar symptoms became visible. The fluorescence transients analysis, too, demonstrated the breakdown of the oxygen evolving system and the inactivation of the end receptors of electrons at a very early stage, both in poplar and in beech. The accumulation of phenolic compounds in the cell walls, on the other hand, was a species-specific response detected in poplar, but not in beech. Evans blue and CeCl3 staining, as well as the multispectral fluorescence microimaging and microspectrofluorometry, can be used to support the field diagnosis of ozone injury, whereas the fast kinetics of chlorophyll fluorescence provides evidence of early physiological responses.

Trinucleotide repeat microsatellite markers for Black Poplar (Populus nigra L.)

NARCIS (Netherlands)

Smulders, M.J.M.; Schoot, van der J.; Arens, P.; Vosman, B.

2001-01-01

Using an enrichment procedure, we have cloned microsatellite repeats from black poplar (Populus nigra L.) and developed primers for microsatellite marker analysis. Ten primer pairs, mostly for trinucleotide repeats, produced polymorphic fragments in P. nigra. Some of them also showed amplification

Degradation of exogenous caffeine by Populus alba and its effects on endogenous caffeine metabolism.

Science.gov (United States)

Pierattini, Erika C; Francini, Alessandra; Raffaelli, Andrea; Sebastiani, Luca

2016-04-01

This is the first study reporting the presence of endogenous caffeine, theobromine, and theophylline in all organs of poplar plants. Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) was used in order to evaluate the uptake, translocation, and metabolism of caffeine-(trimethyl-(13)C) in Populus alba L. Villafranca clone grown in hydroponic conditions. We investigated the remediation of caffeine since it is one of the most widely consumed drugs and it is frequently detected in wastewater treatment plant effluents, surface water, and groundwater worldwide. Our results demonstrated that poplar can absorb and degrade exogenous caffeine without negative effects on plant health. Data showed that concentrations of all endogenous compounds varied depending on caffeine-(trimethyl-(13)C) treatments. In particular, in control conditions, endogenous caffeine, theobromine, and theophylline were mainly distributed in roots. On the other hand, once caffeine-(trimethyl-(13)C) was provided, this compound and its dimethy-(13)C metabolites are mainly localized at leaf level. In conclusion, our results support the possible use of Villafranca clone in association with other water treatment systems in order to complete the process of caffeine remediation.

Final Report on Regulation of Guaiacyl and Syringyl Monolignol Biosynthesis

Energy Technology Data Exchange (ETDEWEB)

Vincent L. Chiang

2006-03-09

The focus of this research is to understand syringyl monolignol biosynthesis that leads to the formation of syringyl lignin, a type of lignin that can be easily removed during biomass conversion. We have achieved the three originally proposed goals for this project. (1) SAD and CAD genes (enzyme catalytic and kinetic properties) and their functional relevance to CAld5H/AldOMT pathway, (2) spatiotemporal expression patterns of Cald5H, AldOMT, SAD and CAD genes, and (3) functions of CAld5H, AldOMT, and SAD genes in vivo using transgenic aspen. Furthermore, we also found that microRNA might be involved in the upstream regulatory network of lignin biosynthesis and wood formation. The achievements are as below. (1) Based on biochemical and molecular studies, we discovered a novel syringyl-specific alcohol dehydrogenase (SAD) involved in monolignol biosynthesis in angiosperm trees. Through CAld5H/OMT/SAD mediation, syringyl monolignol biosynthesis branches out from guaiacyl pathway at coniferaldehyde; (2) The function of CAld5H gene in this syringyl monolignol biosynthesis pathway also was confirmed in vivo in transgenic Populus; (3) The proposed major monolignol biosynthesis pathways were further supported by the involving biochemical functions of CCR based on a detailed kinetic study; (4) Gene promoter activity analysis also supported the cell-type specific expression of SAD and CAD genes in xylem tissue, consistent with the cell-specific locations of SAD and CAD proteins and with the proposed pathways; (5) We have developed a novel small interfering RNA (siRNA)-mediated stable gene-silencing system in transgenic plants; (6) Using the siRNA and P. trichocarpa transformation/regeneration systems we are currently producing transgenic P. trichocarpa to investigate the interactive functions of CAD and SAD in regulating guaiacyl and syringyl lignin biosynthesis; (7) We have cloned for the first time from a tree species, P. trichocarpa, small regulatory RNAs termed micro

Fast growing aspens in the development of a plant micropropagation system based on plant-produced ethylene action

International Nuclear Information System (INIS)

Žiauka, Jonas; Kuusienė, Sigutė; Šilininkas, Mindaugas

2013-01-01

Representatives of the genus Populus (poplars), such as Populus tremula L. (European aspen) and its fast-growing hybrids, are recognized as being among the most suitable tree species for short rotation coppicing in Northern Europe. Several technologies have been developed for fast propagation of selected aspen genotypes, including laboratory (in vitro) micropropagation, which is usually based on the action of exogenous plant hormones. Seeking to minimize the use of the latter, the present study was designed to test if the conditions suitable for increased accumulation of plant-produced gas, including the gaseous plant hormone ethylene, inside a culture vessel could contribute to commercially desirable changes in aspen development. Shoot cultures of several European and hybrid (Populus tremuloides Michx. × P. tremula) aspen genotypes were studied using two different types of culture vessels: tightly sealed Petri dishes (15 × 54 mm) designed to provide restricted gas exchange (RGE) conditions, and capped (but not sealed) test tubes (150 × 18 mm) providing control conditions. Under RGE conditions, not only the positive impact of the ethylene precursors 1-aminocyclopropane-1-carboxylic-acid (ACC) and ethephon on shoot proliferation was demonstrated but also a several-fold increase, compared to the control conditions, in the mean shoot number per explant was recorded even on the hormone-free nutrient medium. Moreover, the shoots developed under RGE conditions were distinguished by superior rooting ability in the subsequent culture. These results suggest that a plant micropropagation system based on the action of plant-produced ethylene rather than of exogenous hormones is possible. -- Highlights: ► Aspen in vitro cultures were grown in different vessels. ► Small-volume vessels were used for restriction of gas exchange. ► Aspen explants produced most shoots in small-volume vessels. ► Shoot proliferation was increased due to explant response to ethylene. �

Salt stress induces the formation of a novel type of 'pressure wood' in two Populus species.

Science.gov (United States)

Janz, Dennis; Lautner, Silke; Wildhagen, Henning; Behnke, Katja; Schnitzler, Jörg-Peter; Rennenberg, Heinz; Fromm, Jörg; Polle, Andrea

2012-04-01

• Salinity causes osmotic stress and limits biomass production of plants. The goal of this study was to investigate mechanisms underlying hydraulic adaptation to salinity. • Anatomical, ecophysiological and transcriptional responses to salinity were investigated in the xylem of a salt-sensitive (Populus × canescens) and a salt-tolerant species (Populus euphratica). • Moderate salt stress, which suppressed but did not abolish photosynthesis and radial growth in P. × canescens, resulted in hydraulic adaptation by increased vessel frequencies and decreased vessel lumina. Transcript abundances of a suite of genes (FLA, COB-like, BAM, XET, etc.) previously shown to be activated during tension wood formation, were collectively suppressed in developing xylem, whereas those for stress and defense-related genes increased. A subset of cell wall-related genes was also suppressed in salt-exposed P. euphratica, although this species largely excluded sodium and showed no anatomical alterations. Salt exposure influenced cell wall composition involving increases in the lignin : carbohydrate ratio in both species. • In conclusion, hydraulic stress adaptation involves cell wall modifications reciprocal to tension wood formation that result in the formation of a novel type of reaction wood in upright stems named 'pressure wood'. Our data suggest that transcriptional co-regulation of a core set of genes determines reaction wood composition. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

Preparation and Characterization of Lignocellulosic Oil Sorbent by Hydrothermal Treatment of Populus Fiber

Directory of Open Access Journals (Sweden)

Yue Zhang

2014-09-01

Full Text Available This study is aimed at achieving the optimum conditions of hydrothermal treatment and acetylation of Populus fiber to improve its oil sorption capacity (OSC in an oil-water mixture. The characteristics of the hydrolyzed and acetylated fibers were comparatively investigated by FT-IR, CP-MAS 13C-NMR, SEM and TGA. The optimum conditions of the hydrothermal treatment and acetylation were obtained at170 °C for 1 h and 120 °C for 2 h, respectively. The maximum OSC of the hydrolyzed fiber (16.78 g/g was slightly lower than that of the acetylated fiber (21.57 g/g, but they were both higher than the maximum OSC of the unmodified fiber (3.94 g/g. In addition, acetylation after hydrothermal treatment for the Populus fiber was unnecessary as the increment of the maximum OSC was only 3.53 g/g. The hydrolyzed and the acetylated Populus fibers both displayed a lumen orifice enabling a high oil entrapment. The thermal stability of the modified fibers was shown to be increased in comparison with that of the raw fiber. The hydrothermal treatment offers a new approach to prepare lignocellulosic oil sorbent.

The Populus ARBORKNOX1 homeodomain transcription factor regulates woody growth through binding to evolutionarily conserved target genes of diverse function

Science.gov (United States)

Lijun Liu; Matthew S. Zinkgraf; H. Earl Petzold; Eric P. Beers; Vladimir Filkov; Andrew Groover

2014-01-01

The class I KNOX homeodomain transcription factor ARBORKNOX1 (ARK1) is a key regulator of vascular cambium maintenance and cell differentiation in Populus. Currently, basic information is lacking concerning the distribution, functional characteristics, and evolution of ARK1 binding in the Populus genome.

Phylogeny reconstruction and hybrid analysis of populus (Salicaceae) based on nucleotide sequences of multiple single-copy nuclear genes and plastid fragments.

Science.gov (United States)

Wang, Zhaoshan; Du, Shuhui; Dayanandan, Selvadurai; Wang, Dongsheng; Zeng, Yanfei; Zhang, Jianguo

2014-01-01

Populus (Salicaceae) is one of the most economically and ecologically important genera of forest trees. The complex reticulate evolution and lack of highly variable orthologous single-copy DNA markers have posed difficulties in resolving the phylogeny of this genus. Based on a large data set of nuclear and plastid DNA sequences, we reconstructed robust phylogeny of Populus using parsimony, maximum likelihood and Bayesian inference methods. The resulting phylogenetic trees showed better resolution at both inter- and intra-sectional level than previous studies. The results revealed that (1) the plastid-based phylogenetic tree resulted in two main clades, suggesting an early divergence of the maternal progenitors of Populus; (2) three advanced sections (Populus, Aigeiros and Tacamahaca) are of hybrid origin; (3) species of the section Tacamahaca could be divided into two major groups based on plastid and nuclear DNA data, suggesting a polyphyletic nature of the section; and (4) many species proved to be of hybrid origin based on the incongruence between plastid and nuclear DNA trees. Reticulate evolution may have played a significant role in the evolution history of Populus by facilitating rapid adaptive radiations into different environments.

Phylogeny reconstruction and hybrid analysis of populus (Salicaceae based on nucleotide sequences of multiple single-copy nuclear genes and plastid fragments.

Directory of Open Access Journals (Sweden)

Zhaoshan Wang

Full Text Available Populus (Salicaceae is one of the most economically and ecologically important genera of forest trees. The complex reticulate evolution and lack of highly variable orthologous single-copy DNA markers have posed difficulties in resolving the phylogeny of this genus. Based on a large data set of nuclear and plastid DNA sequences, we reconstructed robust phylogeny of Populus using parsimony, maximum likelihood and Bayesian inference methods. The resulting phylogenetic trees showed better resolution at both inter- and intra-sectional level than previous studies. The results revealed that (1 the plastid-based phylogenetic tree resulted in two main clades, suggesting an early divergence of the maternal progenitors of Populus; (2 three advanced sections (Populus, Aigeiros and Tacamahaca are of hybrid origin; (3 species of the section Tacamahaca could be divided into two major groups based on plastid and nuclear DNA data, suggesting a polyphyletic nature of the section; and (4 many species proved to be of hybrid origin based on the incongruence between plastid and nuclear DNA trees. Reticulate evolution may have played a significant role in the evolution history of Populus by facilitating rapid adaptive radiations into different environments.

Genome Enabled Discovery of Carbon Sequestration Genes in Poplar

Energy Technology Data Exchange (ETDEWEB)

Filichkin, Sergei; Etherington, Elizabeth; Ma, Caiping; Strauss, Steve

2007-02-22

The goals of the S.H. Strauss laboratory portion of 'Genome-enabled discovery of carbon sequestration genes in poplar' are (1) to explore the functions of candidate genes using Populus transformation by inserting genes provided by Oakridge National Laboratory (ORNL) and the University of Florida (UF) into poplar; (2) to expand the poplar transformation toolkit by developing transformation methods for important genotypes; and (3) to allow induced expression, and efficient gene suppression, in roots and other tissues. As part of the transformation improvement effort, OSU developed transformation protocols for Populus trichocarpa 'Nisqually-1' clone and an early flowering P. alba clone, 6K10. Complete descriptions of the transformation systems were published (Ma et. al. 2004, Meilan et. al 2004). Twenty-one 'Nisqually-1' and 622 6K10 transgenic plants were generated. To identify root predominant promoters, a set of three promoters were tested for their tissue-specific expression patterns in poplar and in Arabidopsis as a model system. A novel gene, ET304, was identified by analyzing a collection of poplar enhancer trap lines generated at OSU (Filichkin et. al 2006a, 2006b). Other promoters include the pGgMT1 root-predominant promoter from Casuarina glauca and the pAtPIN2 promoter from Arabidopsis root specific PIN2 gene. OSU tested two induction systems, alcohol- and estrogen-inducible, in multiple poplar transgenics. Ethanol proved to be the more efficient when tested in tissue culture and greenhouse conditions. Two estrogen-inducible systems were evaluated in transgenic Populus, neither of which functioned reliably in tissue culture conditions. GATEWAY-compatible plant binary vectors were designed to compare the silencing efficiency of homologous (direct) RNAi vs. heterologous (transitive) RNAi inverted repeats. A set of genes was targeted for post transcriptional silencing in the model Arabidopsis system; these include the floral

Eucalyptus and Populus short rotation woody crops for phosphate mined lands in Florida USA

Energy Technology Data Exchange (ETDEWEB)

Rockwood, D L; Carter, D R; Langholtz, M H [The School of Forest Resources and Conservation, University of Florida, Box 110410, Gainesville, FL 32611 0410 (United States); Stricker, J A [Polk County Extension Service, University of Florida, Gainesville, FL 32611 (United States)

2006-08-15

Our short-rotation woody crops (SRWC) research in central and southern Florida is (1) developing superior Eucalyptus grandis (EG), E. amplifolia (EA), and cottonwood (Populus deltoides, PD) genotypes, (2) determining appropriate management practices for and associated productivities of these genotypes, and (3) assessing their economics and markets. Reclaimed clay settling areas (CSA) and overburden sites in phosphate mined areas in central Florida are a potential land base of over 80,000ha for SRWC production. On CSAs, PD grows well in the absence of cogongrass (Imperata cylindrica) but is not as productive as the non-invasive EG and EA. SRWC establishment on CSAs requires strict implementation of the following cultural practices: thorough site preparation through herbiciding/disking and bedding, superior trees, watering/packing seedlings, fertilization with ammonium nitrate at planting and annually thereafter as feasible, high planting density possibly including double row planting, and winter harvesting so that coppice regeneration suppresses weeds. PD cultural requirements, that may require post-planting weed control to suppress herbaceous competition, exceed those of the eucalypts. EG SRWCs on CSAs are at risk of blowdown 3-4 years after planting or coppicing; younger PD, EG, and EA SRWCs appear much less susceptible to wind damage. Genetic improvement must continue if EG, EA, and PD are to increase in commercial feasibility. SRWC cost competitiveness will depend on establishment success, yield improvements, harvesting costs, and identifying/using incentives. Strong collaboration among public and private partners is necessary for commercializing SRWCs in Florida. (author)

Organ and Tissue-specific Sucrose Transporters. Important Hubs in Gene and Metabolite Networks Regulating Carbon Use in Wood-forming Tissues of Populus

Energy Technology Data Exchange (ETDEWEB)

Harding, Scott A. [Univ. of Georgia, Athens, GA (United States); Tsai, Chung-Jui [Univ. of Georgia, Athens, GA (United States)

2016-01-04

The overall project objective was to probe the relationship between sucrose transporters and plant productivity in the biomass for biofuels woody perennial, Populus. At the time the proposal was written, sucrose transporters had already been investigated in many plant model systems, primarily with respect to the export of photosynthate sucrose from source leaves, and the uptake of sucrose in storage organs and seeds. Preliminary findings by the PI found that in Populus, sucrose transporter genes (SUTs) were well expressed in wood-forming tissues that comprise the feedstock for biofuels production. Because sucrose comprises by far the predominant form in which photosynthate is delivered from source organs to sink organs like roots and wood-forming tissues, SUTs control a gate that nominally at least could impact the allocation or partitioning of sucrose for potentially competing end uses like growth (stem biomass) and storage. In addition, water use might be conditioned by the way in which sucrose is distributed throughout the plant, and/or by the way in which sucrose is partitioned intracellularly. Several dozen transgenic lines were produced in year 1 of the project to perturb the expression ratio of multiple plasma membrane (PM) SUTs (intercellular trafficking), versus the single tonoplast membrane (TM) sucrose transporter that effectively regulates intracellular trafficking of sucrose. It was possible to obtain transgenic lines with dual SUT gene knockdown using the 35S promoter, but not the wood-specific TUA1 promoter. By the end of project year 2, a decision was made to work with the 35S plants while archiving the TUA1 plants. The PhD candidate charged with producing the transgenic lines abandoned the project during its second year, substantially contributing to the decision to operate with just the 35S lines. That student’s interests ranged more toward evolutionary topics, and a report on SUT gene evolution was published (Peng et al 2014).

Effect of applying an arsenic-resistant and plant growth-promoting rhizobacterium to enhance soil arsenic phytoremediation by Populus deltoides LH05-17.

Science.gov (United States)

Wang, Q; Xiong, D; Zhao, P; Yu, X; Tu, B; Wang, G

2011-11-01

Bioremediation of highly arsenic (As)-contaminated soil is difficult because As is very toxic for plants and micro-organisms. The aim of this study was to investigate soil arsenic removal effects using poplar in combination with the inoculation of a plant growth-promoting rhizobacterium (PGPR). A rhizobacterium D14 was isolated and identified within Agrobacterium radiobacter. This strain was highly resistant to arsenic and produced indole acetic acid and siderophore. Greenhouse pot bioremediation experiments were performed for 5 months using poplar (Populus deltoides LH05-17) grown on As-amended soils, inoculated with strain D14. The results showed that P. deltoides was an efficient arsenic accumulator; however, high As concentrations (150 and 300 mg kg(-1)) inhibited its growth. With the bacterial inoculation, in the 300 mg kg(-1) As-amended soils, 54% As in the soil was removed, which was higher than the uninoculated treatments (43%), and As concentrations in roots, stems and leaves were significantly increased by 229, 113 and 291%, respectively. In addition, the As translocation ratio [(stems + leaves)/roots = 0·8] was significantly higher than the uninoculated treatments (0·5). About 45% As was translocated from roots to the above-ground tissues. The plant height and dry weight of roots, stems and leaves were all enhanced; the contents of chlorophyll and soluble sugar, and the activities of superoxide dismutase and catalase were all increased; and the content of a toxic compound malondialdehyde was decreased. The results indicated that the inoculation of strain D14 could contribute to the increase in the As tolerance of P. deltoides, promotion of the growth, increase in the uptake efficiency and enhancement of As translocation. The use of P. deltoides in combination with the inoculation of strain D14 provides a potential application for efficient soil arsenic bioremediation. © 2011 The Authors. Journal of Applied Microbiology ©2011 The Society for Applied

Diversity of cuticular wax among Salix species and Populus species hybrids.

Science.gov (United States)

Cameron, Kimberly D; Teece, Mark A; Bevilacqua, Eddie; Smart, Lawrence B

2002-08-01

The leaf cuticular waxes of three Salix species and two Populus species hybrids, selected for their ability to produce high amounts of biomass, were characterized. Samples were extracted in CH(2)Cl(2) three times over the growing season. Low kV SEM was utilized to observe differences in the ultrastructure of leaf surfaces from each clone. Homologous series of wax components were classified into organic groups, and the variation in wax components due to clone, sample time, and their interaction was identified. All Salix species and Populus species hybrids showed differences in total wax load at each sampling period, whereas the pattern of wax deposition over time differed only between the Salix species. A strong positive relationship was identified between the entire homologous series of alcohols and total wax load in all clones. Similarly strong relationships were observed between fatty acids and total wax load as well as fatty acids and alcohols in two Salix species and one Populus species hybrid. One Salix species, S. dasyclados, also displayed a strong positive relationship between alcohols and alkanes. These data indicate that species grown under the same environmental conditions produce measurably different cuticular waxes and that regulation of wax production appears to be different in each species. The important roles cuticular waxes play in drought tolerance, pest, and pathogen resistance, as well as the ease of wax extraction and analysis, strongly suggest that the characteristics of the cuticular wax may prove to be useful selectable traits in a breeding program.

Water use sources of desert riparian Populus euphratica forests.

Science.gov (United States)

Si, Jianhua; Feng, Qi; Cao, Shengkui; Yu, Tengfei; Zhao, Chunyan

2014-09-01

Desert riparian forests are the main body of natural oases in the lower reaches of inland rivers; its growth and distribution are closely related to water use sources. However, how does the desert riparian forest obtains a stable water source and which water sources it uses to effectively avoid or overcome water stress to survive? This paper describes an analysis of the water sources, using the stable oxygen isotope technique and the linear mixed model of the isotopic values and of desert riparian Populus euphratica forests growing at sites with different groundwater depths and conditions. The results showed that the main water source of Populus euphratica changes from water in a single soil layer or groundwater to deep subsoil water and groundwater as the depth of groundwater increases. This appears to be an adaptive selection to arid and water-deficient conditions and is a primary reason for the long-term survival of P. euphratica in the desert riparian forest of an extremely arid region. Water contributions from the various soil layers and from groundwater differed and the desert riparian P. euphratica forests in different habitats had dissimilar water use strategies.

The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a.

Directory of Open Access Journals (Sweden)

Juan Jesús Molina-Rueda

Full Text Available BACKGROUND: Glutamine synthetase (GS plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4 expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. RESULTS: In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs. The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs, with concomitant up-regulation of plastidic iron SODs (FSDs in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. CONCLUSIONS: Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this

Uptake of macro- and micro-nutrients into leaf, woody, and root tissue of Populus after irrigation with landfill leachate

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Bart T. Sexton; Richard B. Hall

2008-01-01

Information about macro- and micro-nutrient uptake and distribution into tissues of Populus irrigated with landfill leachate helps to maximize biomass production and understand impacts of leachate chemistry on tree health. We irrigated eight Populus clones (NC 13460, NCI4O18, NC14104, NC14106, DM115, DN5, NM2, NM6) with fertilized (N, P, K) well...

On the irrigation requirements of cottonwood (Populus fremontii and Populus deltoides var. wislizenii) and willow (Salix gooddingii) grown in a desert environment

Science.gov (United States)

Hartwell, S.; Morino, K.; Nagler, P.L.; Glenn, E.P.

2010-01-01

Native tree plots have been established in river irrigation districts in the western U.S. to provide habitat for threatened and endangered birds. Information is needed on the effective irrigation requirements of the target species. Cottonwood (Populus spp.) and willow (Salix gooddingii) trees were grown for seven years in an outdoor plot in a desert environment in Tucson, Arizona. Plants were allowed to achieve a nearly complete canopy cover over the first four years, then were subjected to three daily summer irrigation schedules of 6.20??mm??d-1; 8.26??mm??d-1 and 15.7??mm??d-1. The lowest irrigation rate was sufficient to maintain growth and high leaf area index for cottonwoods over three years, while willows suffered considerable die-back on this rate in years six and seven. These irrigation rates were applied April 15-September 15, but only 0.88??mm??d-1 was applied during the dormant period of the year. Expressed as a fraction of reference crop evapotranspiration (ETo), recommended annual water applications plus precipitation (and including some deep drainage) were 0.83 ETo for cottonwood and 1.01 ETo for willow. Current practices tend to over-irrigate restoration plots, and this study can provide guidelines for more efficient water use. ?? 2010 Elsevier Ltd.

Identification and characterization of nuclear genes involved in photosynthesis in Populus

Science.gov (United States)

2014-01-01

Background The gap between the real and potential photosynthetic rate under field conditions suggests that photosynthesis could potentially be improved. Nuclear genes provide possible targets for improving photosynthetic efficiency. Hence, genome-wide identification and characterization of the nuclear genes affecting photosynthetic traits in woody plants would provide key insights on genetic regulation of photosynthesis and identify candidate processes for improvement of photosynthesis. Results Using microarray and bulked segregant analysis strategies, we identified differentially expressed nuclear genes for photosynthesis traits in a segregating population of poplar. We identified 515 differentially expressed genes in this population (FC ≥ 2 or FC ≤ 0.5, P photosynthesis by the nuclear genome mainly involves transport, metabolism and response to stimulus functions. Conclusions This study provides new genome-scale strategies for the discovery of potential candidate genes affecting photosynthesis in Populus, and for identification of the functions of genes involved in regulation of photosynthesis. This work also suggests that improving photosynthetic efficiency under field conditions will require the consideration of multiple factors, such as stress responses. PMID:24673936

[Fungi isolated from diseased medicinal plants].

Science.gov (United States)

Sato, T; Matsuhashi, M; Iida, O

1992-01-01

One hundred and forty-four fungal isolates were obtained from diseased Paeonia albiflora Pall. var. trichocarpa Bung., Astragalus membranaceus Bung., Lithospermum erythrorhizon Sieb. et Zucc., Ledebouriella seseloides Wolff and Bupleurum falcatum L. which were collected in the test field of Tsukuba Medicinal Plant Research Station, National Institute of Hygienic Sciences. Most of them were identified into 15 genera containing 8 species. Fungal species presumed to be pathogens of the host plants were as follows: Cladosporium paeoniae, Pestalotia paeoniicola, Glomerella cingulata, Hainesia lythri, Guignardia sp. and Alternaria sp. from P. albiflora, Fusarium spp., Rhizoctonia spp. and Neocosmospora vasinfecta from A. membranaceus, Colletotrichum gloeosporioides from L. erythrorhizon, Rhizoctonia sp., Fusarium spp., Phoma sp. and Pyrenochaeta sp. from L. seseloides, and Fusarium sp., Alternaria alternata, Phyllosticta sp., Phoma sp., Phomopsis sp. and C. gloeosporioides from B. falcatum. Roots of B. falcatum were found to be parasitized by Meloidogyne sp.

Transcriptional and Hormonal Regulation of Gravitropism of Woody Stems in Populus

Science.gov (United States)

Suzanne Gerttula; Matthew S. Zinkgraf; Gloria K. Muday; Daniel R. Lewis; Farid M. Ibatullin; Harry Brumer; Foster Hart; Shawn D. Mansfield; Vladimir Filkov; Andrew Groover

2015-01-01

Angiosperm trees reorient their woody stems by asymmetrically producing a specialized xylem tissue, tension wood, which exerts a strong contractile force resulting in negative gravitropism of the stem. Here, we show, in Populus trees, that initial gravity perception and response occurs in specialized cells through sedimentation of starch-filled...

A database of PCR primers for the chloroplast genomes of higher plants

Science.gov (United States)

Heinze, Berthold

2007-01-01

Background Chloroplast genomes evolve slowly and many primers for PCR amplification and analysis of chloroplast sequences can be used across a wide array of genera. In some cases 'universal' primers have been designed for the purpose of working across species boundaries. However, the essential information on these primer sequences is scattered throughout the literature. Results A database is presented here which assembles published primer information for chloroplast DNA. Additional primers were designed to fill gaps where little or no primer information could be found. Amplicons are either the genes themselves (typically useful in studies of sequence variation in higher-order phylogeny) or they are spacers, introns, and intergenic regions (for studies of phylogeographic patterns within and among species). The current list of 'generic' primers consists of more than 700 sequences. Wherever possible, we give the locations of the primers in the thirteen fully sequenced chloroplast genomes (Nicotiana tabacum, Atropa belladonna, Spinacia oleracea, Arabidopsis thaliana, Populus trichocarpa, Oryza sativa, Pinus thunbergii, Marchantia polymorpha, Zea mays, Oenothera elata, Acorus calamus, Eucalyptus globulus, Medicago trunculata). Conclusion The database described here is designed to serve as a resource for researchers who are venturing into the study of poorly described chloroplast genomes, whether for large- or small-scale DNA sequencing projects, to study molecular variation or to investigate chloroplast evolution. PMID:17326828

A database of PCR primers for the chloroplast genomes of higher plants

Directory of Open Access Journals (Sweden)

Heinze Berthold

2007-02-01

Full Text Available Abstract Background Chloroplast genomes evolve slowly and many primers for PCR amplification and analysis of chloroplast sequences can be used across a wide array of genera. In some cases 'universal' primers have been designed for the purpose of working across species boundaries. However, the essential information on these primer sequences is scattered throughout the literature. Results A database is presented here which assembles published primer information for chloroplast DNA. Additional primers were designed to fill gaps where little or no primer information could be found. Amplicons are either the genes themselves (typically useful in studies of sequence variation in higher-order phylogeny or they are spacers, introns, and intergenic regions (for studies of phylogeographic patterns within and among species. The current list of 'generic' primers consists of more than 700 sequences. Wherever possible, we give the locations of the primers in the thirteen fully sequenced chloroplast genomes (Nicotiana tabacum, Atropa belladonna, Spinacia oleracea, Arabidopsis thaliana, Populus trichocarpa, Oryza sativa, Pinus thunbergii, Marchantia polymorpha, Zea mays, Oenothera elata, Acorus calamus, Eucalyptus globulus, Medicago trunculata. Conclusion The database described here is designed to serve as a resource for researchers who are venturing into the study of poorly described chloroplast genomes, whether for large- or small-scale DNA sequencing projects, to study molecular variation or to investigate chloroplast evolution.

Overexpression of Poplar Pyrabactin Resistance-Like Abscisic Acid Receptors Promotes Abscisic Acid Sensitivity and Drought Resistance in Transgenic Arabidopsis.

Directory of Open Access Journals (Sweden)

Jingling Yu

Full Text Available Drought stress is an important environmental factor limiting productivity of plants, especially fast growing species with high water consumption like poplar. Abscisic acid (ABA is a phytohormone that positively regulates seed dormancy and drought resistance. The PYR1 (Pyrabactin Resistance 1/ PYRL (PYR-Like/ RCAR (Regulatory Component of ABA Receptor (PYR/PYL/RCAR ABA receptor family has been identified and widely characterized in Arabidopsis thaliana. However, their functions in poplars remain unknown. Here, we report that 2 of 14 PYR/PYL/RCAR orthologues in poplar (Populus trichocarpa (PtPYRLs function as a positive regulator of the ABA signal transduction pathway. The Arabidopsis transient expression and yeast two-hybrid assays showed the interaction among PtPYRL1 and PtPYRL5, a clade A protein phosphatase 2C, and a SnRK2, suggesting that a core signalling complex for ABA signaling pathway exists in poplars. Phenotypic analysis of PtPYRL1 and PtPYRL5 transgenic Arabidopsis showed that these two genes positively regulated the ABA responses during the seed germination. More importantly, the overexpression of PtPYRL1 and PtPYRL5 substantially improved ABA sensitivity and drought stress tolerance in transgenic plants. In summary, we comprehensively uncovered the properties of PtPYRL1 and PtPYRL5, which might be good target genes to genetically engineer drought-Resistant plants.

Determination of As in tree-rings of poplar (Populus alba L.) by U-shaped DC arc.

Science.gov (United States)

Marković, D M; Novović, I; Vilotić, D; Ignjatović, Lj

2009-04-01

An argon-stabilized U-shaped DC arc with a system for aerosol introduction was used for determination of As in poplar (Populus alba L.) tree-rings. After optimization of the operating parameters and selection of the most appropriate signal integration time (30 s), the limit of detection for As was reduced to 15.0 ng/mL. This detection limit obtained with the optimal integration time was compared with those for other methods: inductively coupled plasma-atomic emission spectrometry (ICP-AES), direct coupled plasma-atomic emission spectrometry (DCP-AES), microwave induced plasma-atomic emission spectrometry (MIP-AES) and improved thermospray flame furnace atomic absorption spectrometry (TS-FF-AAS). Arsenic is toxic trace element which can adversely affect plant, animal and human health. As an indicator of environment pollution we collected poplar tree-rings from two locations. The first area was close to the "Nikola Tesla" (TENT-A) power plant, Obrenovac, while the other was in the urban area of Novi Sad. In all cases elevated average concentrations of As were registered in poplar tree-rings from the Obrenovac location.

Efeito da aplicação de calcário em estacas de Populus deltoides Bartr. ex Marsh cultivadas em vaso

Directory of Open Access Journals (Sweden)

Jean Gabriel Medeiros da Silva

2002-01-01

Full Text Available This work intended to study the behavior of Populus deltoides regarding its development when submitted to different doses of lime. The research was carried out in the Silviculture Tecnology Center, at Universidade Federal de Santa Maria, Santa Maria - RS. The experiment was constituted by forty eight (48 experimental units completely randomized, with six (06 treatments and eight repetitions (08. Each experimental unit was constituted by a vase of three liters containing only one shoot cutting of Populus deltoides. The treatments were constituted by five different doses (T2: 7 tons of lime/ha; T3: 14 tons of lime/ha; T4: 21 tons of lime/ha; T5: 29 tons of lime/ha; T6: 38 tons of lime/ha plus the testimony, determined with base in the soil analysis used in the experiment. The plants were evaluated, after 120 days of the plantation date, considering its growth in height, its diameter of the neck and its weigh dry of the aerial part. The best average were reached by the treatments without lime and with seven tons of lime for ha in all the parameters observed. The other treatments presented inferior averages, which do not possess significant difference to each other at the level of 5%, for all the observed parameters.

Spatial Pattern of Populus euphratica Forest Change as Affected by Water Conveyance in the Lower Tarim River

Directory of Open Access Journals (Sweden)

Shuhong Peng

2014-01-01

Full Text Available To restore declining species, including Populus euphratica and other riparian communities, in the river ecosystem of the lower Tarim River, the ecological water conveyance project (EWCP, as a part of an integrated water resource management plan, was implemented in 2000. The EWCP aims to schedule and manage the water resources in the upper reaches and transfer water to the lower reaches by a series of intermittent water deliveries. The delivered water flows along a modified river channel and nourishes riparian communities by river overflow flooding. Since it began, it has caused a fierce debate over the response of riparian vegetation to the water conveyance scheme. This study focuses on the lower Tarim River, where Populus euphratica forests have undergone watering, due to the EWCP. Twelve Landsat sensor images and one IKONOS satellite imagery acquired between 1999 and 2009 were used to monitor the change in Populus euphratica forests. Bi-temporal change detection and temporal trajectory analysis were employed to represent the spatial pattern of the forest change. Field investigations were used to analyze the driving forces behind forest change from the perspectives of anthropogenic activities and natural forces. The results showed that Populus euphratica forest have been declining in area, which implies that ecological risks have been increased during the watering process. However, forests areas have increased in the regions where the water supply is abundant, and vice versa.

Biomass production of intensively grown poplars in the southernmost part of Sweden: Observations of characters, traits and growth potential

International Nuclear Information System (INIS)

Christersson, Lars

2006-01-01

Observation of possibilities and problems was performed when trying to optimise growing conditions for high biomass production by irrigation and fertilisation in a clone test of poplar on sandy soil in the south of Sweden. One hundred and eight clones of pure Populus trichocarpa and hybrids between P. trichocarpa and P. deltoides were evaluated for growth rate, phenology, quality, frost hardiness and pest resistance. Some fertilisation experiments were performed. In some years, some unfertilised clones produced up to 2 kg m -2 of woody dry biomass. Some fertilised clones produced almost twice as much in the years following fertilisation. Stem canker was the main cause of serious injuries in all hybrids, but pure P. trichocarpa stems were not affected. The cimbicid sawfly (Cimbex lutea) caused damage to the quality of the trees in the form of curved stems of some clones. Winter frost killed top shoots of the hybrids in a year with particularly low winter temperatures with long duration. Summer frost (in June) killed up to 1 m of some young top shoots in some clones in the first 3-4 years. The results are discussed in terms of radiation utilisation efficiency, energy efficient ratio, and water and nutrient use efficiency. The discussion finishes with the conclusion that fertilisation, but not irrigation, can be economically motivated. If irrigation is to be economic, then the main objective of the whole operation should be to produce drinkable water from water polluted by society. Biomass production would then be a bonus

Litter Quality of Populus Species as Affected by Free-Air CO2

NARCIS (Netherlands)

Vermue, E.; Buurman, P.; Hoosbeek, M.R.

2009-01-01

The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter

Light regimes in Populus plantations using the Voxel-based Light Interception Model

NARCIS (Netherlands)

Van der Zande, D.; Dieussart, K.; Stuckens, J.; Verstraeten, W.W.; Coppin, P.

2011-01-01

Three-dimensional light interception by three uniform Populus canopies was studied using the Voxel-based Light Interception Model (VLIM) in combination with ground-based Light Detection and Ranging (LiDAR) measurements. As the VLIM was developed and validated in a virtual environment to ensure

Molecular genetic analysis of black poplar (Populus nigra L.) along Dutch rivers

NARCIS (Netherlands)

Arens, P.; Coops, H.; Jansen, J.; Vosman, B.

1998-01-01

The genetic structure of remaining black poplar (Populus nigra) trees on the banks of the Dutch Rhine branches was investigated using the AFLP technique. In total, 143 trees, including one P. deltoides and some P. x euramericana, were analysed using six AFLP primer combinations which generated 319

Sulfate Metabolites of 4-Monochlorobiphenyl in Whole Poplar Plants

OpenAIRE

Zhai, Guangshu; Lehmler, Hans-Joachim; Schnoor, Jerald L.

2012-01-01

4-Monochlorobiphenyl (PCB3) has been proven to be transformed into hydroxylated metabolites of PCB3 (OH-PCB3s) in whole poplar plants in our previous work. However, hydroxylated metabolites of PCBs, including OH-PCB3s, as the substrates of sulfotransferases have not been studied in many organisms including plants in vivo. Poplar (Populus deltoides × nigra, DN34) was used to investigate the further metabolism from OH-PCB3s to PCB3 sulfates because it is a model plant and one that is frequently...

Dicty_cDB: Contig-U01541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

Sodium and chloride accumulation in leaf, woody, and root tissue of Populus after irrigation with landfill leachate

International Nuclear Information System (INIS)

Zalesny, Jill A.; Zalesny, Ronald S.; Wiese, Adam H.; Sexton, Bart; Hall, Richard B.

2008-01-01

The response of Populus to irrigation sources containing elevated levels of sodium (Na + ) and chloride (Cl - ) is poorly understood. We irrigated eight Populus clones with fertilized well water (control) (N, P, K) or municipal solid waste landfill leachate weekly during 2005 and 2006 in Rhinelander, Wisconsin, USA (45.6 deg. N, 89.4 deg. W). During August 2006, we tested for differences in total Na + and Cl - concentration in preplanting and harvest soils, and in leaf, woody (stems + branches), and root tissue. The leachate-irrigated soils at harvest had the greatest Na + and Cl - levels. Genotypes exhibited elevated total tree Cl - concentration and increased biomass (clones NC14104, NM2, NM6), elevated Cl - and decreased biomass (NC14018, NC14106, DM115), or mid levels of Cl - and biomass (NC13460, DN5). Leachate tissue concentrations were 17 (Na + ) and four (Cl - ) times greater than water. Sodium and Cl - levels were greatest in roots and leaves, respectively. - Sodium and chloride supplied via landfill leachate irrigation is accumulated at high concentrations in tissues of Populus

A role for stomata in regulating water use efficiency in Populus x ...

African Journals Online (AJOL)

A role for stomata in regulating water use efficiency in Populus x euramericana and characterization of a related gene, PdERECTA. P Guo, X Xia, WL Yin. Abstract. The physiological mechanism of water use efficiency (WUE) remains elucidated, especially in poplar. We studied WUEi (instantaneous leaf transpiration ...

Down-regulation of KORRIGAN-like endo-β-1,4-glucanase genes impacts carbon partitioning, mycorrhizal colonization and biomass production in Populus

Directory of Open Access Journals (Sweden)

Udaya C Kalluri

2016-10-01

Full Text Available A greater understanding of the genetic regulation of plant cell wall remodeling and the impact of modified cell walls on plant performance is important for the development of sustainable biofuel crops. Here, we studied the impact of down-regulating KORRIGAN-like cell wall biosynthesis genes, belonging to the endo-β-1,4-glucanase gene family, on Populus growth, metabolism and the ability to interact with symbiotic microbes. The reductions in cellulose content and lignin syringyl-to-guaiacyl unit ratio, and increase in cellulose crystallinity of cell walls of PdKOR RNAi plants corroborated the functional role of PdKOR in cell wall biosynthesis. Altered metabolism and reduced growth characteristics of RNAi plants revealed new implications on carbon allocation and partitioning. The distinctive metabolome phenotype comprised of a higher phenolic and salicylic acid content, and reduced lignin, shikimic acid and maleic acid content relative to control. Plant sustainability implications of modified cell walls on beneficial plant-microbe interactions were explored via co-culture with an ectomycorrhizal fungus, Laccaria bicolor. A significant increase in the mycorrhization rate was observed in transgenic plants, leading to measurable beneficial growth effects. These findings present new evidence for functional interconnectedness of cellulose biosynthesis pathway, metabolism and mycorrhizal association in plants, and further emphasize the consideration of the sustainability implications of plant trait improvement efforts.

Comparative physiology of allopatric Populus species: geographic clines in photosynthesis, height growth, and carbon isotope discrimination in common gardens.

Science.gov (United States)

Soolanayakanahally, Raju Y; Guy, Robert D; Street, Nathaniel R; Robinson, Kathryn M; Silim, Salim N; Albrectsen, Benedicte R; Jansson, Stefan

2015-01-01

Populus species with wide geographic ranges display strong adaptation to local environments. We studied the clinal patterns in phenology and ecophysiology in allopatric Populus species adapted to similar environments on different continents under common garden settings. As a result of climatic adaptation, both Populus tremula L. and Populus balsamifera L. display latitudinal clines in photosynthetic rates (A), whereby high-latitude trees of P. tremula had higher A compared to low-latitude trees and nearly so in P. balsamifera (p = 0.06). Stomatal conductance (g s) and chlorophyll content index (CCI) follow similar latitudinal trends. However, foliar nitrogen was positively correlated with latitude in P. balsamifera and negatively correlated in P. tremula. No significant trends in carbon isotope composition of the leaf tissue (δ(13)C) were observed for both species; but, intrinsic water-use efficiency (WUEi) was negatively correlated with the latitude of origin in P. balsamifera. In spite of intrinsically higher A, high-latitude trees in both common gardens accomplished less height gain as a result of early bud set. Thus, shoot biomass was determined by height elongation duration (HED), which was well approximated by the number of days available for free growth between bud flush and bud set. We highlight the shortcoming of unreplicated outdoor common gardens for tree improvement and the crucial role of photoperiod in limiting height growth, further complicating interpretation of other secondary effects.

Genetics-based interactions among plants, pathogens, and herbivores define arthropod community structure.

Science.gov (United States)

Busby, Posy E; Lamit, Louis J; Keith, Arthur R; Newcombe, George; Gehring, Catherine A; Whitham, Thomas G; Dirzo, Rodolfo

2015-07-01

Plant resistance to pathogens or insect herbivores is common, but its potential for indirectly influencing plant-associated communities is poorly known. Here, we test whether pathogens' indirect effects on arthropod communities and herbivory depend on plant resistance to pathogens and/or herbivores, and address the overarching interacting foundation species hypothesis that genetics-based interactions among a few highly interactive species can structure a much larger community. In a manipulative field experiment using replicated genotypes of two Populus species and their interspecific hybrids, we found that genetic variation in plant resistance to both pathogens and insect herbivores modulated the strength of pathogens' indirect effects on arthropod communities and insect herbivory. First, due in part to the pathogens' differential impacts on leaf biomass among the two Populus species and the hybrids, the pathogen most strongly impacted arthropod community composition, richness, and abundance on the pathogen-susceptible tree species. Second, we found similar patterns comparing pathogen-susceptible and pathogen-resistant genotypes within species. Third, within a plant species, pathogens caused a fivefold greater reduction in herbivory on insect-herbivore-susceptible plant genotypes than on herbivore-resistant genotypes, demonstrating that the pathogen-herbivore interaction is genotype dependent. We conclude that interactions among plants, pathogens, and herbivores can structure multitrophic communities, supporting the interacting foundation species hypothesis. Because these interactions are genetically based, evolutionary changes in genetic resistance could result in ecological changes in associated communities, which may in turn feed back to affect plant fitness.

Remediation of cyanide-contaminated industrial sites through woody biomass production

Science.gov (United States)

Dimitrova, Tsvetelina; Repmann, Frank; Freese, Dirk

2017-04-01

Due to the unfavourable chemical and physical soil quality parameters and the potential presence of contaminants, former industrial sites can hardly be utilized as arable land and can thus be classified as marginal areas. Still, as far as possible, they can effectively be used for the production of alternative energy, including the cultivation of fast growing trees. Apart from being a source of bioenergy, trees might facilitate the stabilization, remedation, contaminant extraction and degradation and, not on the last place, to enhance soil quality improvement on former industrial areas. This process is known as phytoremediation and has successfully been applied on industrial sites of various organic and inorganic contamination. The former manufactured gas plant site ( 2500 m2) "ehemalige Leuchtgasanstalt" Cottbus, contaminated, among others, with iron cyanides undergoes phytoremediation with simultaneous biomass production since 2011. The project "Biomass-Remediation" is fully financed by the German Railways JSC. A dense (23700 stems/ha), mixed cover of willow (Salix caprea), poplar (Populus maximowicii Henry x Populus trichocarpa Torr. et Gray (Hybrid 275)) and black locust (Robinia pseudoaccacia) trees has been planted on the site. Throughout the five years of remediation, a successful long-term stabilization of the site has been achieved as a result of the nearly outright established tree stock and the dense planting. Annual monitoring of the cyanide levels in the leaf tissue of the trees on the site and results from greenhouse experiments indicate the ability of all tree species to extract and transport the cyanide from the soil. Additonally, the greenhouse experiments suggest that the willows might be able, although not to a full extent, to detoxify the contaminant by splitting the CN moiety. The contaminated biomass material might easily be dealt with through regular harvests and subsequent incineration. Phytoremediation with simultaneous biomass production

Gamma radiation effect on Populus nigra assimilatory pigments

International Nuclear Information System (INIS)

Creanga, I. A.; Tudorie, Marcela; Mocanasu, C.; Creanga, Dorina

2002-01-01

The influence of low intensity gamma radiation on the photosynthesis in young poplar saplings was studied. Black poplar (Populus nigra) was chosen due to its ecological importance, as fast growing tree species with many hybrids, in the frame of a polluted environment. Assimilatory pigments in the leaves of irradiated saplings were assayed using standard spectrophotometric method in acetone extract. Series of five saplings formed the experimental samples. Chlorophyll a and chlorophyll b levels appeared as diminished in exposed samples in comparison to the controls. Linear regression was established in every case, the line slope showing the higher effect in chlorophyll b. Carotene pigments presented a slight increasing tendency in the exposed samples. Assimilatory pigment sum was shown to be affected by the same decreasing tendency. Student t-test was applied (two tailed, pair type) to reveal statistical significance of observed modifications. Though not very deep, the modifications induced by exposure to gamma radiation of low intensity (comparable to the local atmospheric variations, caused by both natural and artificial sources) represent putative inhibitory factors in young plant photosynthesis. The main mechanism of radiation action seems to be water radiolysis, triggering peroxide cascade, generally producing toxic products for the cell metabolism. Nevertheless, living cell ability to repair some damages caused by external stress could be revealed in the present case by the enhancing tendency of the carotenes which sustain photosynthesis as secondary pigments. (authors)

Twenty-one genome sequences from Pseudomonas species and 19 genome sequences from diverse bacteria isolated from the rhizosphere and endosphere of Populus deltoides.

Science.gov (United States)

Brown, Steven D; Utturkar, Sagar M; Klingeman, Dawn M; Johnson, Courtney M; Martin, Stanton L; Land, Miriam L; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A

2012-11-01

To aid in the investigation of the Populus deltoides microbiome, we generated draft genome sequences for 21 Pseudomonas strains and 19 other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium, and Variovorax were generated.

Cloning of the cryptochrome-encoding PeCRY1 gene from Populus euphratica and functional analysis in Arabidopsis.

Directory of Open Access Journals (Sweden)

Ke Mao

Full Text Available Cryptochromes are photolyase-like blue/UV-A light receptors that evolved from photolyases. In plants, cryptochromes regulate various aspects of plant growth and development. Despite of their involvement in the control of important plant traits, however, most studies on cryptochromes have focused on lower plants and herbaceous crops, and no data on cryptochrome function are available for forest trees. In this study, we isolated a cryptochrome gene, PeCRY1, from Euphrates poplar (Populus euphratica, and analyzed its structure and function in detail. The deduced PeCRY1 amino acid sequence contained a conserved N-terminal photolyase-homologous region (PHR domain as well as a C-terminal DQXVP-acidic-STAES (DAS domain. Secondary and tertiary structure analysis showed that PeCRY1 shares high similarity with AtCRY1 from Arabidopsis thaliana. PeCRY1 expression was upregulated at the mRNA level by light. Using heterologous expression in Arabidopsis, we showed that PeCRY1 overexpression rescued the cry1 mutant phenotype. In addition, PeCRY1 overexpression inhibited hypocotyl elongation, promoted root growth, and enhanced anthocyanin accumulation in wild-type background seedlings grown under blue light. Furthermore, we examined the interaction between PeCRY1 and AtCOP1 using a bimolecular fluorescence complementation (BiFc assay. Our data provide evidence for the involvement of PeCRY1 in the control of photomorphogenesis in poplar.

Using low energy x-ray radiography to evaluate root initiation and growth of Populus

Science.gov (United States)

Ronald S., Jr. Zalesny; A. L. Friend; B. Kodrzycki; D.W. McDonald; R. Michaels; A.H. Wiese; J.W. Powers

2007-01-01

Populus roots have been studied less than aboveground tissues. However, there is an overwhelming need to evaluate root initiation and growth in order to understand the genetics and physiology of rooting, along with genotype x environment interactions.

Twenty-One Genome Sequences from Pseudomonas Species and 19 Genome Sequences from Diverse Bacteria Isolated from the Rhizosphere and Endosphere of Populus deltoides

Energy Technology Data Exchange (ETDEWEB)

Brown, Steven D [ORNL; Utturkar, Sagar M [ORNL; Klingeman, Dawn Marie [ORNL; Johnson, Courtney M [ORNL; Martin, Stanton [ORNL; Land, Miriam L [ORNL; Lu, Tse-Yuan [ORNL; Schadt, Christopher Warren [ORNL; Doktycz, Mitchel John [ORNL; Pelletier, Dale A [ORNL

2012-01-01

To aid in the investigation of the Populus deltoides microbiome we generated draft genome sequences for twenty one Pseudomonas and twenty one other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Burkholderia, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium and Variovorax were generated.

Comparative Physiological and Proteomic Analysis Reveals the Leaf Response to Cadmium-Induced Stress in Poplar (Populus yunnanensis.

Directory of Open Access Journals (Sweden)

Yunqiang Yang

Full Text Available Excess amounts of heavy metals are important environmental pollutants with significant ecological and nutritional effects. Cdmium (Cd is of particular concern because of its widespread occurrence and high toxicity. We conducted physiological and proteomic analyses to improve our understanding of the responses of Populus yunnanensis to Cd stress. The plantlets experienced two apparent stages in their response to Cd stress. During the first stage, transiently induced defense-response molecules, photosynthesis- and energy-associated proteins, antioxidant enzymes and heat shock proteins (HSPs accumulated to enhance protein stability and establish a new cellular homeostasis. This activity explains why plant photosynthetic capability during this period barely changed. During the second stage, a decline of ribulose-1, 5-bisphosphate carboxylase (RuBisCO and HSP levels led to imbalance of the plant photosynthetic system. Additionally, the expression of Mitogen-activated protein kinase 3 (MPK3, Mitogen-activated protein kinase 6 (MPK6 and a homeobox-leucine zipper protein was higher in the second stage. Higher expression of caffeoyl-CoA O-methyltransferase (CCoAOMT may regulate plant cell wall synthesis for greater Cd storage. These genes may be candidates for further research and use in genetic manipulation of poplar tolerance to Cd stress.

Efficacy of plastic mesh tubes in reducing herbivory damage by the invasive nutria (Myocastor coypus) in an urban restoration site

Science.gov (United States)

Sheffels, Trevor R.; Systma, Mark D.; Carter, Jacoby; Taylor, Jimmy D.

2014-01-01

The restoration of stream corridors is becoming an increasingly important component of urban landscape planning, and the high cost of these projects necessitates the need to understand and address potential ecological obstacles to project success. The nutria(Myocastor coypus) is an invasive, semi-aquatic rodent native to South America that causes detrimental ecological impacts in riparian and wetland habitats throughout its introduced range, and techniques are needed to reduce nutria herbivory damage to urban stream restoration projects. We assessed the efficacy of standard Vexar® plastic mesh tubes in reducing nutria herbivory damage to newly established woody plants. The study was conducted in winter-spring 2009 at Delta Ponds, a 60-ha urban waterway in Eugene, Oregon. Woody plants protected by Vexar® tubes demonstrated 100% survival over the 3-month initial establishment period, while only 17% of unprotected plantings survived. Nutria demonstrated a preference for black cottonwood (Populus balsamifera ssp trichocarpa) over red osier dogwood (Cornussericea) and willow (Salix spp). Camera surveillance showed that nutria were more active in unprotected rather than protected treatments. Our results suggest that Vexar® plastic mesh tubing can be an effective short-term herbivory mitigation tool when habitat use by nutria is low. Additionally, planting functionally equivalent woody plant species that are less preferred by nutria, and other herbivores, may be another method for reducing herbivory and improving revegetation success. This study highlights the need to address potential wildlife damage conflicts in the planning process for stream restoration in urban landscapes.

The genetic architecture of shoot-root covariation during seedling emergence of a desert tree, Populus euphratica.

Science.gov (United States)

Zhang, Miaomiao; Bo, Wenhao; Xu, Fang; Li, Huan; Ye, Meixia; Jiang, Libo; Shi, Chaozhong; Fu, Yaru; Zhao, Guomiao; Huang, Yuejiao; Gosik, Kirk; Liang, Dan; Wu, Rongling

2017-06-01

The coordination of shoots and roots is critical for plants to adapt to changing environments by fine-tuning energy production in leaves and the availability of water and nutrients from roots. To understand the genetic architecture of how these two organs covary during developmental ontogeny, we conducted a mapping experiment using Euphrates poplar (Populus euphratica), a so-called hero tree able to grow in the desert. We geminated intraspecific F 1 seeds of Euphrates Poplar individually in a tube to obtain a total of 370 seedlings, whose shoot and taproot lengths were measured repeatedly during the early stage of growth. By fitting a growth equation, we estimated asymptotic growth, relative growth rate, the timing of inflection point and duration of linear growth for both shoot and taproot growth. Treating these heterochronic parameters as phenotypes, a univariate mapping model detected 19 heterochronic quantitative trait loci (hQTLs), of which 15 mediate the forms of shoot growth and four mediate taproot growth. A bivariate mapping model identified 11 pleiotropic hQTLs that determine the covariation of shoot and taproot growth. Most QTLs detected reside within the region of candidate genes with various functions, thus confirming their roles in the biochemical processes underlying plant growth. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

Lead tolerance of Populus nigra in symbiosis with arbuscular mycorrhizal fungi in relation to physiological parameters

International Nuclear Information System (INIS)

Salehi, A.; Tabari, M.; Mohammadi Goltapeh, E.; Shirvani, A.

2016-01-01

With the aim to examine lead tolerance of Populus nigra (clone 62/154) in symbiosis witharbuscular mycorrhizal fungi, a greenhouse experiment was carried out in a factorial randomized complete scheme with two factors 1) fungal inoculation in 4 levels (control, inoculation with Glomus mosseae, inoculation with G. intraradices and inoculation with G. mosseae+G. intraradices) and 2) lead in 4 levels (0, 100, 500 and 1000 mg kg-1 soil). Mycorrhizal colonization and physiological parameters of plants were measured at the end of growth season. Results showed that at all Pb levels, the percentage of root mycorrhizal colonization in fungal treatments was significantly higher than that in control treatment (without fungal inoculation), however without significant differences between 3 fungal treatments. Pb treatments had no significant effect on root mycorrhizal colonization of P. nigra plants. Also, photosynthesis, stomatal conductance, transpiration, intercellular CO2 concentration and water use efficiency of P. nigra plants had no significant inhibitory effects versus the control found under Pb and fungal treatments or their interaction.The results of present study demonstrated that fungal treatments had no significant effects on physiological parameters and Pb tolerance of P. nigraplants. While, in relation to mycorrhizal colonization and physiological parameters, P. nigra clone 62/154 showeda good tolerance to Pb stress. So, in further investigations of phytoremediation of lead-contaminated soils, this clone can be considered as a proposed species.

TLC determination of some flavanones in the buds of different genus Populus species and hybrids

Directory of Open Access Journals (Sweden)

Pobłocka-Olech Loretta

2018-06-01

Full Text Available Flavonoids in the buds of eight Populus species and hybrids were detected and compared with the aid of an optimized TLC method. Separation of 17 flavonoid aglycones belonging to different groups, namely, flavones, flavonols, flavanones and flavanonols, previously described as constituents of poplar buds, was performed on silica gel plates using a hexane/ethyl acetate/formic acid (60:40:1.3, V/V/V mixture as the mobile phase. Pinocembrin and pinostrobin were found in the majority of analyzed poplar buds. For quantitative analysis of both compounds, two TLC evaluation modes, densitometric and videodensitometric, were compared and the established methods were validated. Concentrations of flavanones in some extracts differed slightly or significantly due to the analyzed plant matrix complexity and the TLC evaluation mode applied. Poplar buds rich in flavanones originated from P. × canadensis ‘Robusta’ (1.82 and 2.23 g per 100 g, resp. and P. balsamifera (1.17 and 2.24 g per 100 g, resp..

Organization and post-transcriptional processing of the psb B operon from chloroplasts of Populus deltoides.

Science.gov (United States)

Dixit, R; Trivedi, P K; Nath, P; Sane, P V

1999-09-01

Chloroplast genes are typically organized into polycistronic transcription units that give rise to complex sets of mono- and oligo-cistronic overlapping RNAs through a series of processing steps. The psbB operon contains genes for the PSII (psbB, psbT, psbH) and cytochrome b(6)f (petB and petD) complexes which are needed in different amounts during chloroplast biogenesis. The functional significance of gene organization in this polycistronic unit, containing information for two different complexes, is not known and is of interest. To determine the organization and expression of these complexes, studies have been carried out on crop plants by different groups, but not much information is known about trees. We present the nucleotide sequences of PSII genes and RNA profiles of the genes located in the psbB operon from Populus deltoides, a tree species. Although the gene organization of this operon in P. deltoides is similar to that in other species, a few variations have been observed in the processing scheme.

Root bacterial endophytes alter plant phenotype, but not physiology

DEFF Research Database (Denmark)

Henning, Jeremiah A.; Weston, David J.; Pelletier, Dale A.

2016-01-01

(root:shoot, biomass production, root and leaf growth rates) and physiological traits (chlorophyll content, net photosynthesis, net photosynthesis at saturating light-Asat, and saturating CO2-Amax). Overall, we found that bacterial root endophyte infection increased root growth rate up to 184% and leaf...... growth rate up to 137% relative to non-inoculated control plants, evidence that plants respond to bacteria by modifying morphology. However, endophyte inoculation had no influence on total plant biomass and photosynthetic traits (net photosynthesis, chlorophyll content). In sum, bacterial inoculation did......Plant traits, such as root and leaf area, influence how plants interact with their environment and the diverse microbiota living within plants can influence plant morphology and physiology. Here, we explored how three bacterial strains isolated from the Populus root microbiome, influenced plant...

Effects of progressive soil water deficit on growth, and physiological and biochemical responses of populus euphratica in arid area: a case study in China

International Nuclear Information System (INIS)

Yang, Y.; Chen, Y.; Li, W.; Zhu, C.

2015-01-01

The aim of this study was to investigate the responses of Populus euphratica seedlings under a short-term soil water deficit. To mimic natural conditions in which drought stress develops gradually, stress was imposed by subjecting plants to a gradual decrease of soil water content for a period of 21 d. We studied growth, physiological and biochemical responses to progressive soil water deficit of potted Populus euphratica seedlings at outdoors. Results showed that, in 6 d of water withholding, the soil moisture content decreased to a slight drought stress level, and it reached a severe drought stress level after 15 d of water withholding in July. In the process of soil water declining from saturated to severe drought levels, the increasing soil water deficit resulted in decreases in the height, stem base diameter, number of lateral branches. Leaf predawn water potential decreased after 15 d of withholding irrigation. After 21 d of withholding irrigation, actual photochemical efficiency of photosystem II (PSII) in light-adapted leaves and photochemical quenching coefficient decreased, respectively; the peroxidase activity, the content of chlorophyll a and chlorophyll b decreased. There were no significant changes in proline, malondialdehyde content, chlorophyll a/b value and superoxide dismutase activity. (author)

Shoot position affects root initiation and growth of dormant unrooted cuttings of Populus

Science.gov (United States)

R.S., Jr. Zalesny; R.B. Hall; E.O. Bauer; D.E. Riemenschneider

2003-01-01

Rooting of dormant unrooted cuttings is crucial to the commercial deployment of intensively cultured poplar (Populus spp.) plantations because it is the first biological prerequisite to stand establishment. Rooting can be genetically controlled and subject to selection. Thus, our objective was to test for differences in rooting ability among cuttings...

Clonal variation in lateral and basal rooting of Populus irrigated with landfill leachate

Science.gov (United States)

R.S. Zalesny Jr.; J.A. Zalesny

2011-01-01

Successful establishment and productivity of Populus depends upon adventitious rooting from: 1) lateral roots that develop from either preformed or induced primordia and 2) basal roots that differentiate from callus at the base of the cutting in response to wounding. Information is needed for phytotechnologies about the degree to which ...

Ozone sensitivity of plants in natural communities

Energy Technology Data Exchange (ETDEWEB)

Treshow, M; Stewart, D

1973-07-01

Field fumigation studies conducted in grassland, oak, aspen, and conifer, communities established the injury threshold of prevalent plant species to ozone. Several important species, including Bromus tectorum, Quercus gambelii, and Populus tremuloides, were injured by a single 2-hours exposure to 15 pphM ozone. Over half the perennial forbs and woody species studied were visibly injured at concentrations of 30 pphM ozone or less. It is postulated that lower concentrations at prolonged or repeated exposures to ozone may impair growth and affect community vigor and stability. Continued exposure of natural plant communities to ozone is expected to initiate major shifts in the plant composition of communities. 10 references, 4 figures, 1 table.

RNA sequencing of Populus x canadensis roots identifies key molecular mechanisms underlying physiological adaption to excess zinc.

Directory of Open Access Journals (Sweden)

Andrea Ariani

Full Text Available Populus x canadensis clone I-214 exhibits a general indicator phenotype in response to excess Zn, and a higher metal uptake in roots than in shoots with a reduced translocation to aerial parts under hydroponic conditions. This physiological adaptation seems mainly regulated by roots, although the molecular mechanisms that underlie these processes are still poorly understood. Here, differential expression analysis using RNA-sequencing technology was used to identify the molecular mechanisms involved in the response to excess Zn in root. In order to maximize specificity of detection of differentially expressed (DE genes, we consider the intersection of genes identified by three distinct statistical approaches (61 up- and 19 down-regulated and validate them by RT-qPCR, yielding an agreement of 93% between the two experimental techniques. Gene Ontology (GO terms related to oxidation-reduction processes, transport and cellular iron ion homeostasis were enriched among DE genes, highlighting the importance of metal homeostasis in adaptation to excess Zn by P. x canadensis clone I-214. We identified the up-regulation of two Populus metal transporters (ZIP2 and NRAMP1 probably involved in metal uptake, and the down-regulation of a NAS4 gene involved in metal translocation. We identified also four Fe-homeostasis transcription factors (two bHLH38 genes, FIT and BTS that were differentially expressed, probably for reducing Zn-induced Fe-deficiency. In particular, we suggest that the down-regulation of FIT transcription factor could be a mechanism to cope with Zn-induced Fe-deficiency in Populus. These results provide insight into the molecular mechanisms involved in adaption to excess Zn in Populus spp., but could also constitute a starting point for the identification and characterization of molecular markers or biotechnological targets for possible improvement of phytoremediation performances of poplar trees.

Remetabolism of transpired ethanol by Populus deltoides

International Nuclear Information System (INIS)

MacDonald, R.C.; Kimmerer, T.W.

1990-01-01

Ethanol is present in the transpiration stream of flooded and unflooded trees in concentrations up to 0.5mM. Transpired ethanol does not evaporate but is remetabolized by foliage and upper stems in Populus deltoides. 14 C-ethanol was supplied in the transpiration stream to excised leaves and shoots; more than 98% was incorporated. Less than 1% was respired as CO 2 . Organic and amino acids were labelled initially, with eventual accumulations in water- and chloroform-soluble fractions and into protein. Much of the label was incorporated into stem tissue, with little reaching the lamina. These experiments suggest that ethanol is not lost transpirationally through the leaves, but is efficiently recycled in a manner resembling lactate recycling in mammals

Leaf chemical composition of twenty-one Populus hybrid clones grown under intensive culture

Science.gov (United States)

Richard E. Dickson; Philip R. Larson

1976-01-01

Leaf material from 21 nursery-grown Populus hybrid clones was analyzed for three nitrogen fractions (total N, soluble protein, and soluble amino acids) and three carbhydrate fractions (reducing sugars, total soluble sugars, and total nonstructural carbohydrates-TNC). In addition, nursery-grown green ash and silver maple, field-grown bigtooth and trembling aspen, and...

Ethylene and jasmonic acid act as negative modulators during mutualistic symbiosis between Laccaria bicolor and Populus roots.

Science.gov (United States)

Plett, Jonathan M; Khachane, Amit; Ouassou, Malika; Sundberg, Björn; Kohler, Annegret; Martin, Francis

2014-04-01

The plant hormones ethylene, jasmonic acid and salicylic acid have interconnecting roles during the response of plant tissues to mutualistic and pathogenic symbionts. We used morphological studies of transgenic- or hormone-treated Populus roots as well as whole-genome oligoarrays to examine how these hormones affect root colonization by the mutualistic ectomycorrhizal fungus Laccaria bicolor S238N. We found that genes regulated by ethylene, jasmonic acid and salicylic acid were regulated in the late stages of the interaction between L. bicolor and poplar. Both ethylene and jasmonic acid treatments were found to impede fungal colonization of roots, and this effect was correlated to an increase in the expression of certain transcription factors (e.g. ETHYLENE RESPONSE FACTOR1) and a decrease in the expression of genes associated with microbial perception and cell wall modification. Further, we found that ethylene and jasmonic acid showed extensive transcriptional cross-talk, cross-talk that was opposed by salicylic acid signaling. We conclude that ethylene and jasmonic acid pathways are induced late in the colonization of root tissues in order to limit fungal growth within roots. This induction is probably an adaptive response by the plant such that its growth and vigor are not compromised by the fungus. © 2013 The Authors New Phytologist © 2013 New Phytologist Trust.

[Hydraulic limitation on photosynthetic rate of old Populus simonii trees in sandy soil of north Shaanxi Province].

Science.gov (United States)

Zuo, Li-Xiang; Li, Yang-Yang; Chen, Jia-Cun

2014-06-01

'Old and dwarf trees' on the loess plateau region mainly occurred among mature trees rather than among small trees. To elucidate the mechanism of tree age on 'old and dwarf trees' formation, taking Populus simonii, a tree species that accounted for the largest portion of 'old and dwarf trees' on the loess plateau, as an example, the growth, photosynthesis and hydraulic traits of P. simonii trees with different ages (young: 13-15 years, mid-aged: 31-34 years, and old: 49-54 years) were measured. The results showed that the dieback length increased, and net photosynthetic rate, stomatal conductance, transpiration rate, and whole plant hydraulic conductance decreased significantly with the increasing tree age. Both net photosynthetic rate and stomatal conductance measured at different dates were significantly and positively related to the whole plant hydraulic conductance, suggesting that the decreasing photosynthetic rate of old trees was possibly caused by the declined hydraulic conductance. Although the resistance to cavitation in stems and leaves was stronger in old trees than in young and mid-aged trees, there were no differences in midday native stem embolization degree and leaf hydraulic conductance based on the vulnerability curve estimation, suggesting that the increased hydraulic resistance of the soil-root system is probably the most important reason for decreasing the whole plant hydraulic conductance of old trees.

Influence of Populus Genotype on Gene Expression by the Wood Decay Fungus Phanerochaete chrysosporium

Science.gov (United States)

Jill Gaskell; Amber Marty; Michael Mozuch; Philip J. Kersten; Sandra Splinter Bondurant; Grzegorz Sabat; Ali Azarpira; John Ralph; Oleksandr Skyba; Shawn D. Mansfield; Robert A. Blanchette; Dan Cullen

2014-01-01

We examined gene expression patterns in the lignin-degrading fungus Phanerochaete chrysosporium when it colonizes hybrid poplar (Populus alba tremula) and syringyl (S)-rich transgenic derivatives. Acombination ofmicroarrays and liquid chromatography- tandem mass spectrometry (LC-MS/MS) allowed detection of a total of 9,959 transcripts and 793...

Fifteen-Year Growth of Six Planted Hardwood Species on Sharkey Clay Soil

Science.gov (United States)

Roger M. Krinard; Harvey E. Kennedy

1987-01-01

Six hardwood species planted on Sharkey clay soil that had been disked the first 5 years for weed control were significantly taller at age 5 when compared to species grown on mowed sites. By age 15, there were no differences in heights within species except for sweet pecan. Average heights by species at age 15 were: cottonwood (Populus deltoides...

Comparative physiological and proteomic analyses of poplar (Populus yunnanensis plantlets exposed to high temperature and drought.

Directory of Open Access Journals (Sweden)

Xiong Li

Full Text Available Plantlets of Populus yunnanensis Dode were examined in a greenhouse for 48 h to analyze their physiological and proteomic responses to sustained heat, drought, and combined heat and drought. Compared with the application of a single stress, simultaneous treatment with both stresses damaged the plantlets more heavily. The plantlets experienced two apparent response stages under sustained heat and drought. During the first stage, malondialdehyde and reactive oxygen species (ROS contents were induced by heat, but many protective substances, including antioxidant enzymes, proline, abscisic acid (ABA, dehydrin, and small heat shock proteins (sHSPs, were also stimulated. The plants thus actively defended themselves against stress and exhibited few pathological morphological features, most likely because a new cellular homeostasis was established through the collaborative operation of physiological and proteomic responses. During the second stage, ROS homeostasis was overwhelmed by substantial ROS production and a sharp decline in antioxidant enzyme activities, while the synthesis of some protective elements, such as proline and ABA, was suppressed. As a result, photosynthetic levels in P. yunnanensis decreased sharply and buds began to die, despite continued accumulation of sHSPs and dehydrin. This study supplies important information about the effects of extreme abiotic environments on woody plants.

Soil temperature and precipitation affect the rooting ability of dormant hardwood cuttings of Populus

Science.gov (United States)

R.S., Jr. Zalesny; R.B. Hall; E.O. Bauer; D.E. Riemenschneider

2005-01-01

In addition to genetic control, responses to environmental stimuli affect the success of rooting. Our objectives were to: 1) assess the variation in rooting ability among 21 Populus clones grown under varying soil temperatures and amounts of precipitation and 2) identify combinations of soil temperature and precipitation that promote rooting. The...

Bacterial Endophyte Colonization and Distribution within Plants

Directory of Open Access Journals (Sweden)

Shyam L. Kandel

2017-11-01

Full Text Available The plant endosphere contains a diverse group of microbial communities. There is general consensus that these microbial communities make significant contributions to plant health. Both recently adopted genomic approaches and classical microbiology techniques continue to develop the science of plant-microbe interactions. Endophytes are microbial symbionts residing within the plant for the majority of their life cycle without any detrimental impact to the host plant. The use of these natural symbionts offers an opportunity to maximize crop productivity while reducing the environmental impacts of agriculture. Endophytes promote plant growth through nitrogen fixation, phytohormone production, nutrient acquisition, and by conferring tolerance to abiotic and biotic stresses. Colonization by endophytes is crucial for providing these benefits to the host plant. Endophytic colonization refers to the entry, growth and multiplication of endophyte populations within the host plant. Lately, plant microbiome research has gained considerable attention but the mechanism allowing plants to recruit endophytes is largely unknown. This review summarizes currently available knowledge about endophytic colonization by bacteria in various plant species, and specifically discusses the colonization of maize plants by Populus endophytes.

Widespread triploidy in Western North American aspen (Populus tremuloides.

Directory of Open Access Journals (Sweden)

Karen E Mock

Full Text Available We document high rates of triploidy in aspen (Populus tremuloides across the western USA (up to 69% of genets, and ask whether the incidence of triploidy across the species range corresponds with latitude, glacial history (as has been documented in other species, climate, or regional variance in clone size. Using a combination of microsatellite genotyping, flow cytometry, and cytology, we demonstrate that triploidy is highest in unglaciated, drought-prone regions of North America, where the largest clone sizes have been reported for this species. While we cannot completely rule out a low incidence of undetected aneuploidy, tetraploidy or duplicated loci, our evidence suggests that these phenomena are unlikely to be significant contributors to our observed patterns. We suggest that the distribution of triploid aspen is due to a positive synergy between triploidy and ecological factors driving clonality. Although triploids are expected to have low fertility, they are hypothesized to be an evolutionary link to sexual tetraploidy. Thus, interactions between clonality and polyploidy may be a broadly important component of geographic speciation patterns in perennial plants. Further, cytotypes are expected to show physiological and structural differences which may influence susceptibility to ecological factors such as drought, and we suggest that cytotype may be a significant and previously overlooked factor in recent patterns of high aspen mortality in the southwestern portion of the species range. Finally, triploidy should be carefully considered as a source of variance in genomic and ecological studies of aspen, particularly in western U.S. landscapes.

Arbuscular mycorrhizal fungi associated with Populus-Salix stands in a semiarid riparian ecosystem

Science.gov (United States)

Beauchamp, Vanessa B.; Stromberg, J.C.; Stutz, J.C.

2006-01-01

??? This study examined the activity, species richness, and species composition of the arbuscular mycorrhizal fungal (AMF) community of Populus-Salix stands on the Verde River (Arizona, USA), quantified patterns of AMF richness and colonization along complex floodplain gradients, and identified environmental variables responsible for structuring the AMF community. ??? Samples from 61 Populus-Salix stands were analyzed for AMF and herbaceous composition, AMF colonization, gravimetric soil moisture, soil texture, per cent organic matter, pH, and concentrations of nitrate, bicarbonate phosphorus and exchangeable potassium. ??? AMF species richness declined with stand age and distance from and elevation above the channel and was positively related to perennial species cover and richness and gravimetric soil moisture. Distance from and elevation above the active channel, forest age, annual species cover, perennial species richness, and exchangeable potassium concentration all played a role in structuring the AMF community in this riparian area. ??? Most AMF species were found across a wide range of soil conditions, but a subset of species tended to occur more often in hydric areas. This group of riparian affiliate AMF species includes several not previously encountered in the surrounding Sonoran desert. ?? New Phytologist (2006).

Chloride and sodium uptake potential over an entire rotation of Populus irrigated with landfill leachate

Science.gov (United States)

Jill A. Zalesny; Ronald S., Jr. Zalesny

2009-01-01

There is a need for information about the response of Populus genotypes to repeated application of high-salinity water and nutrient sources throughout an entire rotation. We have combined establishment biomass and uptake data with mid- and full-rotation growth data to project potential chloride (Cl−) and sodium (Na...

[Exploration of a quantitative methodology to characterize the retention of PM2.5 and other atmospheric particulate matter by plant leaves: taking Populus tomentosa as an example].

Science.gov (United States)

Zhang, Zhi-Dan; Xi, Ben-Ye; Cao, Zhi-Guo; Jia, Li-Ming

2014-08-01

Taking Populus tomentosa as an example, a methodology called elution-weighing-particle size-analysis (EWPA) was proposed to evaluate quantitatively the ability of retaining fine particulate matter (PM2.5, diameter d ≤ 2.5 μm) and atmospheric particulate matter by plant leaves using laser particle size analyzer and balance. This method achieved a direct, accurate measurement with superior operability about the quality and particle size distribution of atmospheric particulate matter retained by plant leaves. First, a pre-experiment was taken to test the stability of the method. After cleaning, centrifugation and drying, the particulate matter was collected and weighed, and then its particle size distribution was analyzed by laser particle size analyzer. Finally, the mass of particulate matter retained by unit area of leaf and stand was translated from the leaf area and leaf area index. This method was applied to a P. tomentosa stand which had not experienced rain for 27 days in Beijing Olympic Forest Park. The results showed that the average particle size of the atmospheric particulate matter retained by P. tomentosa was 17.8 μm, and the volume percentages of the retained PM2.5, inhalable particulate matter (PM10, d ≤ 10 μm) and total suspended particle (TSP, d ≤ 100 μm) were 13.7%, 47.2%, and 99.9%, respectively. The masses of PM2.5, PM10, TSP and total particulate matter were 8.88 x 10(-6), 30.6 x 10(-6), 64.7 x 10(-6) and 64.8 x 10(-6) g x cm(-2) respectively. The retention quantities of PM2.5, PM10, TSP and total particulate matter by the P. tomentosa stand were 0.963, 3.32, 7.01 and 7.02 kg x hm(-2), respectively.

Physiological, vascular and nanomechanical assessment of hybrid poplar leaf traits in micropropagated plants and plants propagated from root cuttings: A contribution to breeding programs.

Science.gov (United States)

Ďurkovič, Jaroslav; Husárová, Hana; Javoříková, Lucia; Čaňová, Ingrid; Šuleková, Miriama; Kardošová, Monika; Lukáčik, Ivan; Mamoňová, Miroslava; Lagaňa, Rastislav

2017-09-01

Micropropagated plants experience significant stress from rapid water loss when they are transferred from an in vitro culture to either greenhouse or field conditions. This is caused both by inefficient stomatal control of transpiration and the change to a higher light intensity and lower humidity. Understanding the physiological, vascular and biomechanical processes that allow micropropagated plants to modify their phenotype in response to environmental conditions can help to improve both field performance and plant survival. To identify changes between the hybrid poplar [Populus tremula × (Populus × canescens)] plants propagated from in vitro tissue culture and those from root cuttings, we assessed leaf performance for any differences in leaf growth, photosynthetic and vascular traits, and also nanomechanical properties of the tracheary element cell walls. The micropropagated plants showed significantly higher values for leaf area, leaf length, leaf width and leaf dry mass. The greater leaf area and leaf size dimensions resulted from the higher transpiration rate recorded for this stock type. Also, the micropropagated plants reached higher values for chlorophyll a fluorescence parameters and for the nanomechanical dissipation energy of tracheary element cell walls which may indicate a higher damping capacity within the primary xylem tissue under abiotic stress conditions. The performance of the plants propagated from root cuttings was superior for instantaneous water-use efficiency which signifies a higher acclimation capacity to stressful conditions during a severe drought particularly for this stock type. Similarities were found among the majority of the examined leaf traits for both vegetative plant origins including leaf mass per area, stomatal conductance, net photosynthetic rate, hydraulic axial conductivity, indicators of leaf midrib vascular architecture, as well as for the majority of cell wall nanomechanical traits. This research revealed that

Community development on 35-year-old planted minespoil banks in Pennsylvania

Energy Technology Data Exchange (ETDEWEB)

Schuster, W S; Hutnik, R J

1987-07-01

Invading plant communities were studied in 1982 on a series of 35-year old strip-mine test plantings in the main bituminous region of Pennsylvania. Ten of the original 22 sites were evaluated; the others had been significantly disturbed or destroyed. The sites varied in mean pH, in survival and basal area of the planted trees and in the species planted. The study involved 24 plots of the following species: eastern white pine (Pine strobus), red pine (Pinus resinosa), Japanese larch (Laprix leptolepis), red oak (Quercus rubra), black locust (Robinia pseudoacacia), white ash (Fraxinus americana), green ash (Fraxinus pennsylvanica) and hybrid poplar (Populus hyb.) and seven plots where plantings were unsuccessful (control plots). In the cluster analysis of invading communities described by a modified Braun-Blanquet scale, strong clustering trends were evident by both site and planted species. Clustering by sites was most pronounced for those sites with extremes of soil pH. There was also strong clustering among pine plots and among some hardwood plots. Species richness was higher on white ash, red oak, Japanese larch and control plots than on white pine plots. Black cherry (Prunus serotina) was the most common of the 169 invading species and was especially numerous on black locust plots. Aspens (Populus sp.) were also common invaders, especially on pine and ash plots. These species, along with pin cherry (Prunus Pennsylvanica) and the planted black locust are declining in importance, whereas black cherry, red maple (Acer rubrum) and slippery elm (Ulmus rubra) are increasing. Invading oaks (Quercus sp.), hickories (Carya sp.) and a few sugar maple (Acer saccharum) and American beech (Fagus grandifolia) suggest future successional changes. 26 refs., 2 figs., 4 tabs.

Lead uptake increases drought tolerance of wild type and transgenic poplar (Populus tremula x P. alba) overexpressing gsh 1.

Science.gov (United States)

Samuilov, Sladjana; Lang, Friedericke; Djukic, Matilda; Djunisijevic-Bojovic, Danijela; Rennenberg, Heinz

2016-09-01

Growth and development of plants largely depends on their adaptation ability in a changing climate. This is particularly true on heavy metal contaminated soils, but the interaction of heavy metal stress and climate on plant performance has not been intensively investigated. The aim of the present study was to elucidate if transgenic poplars (Populus tremula x P. alba) with enhanced glutathione content possess an enhanced tolerance to drought and lead (Pb) exposure (single and in combination) and if they are good candidates for phytoremediation of Pb contaminated soil. Lead exposure reduced growth and biomass accumulation only in above-ground tissue of wild type poplar, although most of lead accumulated in the roots. Drought caused a decline of the water content rather than reduced biomass production, while Pb counteracted this decline in the combined exposure. Apparently, metals such as Pb possess a protective function against drought, because they interact with abscisic acid dependent stomatal closure. Lead exposure decreased while drought increased glutathione content in leaves of both plant types. Lead accumulation was higher in the roots of transgenic plants, presumably as a result of chelation by glutathione. Water deprivation enhanced Pb accumulation in the roots, but Pb was subject to leakage out of the roots after re-watering. Transgenic plants showed better adaptation under mild drought plus Pb exposure partially due to improved glutathione synthesis. However, the transgenic plants cannot be considered as a good candidate for phytoremediation of Pb, due to its small translocation to the shoots and its leakage out of the roots upon re-watering. Copyright © 2016 Elsevier Ltd. All rights reserved.

Field performance of Populus in short-rotation intensive culture plantations in the north-central U.S.

Science.gov (United States)

Edward A. Hansen; Michael E. Ostry; Wendell D. Johnson; David N. Tolsted; Daniel A. Netzer; William E. Berguson; Richard B. Hall

1994-01-01

Describes a network of short-rotation, Populus research and demonstration plantations that has been established across a 5-state region in the north-central U.S. to identify suitable hybrid poplar clones for large-scale biomass plantations in the region. Reports 6-year results.

Comparative study of volatile components from male and female flower buds of Populus × tomentosa by HS-SPME-GC-MS.

Science.gov (United States)

Xu, Liang; Liu, Haiping; Ma, Yucui; Wu, Cui; Li, Ruiqi; Chao, Zhimao

2018-06-13

The differences of volatile components in male (MFB) and female flower buds (FFB) of Populus × tomentosa were analysed and compared by HS-SPME with GC-MS for the first time. A total of 34 compounds were identified. Two clusters were clearly divided into male and female by hierarchical clustering analysis. Both the male and female flower buds showed methyl salicylate (22.83 and 24.09%, respectively) and 2-hydroxy-benzaldehyde (10.05 and 12.41%, respectively) as the main volatile constituents. The content of 2-cyclohexen-1-one, benzyl benzoate, and methyl benzoate in FFB was remarkably higher than in MFB. In contrast, the content of ethyl benzoate in MFB was greater than that in FFB. The phenomena showed the characteristic differences between MFB and FFB of P. × tomentosa, which enriched the basic studies on dioecious plant.

Identification of five B-type response regulators as members of a multistep phosphorelay system interacting with histidine-containing phosphotransfer partners of Populus osmosensor

Directory of Open Access Journals (Sweden)

Bertheau Lucie

2012-12-01

Full Text Available Abstract Background In plants, the multistep phosphorelay signaling pathway mediates responses to environmental factors and plant hormones. This system is composed of three successive partners: hybrid Histidine-aspartate Kinases (HKs, Histidine-containing Phosphotransfer proteins (HPts, and Response Regulators (RRs. Among the third partners, B-type RR family members are the final output elements of the pathway; they act as transcription factors and clearly play a pivotal role in the early response to cytokinin in Arabidopsis. While interactions studies between partners belonging to the multistep phosphorelay system are mainly focused on protagonists involved in cytokinin or ethylene pathways, very few reports are available concerning partners of osmotic stress signaling pathway. Results In Populus, we identified eight B-type RR proteins, RR12-16, 19, 21 and 22 in the Dorskamp genotype. To assess HPt/B-type RR interactions and consequently determine potential third partners in the osmosensing multistep phosphorelay system, we performed global yeast two-hybrid (Y2H assays in combination with Bimolecular Fluorescence Complementation (BiFC assays in plant cells. We found that all B-type RRs are able to interact with HPt predominant partners (HPt2, 7 and 9 of HK1, which is putatively involved in the osmosensing pathway. However, different profiles of interaction are observed depending on the studied HPt. HPt/RR interactions displayed a nuclear localization, while the nuclear and cytosolic localization of HPt and nuclear localization of RR proteins were validated. Although the nuclear localization of HPt/RR interaction was expected, this work constitutes the first evidence of such an interaction in plants. Furthermore, the pertinence of this partnership is reinforced by highlighting a co-expression of B-type RR transcripts and the other partners (HK1 and HPts belonging to a potential osmosensing pathway. Conclusion Based on the interaction studies

Extensive transcriptome changes during natural onset and release of vegetative bud dormancy in Populus

Directory of Open Access Journals (Sweden)

Glenn Thomas Howe

2015-12-01

Full Text Available To survive winter, many perennial plants become endodormant, a state of suspended growth maintained even in favorable growing environments. To understand vegetative bud endodormancy, we collected paradormant, endodormant, and ecodormant axillary buds from Populus trees growing under natural conditions. Of 44,441 Populus gene models analyzed using NimbleGen microarrays, we found that 1,362 (3.1% were differentially expressed among the three dormancy states, and another 429 (1.0% were differentially expressed during only one of the two dormancy transitions (false discovery rate p-value < 0.05. Of all differentially expressed genes, 69% were down-regulated from paradormancy to endodormancy, which was expected given the lower metabolic activity associated with endodormancy. Dormancy transitions were accompanied by changes in multiple genes associated with DNA methylation (via RNA-directed DNA methylation and histone modifications (via Polycomb Repressive Complex 2, confirming and extending knowledge of chromatin modification as major features of dormancy transitions. Among the chromatin-associated genes, we found two genes similar to SPT (SUPPRESSOR OF TY that were strongly up-regulated during endodormancy. Transcription factor genes and gene sets that were atypically up-regulated during endodormancy include a gene that seems to encode a trihelix transcription factor and genes associated with proteins involved in responses to ethylene, cold, and other abiotic stresses. These latter transcription factors include ETHYLENE INSENSITIVE 3 (EIN3, ETHYLENE-RESPONSIVE ELEMENT BINDING PROTEIN (EBP, ETHYLENE RESPONSE FACTOR (ERF, ZINC FINGER PROTEIN 10 (ZAT10, ZAT12, and WRKY DNA-binding domain proteins. Analyses of phytohormone-associated genes suggest important changes in responses to ethylene, auxin, and brassinosteroids occur during endodormancy. We found weaker evidence for changes in genes associated with salicylic acid and jasmonic acid, and little

Litter Quality of Populus Species as Affected by Free-Air CO2

OpenAIRE

Vermue, E.; Buurman, P.; Hoosbeek, M.R.

2009-01-01

The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher c...

DNA damage in Populus tremuloides clones exposed to elevated O3

International Nuclear Information System (INIS)

Tai, Helen H.; Percy, Kevin E.; Karnosky, David F.

2010-01-01

The effects of elevated concentrations of atmospheric tropospheric ozone (O 3 ) on DNA damage in five trembling aspen (Populus tremuloides Michx.) clones growing in a free-air enrichment experiment in the presence and absence of elevated concentrations of carbon dioxide (CO 2 ) were examined. Growing season mean hourly O 3 concentrations were 36.3 and 47.3 ppb for ambient and elevated O 3 plots, respectively. The 4th highest daily maximum 8-h ambient and elevated O 3 concentrations were 79 and 89 ppb, respectively. Elevated CO 2 averaged 524 ppm (+150 ppm) over the growing season. Exposure to O 3 and CO 2 in combination with O 3 increased DNA damage levels above background as measured by the comet assay. Ozone-tolerant clones 271 and 8L showed the highest levels of DNA damage under elevated O 3 compared with ambient air; whereas less tolerant clone 216 and sensitive clones 42E and 259 had comparably lower levels of DNA damage with no significant differences between elevated O 3 and ambient air. Clone 8L was demonstrated to have the highest level of excision DNA repair. In addition, clone 271 had the highest level of oxidative damage as measured by lipid peroxidation. The results suggest that variation in cellular responses to DNA damage between aspen clones may contribute to O 3 tolerance or sensitivity. - Ozone tolerant clones and sensitive Populus tremuloides clones show differences in DNA damage and repair.

Physiological aspects of short-rotation culture of the poplar. Fertilization of soils by sewage sludge

Energy Technology Data Exchange (ETDEWEB)

Haddad, G

1988-01-01

This study, on the poplar (Populus Trichocarpa x Populus deltoides, c.v. Raspalje) concerned two different problems. The first is a physiological study on the tree treated in short rotation; the second deals with a fertilization by sewage sludge and the consequences on the environment. We have carried out in the laboratory two complementary experiments, the one, on the culture of the poplar in hydroponic medium with a pollutant element (Hg), and the other in the potentialities of soil retention. In the first part, we have showed that: - the best period for coppicing is between Mid August and May, as soon as the stumps were four or five years-old, - the coppicing has a stimulating effect on the growth of the coppice shoots, - the mean number of dominant coppice shoots, after several coppicing, is two, - the productivity is about 20 to 30 tonnes of dry matter per hectare and per year. The second part of this study has showed that: - using 3.2 tonnes of dehydrated sewage sludge per hectare and per year to fertilize, has the same effects on productivity of poplars as a classical fertilization (every 5 years) by chemical manure (N, P, K), - there were no differences in the concentration of heavy metals (Cd, Cu, Pb and Hg), in the different parts of the poplars, between the different plots fertilized with sewage sludge, chemical manure and controlled. Moreover, the experiments performed, in the laboratory showed that: - pollutant elements (Cd, Cu) were fixed in the top of the column soil, - using a hydroponic solution containing a mercuric chloride, labelled ({sup 203}Hg), the poplars absorb very little of the pollutant element. Only 10% of the mercury in the solution was to be found in the plant and 99% of this in the root-system, more precisely, at the level epidermic barrier.

PHYTOALEXIN DEFICIENT 4 affects reactive oxygen species metabolism, cell wall and wood properties in hybrid aspen (Populus tremula L. × tremuloides).

Science.gov (United States)

Ślesak, Ireneusz; Szechyńska-Hebda, Magdalena; Fedak, Halina; Sidoruk, Natalia; Dąbrowska-Bronk, Joanna; Witoń, Damian; Rusaczonek, Anna; Antczak, Andrzej; Drożdżek, Michał; Karpińska, Barbara; Karpiński, Stanisław

2015-07-01

The phytoalexin deficient 4 (PAD4) gene in Arabidopsis thaliana (AtPAD4) is involved in the regulation of plant--pathogen interactions. The role of PAD4 in woody plants is not known; therefore, we characterized its function in hybrid aspen and its role in reactive oxygen species (ROS)-dependent signalling and wood development. Three independent transgenic lines with different suppression levels of poplar PAD expression were generated. All these lines displayed deregulated ROS metabolism, which was manifested by an increased H2O2 level in the leaves and shoots, and higher activities of manganese superoxide dismutase (MnSOD) and catalase (CAT) in the leaves in comparison to the wild-type plants. However, no changes in non-photochemical quenching (NPQ) between the transgenic lines and wild type were observed in the leaves. Moreover, changes in the ROS metabolism in the pad4 transgenic lines positively correlated with wood formation. A higher rate of cell division, decreased tracheid average size and numbers, and increased cell wall thickness were observed. The results presented here suggest that the Populus tremula × tremuloides PAD gene might be involved in the regulation of cellular ROS homeostasis and in the cell division--cell death balance that is associated with wood development. © 2014 John Wiley & Sons Ltd.

The poplar phi class glutathione transferase: expression, activity and structure of GSTF1

Directory of Open Access Journals (Sweden)

Henri ePégeot

2014-12-01

Full Text Available Glutathione transferases (GSTs constitute a superfamily of enzymes with essential roles in cellular detoxification and secondary metabolism in plants as in other organisms. Several plant GSTs, including those of the Phi class (GSTFs, require a conserved catalytic serine residue to perform glutathione (GSH-conjugation reactions. Genomic analyses revealed that terrestrial plants have around 10 GSTFs, 8 in the Populus trichocarpa genome, but their physiological functions and substrates are mostly unknown. Transcript expression analyses showed a predominant expression of all genes both in reproductive (female flowers, fruits, floral buds and vegetative organs (leaves, petioles. Here, we show that the recombinant poplar GSTF1 (PttGSTF1 possesses peroxidase activity towards cumene hydroperoxide and GSH-conjugation activity towards model substrates such as 2,4-dinitrochlorobenzene, benzyl and phenetyl isothiocyanate, 4-nitrophenyl butyrate and 4-hydroxy-2-nonenal but interestingly not on previously identified GSTF-class substrates. In accordance to analytical gel filtration data, crystal structure of PttGSTF1 showed a canonical dimeric organization with bound GSH or MES molecules. The structure of these protein-substrate complexes allowed delineating the residues contributing to both the G and H sites that form the active site cavity. In sum, the presence of GSTF1 transcripts and proteins in most poplar organs especially those rich in secondary metabolites such as flowers and fruits, together with its GSH-conjugation activity and its documented stress-responsive expression suggest that its function is associated with the catalytic transformation of metabolites and/or peroxide removal rather than with ligandin properties as previously reported for other GSTFs.

Factors Influencing the Tissue Culture and the Agrobacterium tumefaciens-Mediated Transformation of Hybrid Aspen and Poplar Clones.

Science.gov (United States)

De Block, M

1990-07-01

Tissue culture conditions and transformation have been established for both aspen and poplar. The use of previously described culture conditions resulted in shoot tip necrosis in the shoot cultures and necrosis of stem and leaf explants. Shoot tip necrosis could be overcome by buffering the medium with 2-(N-morpholino)ethanesulfonic acid and Ca-gluconate and by growing the shoots below 25 degrees C. Necrosis of the explants was probably due to an accumulation of ammonium in the explants and could be overcome by adapting the NO(3) (-)/NH(4) (+) ratio of the media. Stem explants of established shoot cultures of the aspen hybrid Populus alba x P. tremula and of the poplar hybrid Populus trichocarpa x P. deltoides were cocultivated with Agrobacterium strains having chimeric bar and neo genes on their disarmed tDNAs. Transformed aspen shoots were obtained from 30 to 40% of the explants, while transformed poplar shoots were obtained from 10% of the explants. Extracts from the transformed trees contained high phosphinotricin acetyltransferase and neomycin phosphotransferase activities, and the trees contained one to three copies of the chimeric genes. The transformed trees were completely resistant to the commercial preparations of the herbicide phosphinotricin (glufosinate), while control trees were not.

Deserts in the Deluge: TerraPopulus and Big Human-Environment Data.

Science.gov (United States)

Manson, S M; Kugler, T A; Haynes, D

2016-01-01

Terra Populus, or TerraPop, is a cyberinfrastructure project that integrates, preserves, and disseminates massive data collections describing characteristics of the human population and environment over the last six decades. TerraPop has made a number of GIScience advances in the handling of big spatial data to make information interoperable between formats and across scientific communities. In this paper, we describe challenges of these data, or 'deserts in the deluge' of data, that are common to spatial big data more broadly, and explore computational solutions specific to microdata, raster, and vector data models.

Structural and kinetic basis for substrate selectivity in Populus tremuloides sinapyl alcohol dehydrogenase.

Science.gov (United States)

Bomati, Erin K; Noel, Joseph P

2005-05-01

We describe the three-dimensional structure of sinapyl alcohol dehydrogenase (SAD) from Populus tremuloides (aspen), a member of the NADP(H)-dependent dehydrogenase family that catalyzes the last reductive step in the formation of monolignols. The active site topology revealed by the crystal structure substantiates kinetic results indicating that SAD maintains highest specificity for the substrate sinapaldehyde. We also report substantial substrate inhibition kinetics for the SAD-catalyzed reduction of hydroxycinnamaldehydes. Although SAD and classical cinnamyl alcohol dehydrogenases (CADs) catalyze the same reaction and share some sequence identity, the active site topology of SAD is strikingly different from that predicted for classical CADs. Kinetic analyses of wild-type SAD and several active site mutants demonstrate the complexity of defining determinants of substrate specificity in these enzymes. These results, along with a phylogenetic analysis, support the inclusion of SAD in a plant alcohol dehydrogenase subfamily that includes cinnamaldehyde and benzaldehyde dehydrogenases. We used the SAD three-dimensional structure to model several of these SAD-like enzymes, and although their active site topologies largely mirror that of SAD, we describe a correlation between substrate specificity and amino acid substitution patterns in their active sites. The SAD structure thus provides a framework for understanding substrate specificity in this family of enzymes and for engineering new enzyme specificities.

Formation of wood secondary cell wall may involve two type cellulose synthase complexes in Populus.

Science.gov (United States)

Xi, Wang; Song, Dongliang; Sun, Jiayan; Shen, Junhui; Li, Laigeng

2017-03-01

Cellulose biosynthesis is mediated by cellulose synthases (CesAs), which constitute into rosette-like cellulose synthase complexe (CSC) on the plasma membrane. Two types of CSCs in Arabidopsis are believed to be involved in cellulose synthesis in the primary cell wall and secondary cell walls, respectively. In this work, we found that the two type CSCs participated cellulose biosynthesis in differentiating xylem cells undergoing secondary cell wall thickening in Populus. During the cell wall thickening process, expression of one type CSC genes increased while expression of the other type CSC genes decreased. Suppression of different type CSC genes both affected the wall-thickening and disrupted the multilaminar structure of the secondary cell walls. When CesA7A was suppressed, crystalline cellulose content was reduced, which, however, showed an increase when CesA3D was suppressed. The CesA suppression also affected cellulose digestibility of the wood cell walls. The results suggest that two type CSCs are involved in coordinating the cellulose biosynthesis in formation of the multilaminar structure in Populus wood secondary cell walls.

Biomass traits and candidate genes for bioenergy revealed through association genetics in coppiced European Populus nigra (L.)

NARCIS (Netherlands)

Allwright, Mike Robert; Payne, Adrienne; Emiliani, Giovanni; Milner, Suzanne; Viger, Maud; Rouse, Franchesca; Keurentjes, Joost J.B.; Bérard, Aurélie; Wildhagen, Henning; Faivre-Rampant, Patricia; Polle, Andrea; Morgante, Michele; Taylor, Gail

2016-01-01

Background: Second generation (2G) bioenergy from lignocellulosic feedstocks has the potential to develop as a sustainable source of renewable energy; however, significant hurdles still remain for large-scale commercialisation. Populus is considered as a promising 2G feedstock and understanding

Generalized allometric regression to estimate biomass of Populus in short-rotation coppice

Energy Technology Data Exchange (ETDEWEB)

Ben Brahim, Mohammed; Gavaland, Andre; Cabanettes, Alain [INRA Centre de Toulouse, Castanet-Tolosane Cedex (France). Unite Agroforesterie et Foret Paysanne

2000-07-01

Data from four different stands were combined to establish a single generalized allometric equation to estimate above-ground biomass of individual Populus trees grown on short-rotation coppice. The generalized model was performed using diameter at breast height, the mean diameter and the mean height of each site as dependent variables and then compared with the stand-specific regressions using F-test. Results showed that this single regression estimates tree biomass well at each stand and does not introduce bias with increasing diameter.

Altered stream-flow regimes and invasive plant species: The Tamarix case

Science.gov (United States)

Stromberg, J.C.; Lite, S.J.; Marler, R.; Paradzick, C.; Shafroth, P.B.; Shorrock, D.; White, J.M.; White, M.S.

2007-01-01

Aim: To test the hypothesis that anthropogenic alteration of stream-flow regimes is a key driver of compositional shifts from native to introduced riparian plant species. Location: The arid south-western United States; 24 river reaches in the Gila and Lower Colorado drainage basins of Arizona. Methods: We compared the abundance of three dominant woody riparian taxa (native Populus fremontii and Salix gooddingii, and introduced Tamarix) between river reaches that varied in stream-flow permanence (perennial vs. intermittent), presence or absence of an upstream flow-regulating dam, and presence or absence of municipal effluent as a stream water source. Results: Populus and Salix were the dominant pioneer trees along the reaches with perennial flow and a natural flood regime. In contrast, Tamarix had high abundance (patch area and basal area) along reaches with intermittent stream flows (caused by natural and cultural factors), as well as those with dam-regulated flows. Main conclusions: Stream-flow regimes are strong determinants of riparian vegetation structure, and hydrological alterations can drive dominance shifts to introduced species that have an adaptive suite of traits. Deep alluvial groundwater on intermittent rivers favours the deep-rooted, stress-adapted Tamarix over the shallower-rooted and more competitive Populus and Salix. On flow-regulated rivers, shifts in flood timing favour the reproductively opportunistic Tamarix over Populus and Salix, both of which have narrow germination windows. The prevailing hydrological conditions thus favour a new dominant pioneer species in the riparian corridors of the American Southwest. These results reaffirm the importance of reinstating stream-flow regimes (inclusive of groundwater flows) for re-establishing the native pioneer trees as the dominant forest type. ?? 2007 The Authors Journal compilation ?? 2007 Blackwell Publishing Ltd.

STIMULATION OF CICATRIX AND EPITHELIUM MAKING PROCESES, BY USE OF SOME AROMATIC PLANT EXTRACTS

Directory of Open Access Journals (Sweden)

O. NEGREA

2008-05-01

Full Text Available This experiment has as purpose an evaluation of cicatrix stimulation and healing capacity of some accidental wounds produced by different body regions to a livestock of 20 horses, young stock and adult animals, during the year 2007, by local treatment with hydrogel ointment prepared from 8 medicinal plants, namely Echinaceea palida, Calendula officinalis, Populus nigra, Symphytum officinalis, Arnica montana, Thuja occidentalis, Veronica officinalis and Salvia officinalis. To the end of experiment, the best results, in epithelium making and wound contraction, were obtained with Calendule officinalis ointment, which has shortened this stage with 6 days, comparatively to witness wounds and those treated with Veronica officinalis, with 5 days facing to Thuja occidentalis and Salvia officinalis, with 4 days facing to Symphytum officinalis and Arnica montana , with 2 days facing Populus nigra and one day facing to Echinaceea palida.

Abnormal meiosis in an intersectional allotriploid of Populus L. and segregation of ploidy levels in 2x × 3x progeny.

Directory of Open Access Journals (Sweden)

Jun Wang

Full Text Available Triploid plants are usually highly aborted owing to unbalanced meiotic chromosome segregation, but limited viable gametes can participate in the transition to different ploidy levels. In this study, numerous meiotic abnormalities were found with high frequency in an intersectional allotriploid poplar (Populus alba × P. berolinensis 'Yinzhong', including univalents, precocious chromosome migration, lagging chromosomes, chromosome bridges, micronuclei, and precocious cytokinesis, indicating high genetic imbalance in this allotriploid. Some micronuclei trigger mini-spindle formation in metaphase II and participate in cytokinesis to form polyads with microcytes. Unbalanced chromosome segregation and chromosome elimination resulted in the formation of microspores with aneuploid chromosome sets. Fusion of sister nuclei occurs in microsporocytes with precocious cytokinesis, which could form second meiotic division restitution (SDR-type gametes. However, SDR-type gametes likely contain incomplete chromosome sets due to unbalanced segregation of homologous chromosomes during the first meiotic division in triploids. Misorientation of spindles during the second meiotic division, such as fused and tripolar spindles with low frequency, could result in the formation of first meiotic division restitution (FDR-type unreduced gametes, which most likely contain three complete chromosome sets. Although 'Yinzhong' yields 88.7% stainable pollen grains with wide diameter variation from 23.9 to 61.3 μm, the pollen viability is poor (2.78% ± 0.38. A cross of 'Yinzhong' pollen with a diploid female clone produced progeny with extensive segregation of ploidy levels, including 29 diploids, 18 triploids, 4 tetraploids, and 48 aneuploids, suggesting the formation of viable aneuploidy and unreduced pollen in 'Yinzhong'. Individuals with different chromosome compositions are potential to analyze chromosomal function and to integrate the chromosomal dosage variation into

Exotic woody plant invaders of the Transvaal

Directory of Open Access Journals (Sweden)

L. Henderson

1984-12-01

Full Text Available The frequency and abundance o ;f exotic, woody plant invaders were recorded in 60% of the quarter degree squares in the study area. Sixty-one invaders were encountered o f which the most important and aggressive were Acacia dealbaia, Populus spp.,  Melia azedarach, Opuntia ficus-indica, Salix babylonica and  Acacia mearnsii. Invasion patterns are discussed and an attempt is made to correlate distribution with environmental factors. Attention is drawn to the areas of greatest invasion and the areas that are liable to show the greatest expansion in the future.

Nitrogen-controlled intra- and interspecific competition between Populus purdomii and Salix rehderiana drive primary succession in the Gongga Mountain glacier retreat area.

Science.gov (United States)

Song, Mengya; Yu, Lei; Jiang, Yonglei; Lei, Yanbao; Korpelainen, Helena; Niinemets, Ülo; Li, Chunyang

2017-06-01

In this study, intra- and interspecific competition were investigated in early successional Salix rehderiana Schneider and later-appearing Populus purdomii Rehder under non-fertilized (control) and nitrogen (N)-fertilized conditions in the Hailuogou glacier retreat area. Our aim was to discover whether N is a key factor in plant-plant competition and whether N drives the primary succession process in a glacier retreat area. We analyzed differences in responses to intra- and interspecific competition and N fertilization between P. purdomii and S. rehderiana, including parameters such as biomass accumulation, nutrient absorption, non-structural carbohydrates, photosynthetic capacity, hydrolysable amino acids and leaf ultrastructure. In the control treatments, S. rehderiana individuals subjected to interspecific competition benefited from the presence of P. purdomii plants, as indicated by higher levels of biomass accumulation, photosynthetic capacity, N absorption, amino acid contents and photosynthetic N-use efficiency. However, in the N-fertilized treatments, P. purdomii individuals exposed to interspecific competition benefited from the presence of S. rehderiana plants, as shown by a higher growth rate, enhanced carbon gain capacity, greater amino acid contents, and elevated water-use efficiency, whereas the growth of S. rehderiana was significantly reduced. Our results demonstrate that N plays a pivotal role in determining the asymmetric competition pattern among Salicaceae species during primary succession. We argue that the interactive effects of plant-plant competition and N availability are key mechanisms that drive primary succession in the Gongga Mountain glacier retreat area. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Rate of Contamination Removal of Two Phyto-remediation Sites at the DOE Portsmouth Gaseous Diffusion Plant

International Nuclear Information System (INIS)

Lewis, A.C.; Baird, D.R.

2006-01-01

This paper describes applications of phyto-remediation at the Portsmouth Gaseous Diffusion Plant (PORTS), a Department of Energy (DOE) Facility that enriched uranium from the early 1950's until 2000. Phyto-remediation has been implemented to assist in the removal of TCE (trichloroethylene) in the groundwater at two locations at the PORTS facility: the X-740 area and the X-749/X-120 area. Phyto-remediation technology is based on the ability of certain plants species (in this case hybrid poplar trees) and their associated rhizo-spheric microorganisms to remove, degrade, or contain chemical contaminants located in the soil, sediment, surface water, groundwater, and possibly even the atmosphere. Phyto-remediation technology is a promising clean-up solution for a wide variety of pollutants and sites. Mature trees, such as the hybrid poplar, can consume up to 3,000 gallons of groundwater per acre per day. Organic compounds are captured in the trees' root systems. These organic compounds are degraded by ultraviolet light as they are transpired along with the water vapor through the leaves of the trees. The phyto-remediation system at the X-740 area encompasses 766 one-year old hybrid poplar trees (Populus nigra x nigra, Populus nigra x maximowiczii, and Populus deltoides x nigra) that were planted 10 feet apart in rows 10 feet to 20 feet apart, over an area of 2.6 acres. The system was installed to manage the VOC contaminant plume. At the X749/X-120 area, a phyto-remediation system of 2,640 hybrid poplar trees (Populus nigra x maximowiczii) was planted in seven areas/zones to manage the VOC contaminant plume. The objectives of these systems are to remove contamination from the groundwater and to prevent further migration of contaminants. The goal of these remediation procedures is to achieve completely mature and functional phyto-remediation systems within two years of the initial planting of the hybrid poplar trees at each planting location. There is a direct

Phytoextraction potential of poplar (Populus alba L. var. pyramidalis Bunge) from calcareous agricultural soils contaminated by cadmium.

Science.gov (United States)

Hu, Yahu; Nan, Zhongren; Jin, Cheng; Wang, Ning; Luo, Huanzhang

2014-01-01

To investigate the phytoextraction potential of Populus alba L. var. pyramidalis Bunge for cadmium (Cd) contaminated calcareous soils, a concentration gradient experiment and a field sampling experiment (involving poplars of different ages) were conducted. The translocation factors for all experiments and treatments were greater than 1. The bioconcentration factor decreased from 2.37 to 0.25 with increasing soil Cd concentration in the concentration gradient experiment and generally decreased with stand age under field conditions. The Cd concentrations in P. pyramidalis organs decreased in the order of leaves > stems > roots. The shoot biomass production in the concentration gradient experiment was not significantly reduced with soil Cd concentrations up to or slightly over 50 mg kg(-1). The results show that the phytoextraction efficiency of P. pyramidalis depends on both the soil Cd concentration and the tree age. Populus pyramidalis is most suitable for remediation of slightly Cd contaminated calcareous soils through the combined harvest of stems and leaves under actual field conditions.

Comparative physiology of allopatric Populus species: Geographic clines in photosynthesis, height growth and carbon isotope discrimination in common gardens

Directory of Open Access Journals (Sweden)

Raju Yaranna Soolanayakanahally

2015-07-01

Full Text Available Populus species with wide geographic ranges display strong adaptation to local environments. We studied the clinal patterns in phenology and ecophysiology in allopatric Populus species adapted to similar environments on different continents under common garden settings. As a result of climatic adaptation, both P. tremula L. and Populus balsamifera L. display latitudinal clines in photosynthetic rates (A, whereby high-latitude trees of P. tremula had higher A compared to low-latitude trees and nearly so in P. balsamifera (p = 0.06. Stomatal conductance (gs and chlorophyll content index (CCI follow similar latitudinal trends. However, foliar nitrogen was positively correlated with latitude in P. balsamifera and negatively correlated in P. tremula. No significant trends in carbon isotope composition of the leaf tissue (δ13C were observed for both species; but, intrinsic water-use efficiency (WUEi was negatively correlated with the latitude of origin in P. balsamifera. In spite of intrinsically higher A, high-latitude trees in both common gardens accomplished less height gain as a result of early bud set. Thus, shoot biomass was determined by height elongation duration (HED, which was well approximated by the number of days available for free growth between bud flush and bud set. In doing so, we highlight the shortcoming of unreplicated outdoor common gardens for tree improvement and the crucial role of photoperiod in limiting height growth, further complicating interpretation of other secondary effects.

Increased leaf area dominates carbon flux response to elevated CO2 in stands of Populus deltoides (Bartr.)

Science.gov (United States)

Ramesh Murthy; Greg Barron-Gafford; Philip M. Dougherty; Victor c. Engels; Katie Grieve; Linda Handley; Christie Klimas; Mark J. Postosnaks; Stanley J. Zarnoch; Jianwei Zhang

2005-01-01

We examined the effects of atmospheric vapor pressure deficit (VPD) and soil moisture stress (SMS) on leaf- and stand-level CO2 exchange in model 3-year-old coppiced cottonwood (Populus deltoides Bartr.) plantations using the large-scale, controlled environments of the Biosphere 2 Laboratory. A short-term experiment was imposed...

Transcriptome responses to aluminum stress in roots of aspen (Populus tremula

Directory of Open Access Journals (Sweden)

Grisel Nadine

2010-08-01

Full Text Available Abstract Background Ionic aluminum (mainly Al3+ is rhizotoxic and can be present in acid soils at concentrations high enough to inhibit root growth. Many forest tree species grow naturally in acid soils and often tolerate high concentrations of Al. Previously, we have shown that aspen (Populus tremula releases citrate and oxalate from roots in response to Al exposure. To obtain further insights into the root responses of aspen to Al, we investigated root gene expression at Al conditions that inhibit root growth. Results Treatment of the aspen roots with 500 μM Al induced a strong inhibition of root growth within 6 h of exposure time. The root growth subsequently recovered, reaching growth rates comparable to that of control plants. Changes in gene expression were determined after 6 h, 2 d, and 10 d of Al exposure. Replicated transcriptome analyses using the Affymetrix poplar genome array revealed a total of 175 significantly up-regulated and 69 down-regulated genes, of which 70% could be annotated based on Arabidopsis genome resources. Between 6 h and 2 d, the number of responsive genes strongly decreased from 202 to 26, and then the number of changes remained low. The responses after 6 h were characterized by genes involved in cell wall modification, ion transport, and oxidative stress. Two genes with prolonged induction were closely related to the Arabidopsis Al tolerance genes ALS3 (for Al sensitive 3 and MATE (for multidrug and toxin efflux protein, mediating citrate efflux. Patterns of expression in different plant organs and in response to Al indicated that the two aspen genes are homologs of the Arabidopsis ALS3 and MATE. Conclusion Exposure of aspen roots to Al results in a rapid inhibition of root growth and a large change in root gene expression. The subsequent root growth recovery and the concomitant reduction in the number of responsive genes presumably reflect the success of the roots in activating Al tolerance mechanisms. The

Sex-specific responses of Populus yunnanensis exposed to elevated CO{sub 2} and salinity

Energy Technology Data Exchange (ETDEWEB)

Ling Li; Yuanbin Zhang; Chunyang Li [Chinese Academy of Sciences. Chengdu Institute of Biology, Chengdu (Switzerland); Jianxun Luo, Sichuan Academy of Forestry, Chengdu (Switzerland)); Korpelainen, H. [Univ. of Helsinki. Dept. of Agricultural Sciences, Helsinki (Finland)

2013-04-15

Populus yunnanensis Dode., a native dioecious woody plant in southwestern China, was employed as a model species to study sex-specific morphological, physiological and biochemical responses to elevated CO{sub 2} and salinity. To investigate the effects of elevated CO{sub 2}, salinity and their combination, the cuttings were exposed to two CO{sub 2} regimes (ambient CO{sub 2} and double ambient CO{sub 2}) and two salt treatments in growth chambers. Males exhibited greater downregulation of net photosynthesis rate (A{sub net}) and carboxylation efficiency (CE) than females at elevated CO{sub 2}, whereas these sexual differences were lessened under salt stress. On the other hand, salinity induced a higher decrease in Anet and CE, more growth inhibition and leaf Cl{sup -} accumulation and more damage to cell organelles in females than in males, whereas the sexual differences in photosynthesis and growth were lessened at elevated CO{sub 2}. Moreover, elevated CO{sub 2} exacerbated membrane lipid peroxidation and organelle damage in females but not in males under salt stress. Our results indicated that: (1) females are more sensitive and suffer from greater negative effects than do males under salt stress, and elevated CO{sub 2} lessens the sexual differences in photosynthesis and growth under salt stress; (2) elevated CO{sub 2} tends to aggravate the negative effects of salinity in females; and (3) sex-specific reactions under the combination of elevated CO{sub 2} and salinity are distinct from single-stress responses. Therefore, these results provide evidence for different adaptive responses between plants of different sexes exposed to elevated CO{sub 2} and salinity. (Author)

The UDP-glucuronate decarboxylase gene family in Populus: structure, expression, and association genetics.

Directory of Open Access Journals (Sweden)

Qingzhang Du

Full Text Available In woody crop plants, the oligosaccharide components of the cell wall are essential for important traits such as bioenergy content, growth, and structural wood properties. UDP-glucuronate decarboxylase (UXS is a key enzyme in the synthesis of UDP-xylose for the formation of xylans during cell wall biosynthesis. Here, we isolated a multigene family of seven members (PtUXS1-7 encoding UXS from Populus tomentosa, the first investigation of UXSs in a tree species. Analysis of gene structure and phylogeny showed that the PtUXS family could be divided into three groups (PtUXS1/4, PtUXS2/5, and PtUXS3/6/7, consistent with the tissue-specific expression patterns of each PtUXS. We further evaluated the functional consequences of nucleotide polymorphisms in PtUXS1. In total, 243 single-nucleotide polymorphisms (SNPs were identified, with a high frequency of SNPs (1/18 bp and nucleotide diversity (πT = 0.01033, θw = 0.01280. Linkage disequilibrium (LD analysis showed that LD did not extend over the entire gene (r (2<0.1, P<0.001, within 700 bp. SNP- and haplotype-based association analysis showed that nine SNPs (Q <0.10 and 12 haplotypes (P<0.05 were significantly associated with growth and wood property traits in the association population (426 individuals, with 2.70% to 12.37% of the phenotypic variation explained. Four significant single-marker associations (Q <0.10 were validated in a linkage mapping population of 1200 individuals. Also, RNA transcript accumulation varies among genotypic classes of SNP10 was further confirmed in the association population. This is the first comprehensive study of the UXS gene family in woody plants, and lays the foundation for genetic improvements of wood properties and growth in trees using genetic engineering or marker-assisted breeding.

Date of shoot collection, genotype, and original shoot position affect early rooting of dormant hardwood cuttings of Populus

Science.gov (United States)

R. S., Jr. Zalesny; A.H. Wiese

2006-01-01

Identifying superior combinations among date of dormant- season shoot collection, genotype, and original shoot position can increase the rooting potential of Populus cuttings. Thus, the objectives of our study were to: 1) evaluate variation among clones in early rooting from hardwood cuttings processed every three weeks from shoots collected...

Sex-specific responses of Populus deltoides to defoliation

Directory of Open Access Journals (Sweden)

Li Shuxin

2017-12-01

Full Text Available There has been an increasing interest in understanding the differential effects of sexual dimorphism on plant stress responses. However, there is no clear pattern in the responses of the sexes to defoliation. In this study, the effects of different severity of artificial defoliation on biomass production, total nonstructural carbohydrate (NSC concentration, and photosynthetic rate (PN of male and female Populus deltoides were examined. We used half and full defoliation to observe the differences between the sexes in three harvest dates (1 week, 4 weeks, and 8 weeks after treatments. We hypothesized that female and male P. deltoides compared with an undefoliated control would have compensatory growth in response to defoliation treatments. Results showed that half and full defoliation reduced the growth of both sexes. Following half defoliation, root growth was reduced, especially in males, at T2 (4 weeks after defoliation and T3 (8 weeks after defoliation, while males showed an increase in height increment under the half defoliation compared with the nondefoliation treatments. By contrast, females were more negatively affected by defoliation than males in terms of biomass after 8 weeks. One week after defoliation, PN increased significantly in females and males under half defoliation (+30%, +32%, respectively and full defoliation (+58%, +56%, respectively. However, 8 weeks after defoliation, there was little difference in PN between defoliated and undefoliated female cuttings. Increases in stomatal conductance (gs and leaf nitrogen were observed under fully defoliated female and male cuttings. Moreover, males had less NSC concentrations following half defoliation compared with females. Our results indicate that leaf compensatory growth in male cuttings of P. deltoides was maintained by obtaining greater photosynthetic capacity, higher leaf nitrogen, and lower NSC concentration following half and full defoliation. Our results highlight that

Molecular Cloning and Functional Analysis of UV RESISTANCE LOCUS 8 (PeUVR8 from Populus euphratica.

Directory of Open Access Journals (Sweden)

Ke Mao

Full Text Available Ultraviolet-B (UV-B; 280-315 nm light, which is an integral part of the solar radiation reaching the surface of the Earth, induces a broad range of physiological responses in plants. The UV RESISTANCE LOCUS 8 (UVR8 protein is the first and only light photoreceptor characterized to date that is specific for UV-B light and it regulates various aspects of plant growth and development in response to UV-B light. Despite its involvement in the control of important plant traits, most studies on UV-B photoreceptors have focused on Arabidopsis and no data on UVR8 function are available for forest trees. In this study, we isolated a homologue of the UV receptor UVR8 of Arabidopsis, PeUVR8, from Populus euphratica (Euphrates poplar and analyzed its structure and function in detail. The deduced PeUVR8 amino acid sequence contained nine well-conserved regulator of chromosome condensation 1 (RCC1 repeats and the region 27 amino acids from the C terminus (C27 that interact with COP1 (CONSTITUTIVELY PHOTOMORPHOGENIC1. Secondary and tertiary structure analysis showed that PeUVR8 shares high similarity with the AtUVR8 protein from Arabidopsis thaliana. Using heterologous expression in Arabidopsis, we showed that PeUVR8 overexpression rescued the uvr8 mutant phenotype. In addition, PeUVR8 overexpression in wild-type background seedlings grown under UV-B light inhibited hypocotyl elongation and enhanced anthocyanin accumulation. Furthermore, we examined the interaction between PeUVR8 and AtCOP1 using a bimolecular fluorescence complementation (BiFC assay. Our data provide evidence that PeUVR8 plays important roles in the control of photomorphogenesis in planta.

Sex-specific responses to winter flooding, spring waterlogging and post-flooding recovery in Populus deltoides

OpenAIRE

Ling-Feng Miao; Fan Yang; Chun-Yu Han; Yu-Jin Pu; Yang Ding; Li-Jia Zhang

2017-01-01

Winter flooding events are common in some rivers and streams due to dam constructions, and flooding and waterlogging inhibit the growth of trees in riparian zones. This study investigated sex-specific morphological, physiological and ultrastructural responses to various durations of winter flooding and spring waterlogging stresses, and post-flooding recovery characteristics in Populus deltoides. There were no significant differences in the morphological, ultrastructural and the majority of ph...

Sex-specific responses to winter flooding, spring waterlogging and post-flooding recovery in Populus deltoides.

Science.gov (United States)

Miao, Ling-Feng; Yang, Fan; Han, Chun-Yu; Pu, Yu-Jin; Ding, Yang; Zhang, Li-Jia

2017-05-31

Winter flooding events are common in some rivers and streams due to dam constructions, and flooding and waterlogging inhibit the growth of trees in riparian zones. This study investigated sex-specific morphological, physiological and ultrastructural responses to various durations of winter flooding and spring waterlogging stresses, and post-flooding recovery characteristics in Populus deltoides. There were no significant differences in the morphological, ultrastructural and the majority of physiological traits in trees subjected to medium and severe winter flooding stresses, suggesting that males and females of P. deltoides were winter flooding tolerant, and insensitive to winter flooding duration. Males were more tolerant to winter flooding stress in terms of photosynthesis and chlorophyll fluorescence than females. Females displayed greater oxidative damage due to flooding stress than males. Males developed more efficient antioxidant enzymatic systems to control reactive oxygen species. Both sexes had similarly strong post-flooding recovery capabilities in terms of plant growth, and physiological and ultrastructural parameters. However, Males had better recovery capabilities in terms of pigment content. These results increase the understanding of poplars's adaptation to winter flooding stress. They also elucidate sex-specific differences in response to flooding stress during the dormant season, and during post-flooding recovery periods.

Effects of light regime and IBA concentration on adventitious rooting of an eastern cottonwood (Populus deltoides) clone

Science.gov (United States)

Alexander P. Hoffman; Joshua P. Adams; Andrew Nelson

2016-01-01

Eastern cottonwood (Populus deltoides) has received a substantial amount of interest from invitro studies within the past decade. The ability to efficiently multiply the stock of established clones such as clone 110412 is a valuable asset for forest endeavors. However, a common problem encountered is initiating adventitious rooting in new micropropagation protocols....

Analysis of the pumpkin phloem proteome provides insights into angiosperm sieve tube function.

Science.gov (United States)

Lin, Ming-Kuem; Lee, Young-Jin; Lough, Tony J; Phinney, Brett S; Lucas, William J

2009-02-01

Increasing evidence suggests that proteins present in the angiosperm sieve tube system play an important role in the long distance signaling system of plants. To identify the nature of these putatively non-cell-autonomous proteins, we adopted a large scale proteomics approach to analyze pumpkin phloem exudates. Phloem proteins were fractionated by fast protein liquid chromatography using both anion and cation exchange columns and then either in-solution or in-gel digested following further separation by SDS-PAGE. A total of 345 LC-MS/MS data sets were analyzed using a combination of Mascot and X!Tandem against the NCBI non-redundant green plant database and an extensive Cucurbit maxima expressed sequence tag database. In this analysis, 1,209 different consensi were obtained of which 1,121 could be annotated from GenBank and BLAST search analyses against three plant species, Arabidopsis thaliana, rice (Oryza sativa), and poplar (Populus trichocarpa). Gene ontology (GO) enrichment analyses identified sets of phloem proteins that function in RNA binding, mRNA translation, ubiquitin-mediated proteolysis, and macromolecular and vesicle trafficking. Our findings indicate that protein synthesis and turnover, processes that were thought to be absent in enucleate sieve elements, likely occur within the angiosperm phloem translocation stream. In addition, our GO analysis identified a set of phloem proteins that are associated with the GO term "embryonic development ending in seed dormancy"; this finding raises the intriguing question as to whether the phloem may exert some level of control over seed development. The universal significance of the phloem proteome was highlighted by conservation of the phloem proteome in species as diverse as monocots (rice), eudicots (Arabidopsis and pumpkin), and trees (poplar). These results are discussed from the perspective of the role played by the phloem proteome as an integral component of the whole plant communication system.

Uncovering the defence responses of Eucalyptus to pests and pathogens in the genomics age.

Science.gov (United States)

Naidoo, Sanushka; Külheim, Carsten; Zwart, Lizahn; Mangwanda, Ronishree; Oates, Caryn N; Visser, Erik A; Wilken, Febé E; Mamni, Thandekile B; Myburg, Alexander A

2014-09-01

Long-lived tree species are subject to attack by various pests and pathogens during their lifetime. This problem is exacerbated by climate change, which may increase the host range for pathogens and extend the period of infestation by pests. Plant defences may involve preformed barriers or induced resistance mechanisms based on recognition of the invader, complex signalling cascades, hormone signalling, activation of transcription factors and production of pathogenesis-related (PR) proteins with direct antimicrobial or anti-insect activity. Trees have evolved some unique defence mechanisms compared with well-studied model plants, which are mostly herbaceous annuals. The genome sequence of Eucalyptus grandis W. Hill ex Maiden has recently become available and provides a resource to extend our understanding of defence in large woody perennials. This review synthesizes existing knowledge of defence mechanisms in model plants and tree species and features mechanisms that may be important for defence in Eucalyptus, such as anatomical variants and the role of chemicals and proteins. Based on the E. grandis genome sequence, we have identified putative PR proteins based on sequence identity to the previously described plant PR proteins. Putative orthologues for PR-1, PR-2, PR-4, PR-5, PR-6, PR-7, PR-8, PR-9, PR-10, PR-12, PR-14, PR-15 and PR-17 have been identified and compared with their orthologues in Populus trichocarpa Torr. & A. Gray ex Hook and Arabidopsis thaliana (L.) Heynh. The survey of PR genes in Eucalyptus provides a first step in identifying defence gene targets that may be employed for protection of the species in future. Genomic resources available for Eucalyptus are discussed and approaches for improving resistance in these hardwood trees, earmarked as a bioenergy source in future, are considered. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Effect of submergence-emergence sequence and organic matter or aluminosilicate amendment on metal uptake by woody wetland plant species from contaminated sediments

International Nuclear Information System (INIS)

Vandecasteele, Bart; Du Laing, Gijs; Tack, Filip M.G.

2007-01-01

Site-specific hydrological conditions affect the availability of trace metals for vegetation. In a greenhouse experiment, the effect of submersion on the metal uptake by the wetland plant species Salix cinerea and Populus nigra grown on a contaminated dredged sediment-derived soil and on an uncontaminated soil was evaluated. An upland hydrological regime for the polluted sediment caused elevated Cd concentrations in leaves and cuttings for both species. Emergence and soil oxidation after initial submersion of a polluted sediment resulted in comparable foliar Cd and Zn concentrations for S. cinerea as for the constant upland treatment. The foliar Cd and Zn concentrations were clearly higher than for submerged soils after initial upland conditions. These results point at the importance of submergence-emergence sequence for plant metal availability. The addition of foliar-based organic matter or aluminosilicates to the polluted sediment-derived soil in upland conditions did not decrease Cd and Zn uptake by S. cinerea. - The effect of a wetland hydrological regime on Cd uptake was similar for Populus nigra and Salix cinerea

Some new and noteworthy diseases of poplars in India. [Botryodiplodia sett-rot; Alternaria tip blight; Cladosporium leaf spot; Fusarium pink incrustation

Energy Technology Data Exchange (ETDEWEB)

Singh, S.

1983-09-01

Four new diseases of poplars namely Botryodiplodia sett-rott, Alternaria tip blight, Cladosporium leaf spot and Fusarium pink incrustation are described in this paper. Botryodiplodia palmarum causes sett-rott of poplars both at pre-sprouting and post-sprouting stage. The pathogen also causes mortality of poplar plants in the field within 4-6 weeks after planting. Alternaria stage of Pleuspora infectoria has been found as the cause of blackening and dying of growing tips and young leaves of a Populus sp. and P. deltoides in nurseries. Cladosporium humile has been recorded as the cause of brown spot followed by crumpling and premature shedding of leaves in P. ciliata, P. nigra and P. alba. The cause of Fusarium incrustation disease on P. cilata has been identified as Fusarium sp. of Gibbosum group. Pathogenicity of Botryodiplodia palmarum and Alternaria stage of Pleospora infectoria was confirmed by artificial inoculations. Brief descriptions of Alternaria, Cladosporium and Fusarium are also given. The paper also gives a short account of some noteworthy diseases recorded on poplars namely Ganoderma root rot, foliage ruts and stem cankers. Ganoderma root-rot is found to reach alarming proportions in closely spaced poplar plantations. Melampsora ciliata, an indigenous rust, is found to attack mainly clones of P. deltoides, P. yunnanensis, P. trichocarpa, P. alba and some cultivars of P. x euramericana in nurseries. A brief account of three types of stem cankers i.e. cankers due to pink disease fungus, Corticium salmonicolor, sun-scaled cankers and cankers associated with slime flux on various clones of P. deltoides is also given.

Eighteen microsatellite loci in Salix arbutifolia (Salicaceae) and cross-species amplification in Salix and Populus species.

Science.gov (United States)

Hoshikawa, Takeshi; Kikuchi, Satoshi; Nagamitsu, Teruyoshi; Tomaru, Nobuhiro

2009-07-01

Salix arbutifolia is a riparian dioecious tree species that is of conservation concern in Japan because of its highly restricted distribution. Eighteen polymorphic loci of dinucleotide microsatellites were isolated and characterized. Among these, estimates of the expected heterozygosity ranged from 0.350 to 0.879. Cross-species amplification was successful at 9-13 loci among six Salix species and at three loci in one Populus species. © 2009 Blackwell Publishing Ltd.

Genetic origin and composition of a natural hybrid poplar Populus???jrtyschensis from two distantly related species

OpenAIRE

Jiang, Dechun; Feng, Jianju; Dong, Miao; Wu, Guili; Mao, Kangshan; Liu, Jianquan

2016-01-01

Background The factors that contribute to and maintain hybrid zones between distinct species are highly variable, depending on hybrid origins, frequencies and fitness. In this study, we aimed to examine genetic origins, compositions and possible maintenance of Populus???jrtyschensis, an assumed natural hybrid between two distantly related species. This hybrid poplar occurs mainly on the floodplains along the river valleys between the overlapping distributions of the two putative parents. Resu...

PROCESS OPTIMIZATION OF TETRA ACETYL ETHYLENE DIAMINE ACTIVATED HYDROGEN PEROXIDE BLEACHING OF POPULUS NIGRA CTMP

OpenAIRE

Qiang Zhao; Junwen Pu; Shulei Mao; Guibo Qi

2010-01-01

To enhance the bleaching efficiency, the activator of tetra acetyl ethylene diamine (TAED) was used in conventional H2O2 bleaching. The H2O2/TAED bleaching system can accelerate the reaction rate and shorten bleaching time at relative low temperature, which can reduce the production cost. In this research, the process with hydrogen peroxide activated by TAED bleaching of Populus nigra chemi-thermo mechanical pulp was optimized. Suitable bleaching conditions were confirmed as follows: pulp con...

Stem respiration of Populus species in the third year of free-air CO2 enrichment

OpenAIRE

GIELEN, Birgit; Scarascia-Mugnozza, G.; Ceulemans, R.

2003-01-01

Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO2 concentrations. Regarding this question, effects of elevated [CO2 ] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-...

Influence of irrigation and fertilization on transpiration and hydraulic properties of Populus deltoides.

Energy Technology Data Exchange (ETDEWEB)

Samuelson, Lisa, J.; Stokes, Thomas, A.; Coleman, Mark, D.

2007-02-01

Summary Long-term hydraulic acclimation to resource availability was explored in 3-year-bld Populus deltoides Bartr. ex Marsh. clones by examining transpiration. leaf-specific hydraulic conductance (GL), canopy stomatal conductance (Gs) and leaf to sapwood area ratio (AL:Asi)n response to imgation (13 and 551 mm year in addition to ambient precipitation) and fertilization (0 and 120 kg N ha-' year-'). Sap flow was measured continuously over one growing season with thermal dissipation probes. Fertilization had a greater effect on growth and hydraulic properties than imgation, and fertilization effects were independent of irrigation treatment. Transpiration on a ground area basis (E) ranged between 0.3 and 1.8 mm day-', and increased 66% and 90% in response to imgation and fertilization, respectively. Increases in GL, Gs at a reference vapor pressure deficit of 1 kPa, and transpiration per unit leaf areain response to increases in resource availability were associated with reductions in AL:As and consequently a minimal change in the water potential gradient from soil to leaf. Imgation and fertilization increased leaf area index similarly, from an average 1.16 in control stands to 1.45, but sapwood area was increased from 4.0 to 6.3 m ha-' by irrigation and from 3.7 to 6.7 m2 ha-' by fertilization. The balance between leaf area and sapwood area was important in understanding long-term hydraulic acclimation to resource availability and mechanisms controlling maximum productivity in Populus deltoides.

An ecophysiological study of plants growing on the fly ash deposits from the "Nikola Tesla-A" thermal power station in Serbia.

Science.gov (United States)

Pavlović, Pavle; Mitrović, Miroslava; Djurdjević, Lola

2004-05-01

This ecophysiological research on the ash deposits from the "Nikola Tesla-A" thermal power station in Serbia covered 10 plant species (Tamarix gallica, Populus alba, Spiraea van-hauttei, Ambrosia artemisifolia, Amorpha fruticosa, Eupatorium cannabinum, Crepis setosa, Epilobium collinum, Verbascum phlomoides, and Cirsium arvense). This paper presents the results of a water regime analysis, photosynthetic efficiency and trace elements (B, Cu, Mn, Zn, Pb, and Cd) content in vegetative plant parts. Water regime parameters indicate an overall stability in plant-water relations. During the period of summer drought, photosynthetic efficiency (Fv/Fm) was low, ranging from 0.429 to 0.620 for all the species that were analyzed. An analysis of the tissue trace elements content showed a lower trace metal concentration in the plants than in the ash, indicating that heavy metals undergo major concentration during the combustion process and some are not readily taken up by plants. The Zn and Pb concentrations in all of the examined species were normal whereas Cu and Mn concentrations were in the deficiency range. Boron concentrations in plant tissues were high, with some species even showing levels of more than 100 microg/g (Populus sp., Ambrosia sp., Amorpha sp., and Cirsium sp.). The presence of Cd was not detected. In general, it can be concluded from the results of this research that biological recultivation should take into account the existing ecological, vegetation, and floristic potential of an immediate environment that is abundant in life forms and ecological types of plant species that can overgrow the ash deposit relatively quickly. Selected species should be adapted to toxic B concentrations with moderate demands in terms of mineral elements (Cu and Mn).

Plant species influence on soil C after afforestation of Mediterranean degraded soils

Science.gov (United States)

Dominguez, Maria T.; García-Vargas, Carlos; Madejón, Engracia; Marañón, Teodoro

2015-04-01

Increasing C sequestration in terrestrial ecosystems is one of the main current environmental challenges to mitigate climate change. Afforestation of degraded and contaminated lands is one of the key strategies to achieve an increase in C sequestration in ecosystems. Plant species differ in their mechanisms of C-fixation, C allocation into different plant organs, and interaction with soil microorganisms, all these factors influencing the dynamics of soil C following the afforestation of degraded soils. In this work we examine the influence of different woody plant species on soil C dynamics in degraded and afforested Mediterranean soils. The soils were former agricultural lands that were polluted by a mining accident and later afforested with different native plant species. We analysed the effect of four of these species (Olea europaea var. sylvestris Brot., Populus alba L., Pistacia lentiscus L. and Retama sphaerocarpa (L.) Boiss.) on different soil C fractions, soil nutrient availability, microbial activity (soil enzyme activities) and soil CO2 fluxes 15 years after the establishment of the plantations. Results suggest that the influence of the planted trees and shrubs is still limited, being more pronounced in the more acidic and nutrient-poor soils. Litter accumulation varied among species, with the highest C accumulated in the litter under the deciduous species (Populus alba L.). No differences were observed in the amount of total soil organic C among the studied species, or in the concentrations of phenols and sugars in the dissolved organic C (DOC), which might have indicated differences in the biodegradability of the DOC. Microbial biomass and activity was highly influenced by soil pH, and plant species had a significant influence on soil pH in the more acidic site. Soil CO2 fluxes were more influenced by the plant species than total soil C content. Our results suggest that changes in total soil C stocks after the afforestation of degraded Mediterranean

Barrier to gene flow between two ecologically divergent Populus species, P. alba (white poplar) and P. tremula (European aspen): the role of ecology and life history in gene introgression.

Science.gov (United States)

Lexer, C; Fay, M F; Joseph, J A; Nica, M-S; Heinze, B

2005-04-01

The renewed interest in the use of hybrid zones for studying speciation calls for the identification and study of hybrid zones across a wide range of organisms, especially in long-lived taxa for which it is often difficult to generate interpopulation variation through controlled crosses. Here, we report on the extent and direction of introgression between two members of the "model tree" genus Populus: Populus alba (white poplar) and Populus tremula (European aspen), across a large zone of sympatry located in the Danube valley. We genotyped 93 hybrid morphotypes and samples from four parental reference populations from within and outside the zone of sympatry for a genome-wide set of 20 nuclear microsatellites and eight plastid DNA restriction site polymorphisms. Our results indicate that introgression occurs preferentially from P. tremula to P. alba via P. tremula pollen. This unidirectional pattern is facilitated by high levels of pollen vs. seed dispersal in P. tremula (pollen/seed flow = 23.9) and by great ecological opportunity in the lowland floodplain forest in proximity to P. alba seed parents, which maintains gene flow in the direction of P. alba despite smaller effective population sizes (N(e)) in this species (P. alba N(e)c. 500-550; P. tremula N(e)c. 550-700). Our results indicate that hybrid zones will be valuable tools for studying the genetic architecture of the barrier to gene flow between these two ecologically divergent Populus species.

Scientific Basis for Sustainable Management of Eucalyptus and Populus as Short-Rotation Woody Crops in the U.S.

Directory of Open Access Journals (Sweden)

Eric D. Vance

2014-05-01

Full Text Available Short rotation woody crops (SRWC, fast growing tree species that are harvested on short, repeated intervals, can augment traditional fiber sources. These crops have economic and environmental benefits stemming from their capability of supplying fiber on a reduced land base in close proximity to users and when sensitive sites cannot be accessed. Eucalyptus and Populus appear to be genera with the greatest potential to provide supplemental fiber in the U.S. Optimal productivity can be achieved through practices that overcome site limitations and by choosing the most appropriate sites, species, and clones. Some Eucalyptus species are potentially invasive, yet field studies across multiple continents suggest they are slower to disperse than predicted by risk assessments. Some studies have found lower plant and animal diversity in SRWC systems compared to mature, native forests, but greater than some alterative land uses and strongly influenced by stand management, land use history, and landscape context. Eucalyptus established in place of grasslands, arable lands, and, in some cases, native forests can reduce streamflow and lower water tables due to higher interception and transpiration rates but results vary widely, are scale dependent, and are most evident in drier regions.

Optimization of agrobacterium tumefaciens mediated transformation in populus deltoides

International Nuclear Information System (INIS)

John, E.; Maqbool, A.; Malik, K.A.

2014-01-01

The objective of the study was to develop an efficient protocol for Populus deltoides transformation through Agrobacterium tumefaciens LBA4404. Agrobacterium strain harboring binary plasmid pGA482 with Gus (uidA) gene under CamV35S promoter and Neomycin phosphotransferase (nptII) gene under Nos promoter was used for the transformation. Nodal, internodal and leaf explants from 4-5 months In vitro and fieldgrown plants were used for the transformation. Transformation was done under different conditions including, preculture time, optical density, acetosyringone concentration, infection time and co-cultivation time. Confirmation of transformation was done through GUS histochemical staining. Highest transformation efficiency was observed in one week precultured leaf explants from field grown source on preculture medium containing 200 meu M acetosyringone. Precultured explants from In vitro source also gave good results for transformation but the callus formation was found to be slow in leaf explant. Calli from the both sources did not show any transformation when infected with O.D A600nm range from 0.3-0.8. Node and internode though showed less transformation rate but the callogenesis was found to be highest in node and internode explants on CIM 1. Leaf explants from field source also gave high callus induction on CIM 5. A. tumefaciens O.D A600nm 0.3-0.5 was found to be effective. Infection time of 1-2 hour and co-cultivation time of 1day in dark were found to be optimum for the transformation. 200mg/l of timentin was found the best to control the overgrowth of Agrobacterium.100mg/l Kanamycin in growth medium was found to sufficient for selection for transformants. Selected transformants were confirmed through PCR for the presence of transgene. The present protocol for P. deltoides was found to be efficient for genetic transformation and can be used to introduce novel traits in the P. deltoides. (author)

Plant Signals Disrupt (regulate?) Arbuscular Mycorrhizal Fungal Growth Under Enhanced Ozone and CO2 Growing Conditions for Populus tremuloides

Science.gov (United States)

Miller, R. M.; Podila, G. K.

2008-12-01

An understanding of the genetic determinants of keystone symbiotic relationships is essential to elucidating adaptive mechanisms influencing higher-order processes, including shifts in community composition following environmental perturbations. The Aspen FACE project offers a unique opportunity to address adaptive processes with an imposed three way interaction experiment composed of the atmospheric pollutant ozone (eO3), elevated CO2 (eCO2) fumigations, five Populus tremuloides (aspen) genotypes, and both arbuscular mycorrhizal and ectomycorrhizal fungal interactions. The 10 year time span of this experiment has allowed for a realistic and mechanistic understanding of above ground responses of the aspen genotypes to eCO2, eO3 and the interaction effects of eCO2 and eO3. Even so, treatment influences to the below ground, including carbon allocation to roots and associated mycorrhizal symbionts, and rhizosphere dynamics are just beginning to be understood. We hypothesized that mycorrhizal fungal responses to eCO2, eO3, and the interaction effects of eCO2+eO3 are conditioned by the degree of response of their aspen hosts. We intend to describe the molecular mechanisms of an important critical interaction between host and fungus using microarray analysis of expression profiles, as well as metabolic profiling of aspen roots and their associated mycorrhizal partner, the arbuscular mycorrhizal fungus (AMF) Glomus intraradices, under eCO2, eO3 and eCO2+eO3. We present evidence that host-derived factors, expressed in response to eCO2+eO3, trigger responses in Glomus leading to the partitioning or metabolic shift in lipid biosynthesis that is associated with reduced extraradical hyphae growth and altered lipid metabolism. We then scale these lower-level responses to give better insight to fungal intraradical and extraradical allocation of biomass and fungal and root lipid and carbohydrate content in association with aspen genotype responses to the imposed treatments. By

Pectin methyl esterase inhibits intrusive and symplastic cell growth in developing wood cells of Populus.

Science.gov (United States)

Siedlecka, Anna; Wiklund, Susanne; Péronne, Marie-Amélie; Micheli, Fabienne; Lesniewska, Joanna; Sethson, Ingmar; Edlund, Ulf; Richard, Luc; Sundberg, Björn; Mellerowicz, Ewa J

2008-02-01

Wood cells, unlike most other cells in plants, grow by a unique combination of intrusive and symplastic growth. Fibers grow in diameter by diffuse symplastic growth, but they elongate solely by intrusive apical growth penetrating the pectin-rich middle lamella that cements neighboring cells together. In contrast, vessel elements grow in diameter by a combination of intrusive and symplastic growth. We demonstrate that an abundant pectin methyl esterase (PME; EC 3.1.1.11) from wood-forming tissues of hybrid aspen (Populus tremula x tremuloides) acts as a negative regulator of both symplastic and intrusive growth of developing wood cells. When PttPME1 expression was up- and down-regulated in transgenic aspen trees, the PME activity in wood-forming tissues was correspondingly altered. PME removes methyl ester groups from homogalacturonan (HG) and transgenic trees had modified HG methylesterification patterns, as demonstrated by two-dimensional nuclear magnetic resonance and immunostaining using PAM1 and LM7 antibodies. In situ distributions of PAM1 and LM7 epitopes revealed changes in pectin methylesterification in transgenic trees that were specifically localized in expanding wood cells. The results show that en block deesterification of HG by PttPME1 inhibits both symplastic growth and intrusive growth. PttPME1 is therefore involved in mechanisms determining fiber width and length in the wood of aspen trees.

The effects of groundwater depth on water uptake of Populus euphratica and Tamarix ramosissima in the hyperarid region of Northwestern China.

Science.gov (United States)

Chen, Yapeng; Chen, Yaning; Xu, Changchun; Li, Weihong

2016-09-01

Knowledge of the water sources used by desert trees and shrubs is critical for understanding how they function and respond to groundwater decline and predicting the influence of water table changes on riparian plants. In this paper, we test whether increased depth to groundwater changed the water uptake pattern of desert riparian species and whether competition for water resources between trees and shrubs became more intense with a groundwater depth gradient. The water sources used by plants were calculated using the IsoSource model, and the results suggested differences in water uptake patterns with varying groundwater depths. At the river bank (groundwater depth = 1.8 m), Populus euphratica and Tamarix ramosissima both used a mixture of river water, groundwater, and deeper soil water (>75 cm). When groundwater depth was 3.8 m, trees and shrubs both depended predominantly on soil water stored at 150-375 cm depth. When the groundwater depth was 7.2 m, plant species switched to predominantly use both groundwater and deeper soil water (>375 cm). However, differences in water acquisition patterns between species were not found. The proportional similarity index (PSI) of proportional contribution to water uptake of different water resources between P. euphratica and T. ramosissima was calculated, and results showed that there was intense water resource competition between P. euphratica and T. ramosissima when grown at shallow groundwater depth (not more than 3.8 m), and the competition weakened when the groundwater depth increased to 7.2 m.

Influence of brick air scrubber by-product on growth and development of corn and hybrid poplar.

Science.gov (United States)

Thomas, Carla N; Bauerle, William L; Owino, Tom O; Chastain, John P; Klaine, Stephen J

2007-03-01

Studies were conducted to determine the effects of spent reagent from air pollution control scrubbers used at a brick manufacturing facility on emergence, growth, and physiological responses of corn and hybrid poplar plants. Scrubber by-product was obtained from General Shale Brick, Louisville, KY. Potting substrate was weighed and quantities of scrubber by-product were added to the substrate to obtain treatments of 0%, 6.25%, 12.5%, 25%, 50%, 75%, and 100% scrubber by-product (w:w) for the corn study. Each treatment mix was potted into nine replicate polyethylene pots and four corn seeds were sown per pot. The pots were randomized in a greenhouse at Clemson University and the number of seedlings emerging from each treatment, dark-adapted leaf chlorophyll a fluorescence, and shoot heights were measured at the end of a 21-day growth period. Then, dry shoot biomass was determined for plants from each treatment and plant tissues were analyzed for selected constituents. For the poplar study, nine-inch cuttings of hybrid poplar clone 15-29 (Populus trichocarpa x P. deltoides) and clone OP367 (P. deltoides x P. nigra) were planted in treatments of scrubber by-product-potting soil mixes of 0% , 5% , 10% , and 25% w:w. Leaf chlorophyll a fluorescence was measured over six weeks and cumulative leaf area, dry biomass, and nutrient content of tissues were determined upon harvest. Results of these studies indicate that percent seedling emergence for corn plants decreased with increasing scrubber by-product application rates. Application rates up to 12.5% scrubber by-product w:w had no adverse effect on corn seedling emergence. Shoot elongation, biomass production, and the status of the photosynthetic apparatus of the seedlings were also not severely impaired at applications below this level. A critical value of 58.2% w:w scrubber by-product was estimated to cause 25% inhibition of seedling emergence. Biomass production, cumulative leaf area, and chlorophyll a fluorescence of

Annotation and comparative analysis of the glycoside hydrolase genes in Brachypodium distachyon

Directory of Open Access Journals (Sweden)

Wu Jiajie

2010-10-01

Full Text Available Abstract Background Glycoside hydrolases cleave the bond between a carbohydrate and another carbohydrate, a protein, lipid or other moiety. Genes encoding glycoside hydrolases are found in a wide range of organisms, from archea to animals, and are relatively abundant in plant genomes. In plants, these enzymes are involved in diverse processes, including starch metabolism, defense, and cell-wall remodeling. Glycoside hydrolase genes have been previously cataloged for Oryza sativa (rice, the model dicotyledonous plant Arabidopsis thaliana, and the fast-growing tree Populus trichocarpa (poplar. To improve our understanding of glycoside hydrolases in plants generally and in grasses specifically, we annotated the glycoside hydrolase genes in the grasses Brachypodium distachyon (an emerging monocotyledonous model and Sorghum bicolor (sorghum. We then compared the glycoside hydrolases across species, at the levels of the whole genome and individual glycoside hydrolase families. Results We identified 356 glycoside hydrolase genes in Brachypodium and 404 in sorghum. The corresponding proteins fell into the same 34 families that are represented in rice, Arabidopsis, and poplar, helping to define a glycoside hydrolase family profile which may be common to flowering plants. For several glycoside hydrolase familes (GH5, GH13, GH18, GH19, GH28, and GH51, we present a detailed literature review together with an examination of the family structures. This analysis of individual families revealed both similarities and distinctions between monocots and eudicots, as well as between species. Shared evolutionary histories appear to be modified by lineage-specific expansions or deletions. Within GH families, the Brachypodium and sorghum proteins generally cluster with those from other monocots. Conclusions This work provides the foundation for further comparative and functional analyses of plant glycoside hydrolases. Defining the Brachypodium glycoside hydrolases sets

Mortality gradients within and among dominant plant populations as barometers of ecosystem change during extreme drought.

Science.gov (United States)

Gitlin, Alicyn R; Sthultz, Christopher M; Bowker, Matthew A; Stumpf, Stacy; Paxton, Kristina L; Kennedy, Karla; Muñoz, Axhel; Bailey, Joseph K; Whitham, Thomas G

2006-10-01

Understanding patterns of plant population mortality during extreme weather events is important to conservation planners because the frequency of such events is expected to increase, creating the need to integrate climatic uncertainty into management. Dominant plants provide habitat and ecosystem structure, so changes in their distribution can be expected to have cascading effects on entire communities. Observing areas that respond quickly to climate fluctuations provides foresight into future ecological changes and will help prioritize conservation efforts. We investigated patterns of mortality in six dominant plant species during a drought in the southwestern United States. We quantified population mortality for each species across its regional distribution and tested hypotheses to identify ecological stress gradients for each species. Our results revealed three major patterns: (1) dominant species from diverse habitat types (i.e., riparian, chaparral, and low- to high-elevation forests) exhibited significant mortality, indicating that the effects of drought were widespread; (2) average mortality differed among dominant species (one-seed juniper[Juniperus monosperma (Engelm.) Sarg.] 3.3%; manzanita[Arctostaphylos pungens Kunth], 14.6%; quaking aspen[Populus tremuloides Michx.], 15.4%; ponderosa pine[Pinus ponderosa P. & C. Lawson], 15.9%; Fremont cottonwood[Populus fremontii S. Wats.], 20.7%; and pinyon pine[Pinus edulis Engelm.], 41.4%); (3) all dominant species showed localized patterns of very high mortality (24-100%) consistent with water stress gradients. Land managers should plan for climatic uncertainty by promoting tree recruitment in rare habitat types, alleviating unnatural levels of competition on dominant plants, and conserving sites across water stress gradients. High-stress sites, such as those we examined, have conservation value as barometers of change and because they may harbor genotypes that are adapted to climatic extremes.

Genomic research in Eucalyptus.

Science.gov (United States)

Poke, Fiona S; Vaillancourt, René E; Potts, Brad M; Reid, James B

2005-09-01

Eucalyptus L'Hérit. is a genus comprised of more than 700 species that is of vital importance ecologically to Australia and to the forestry industry world-wide, being grown in plantations for the production of solid wood products as well as pulp for paper. With the sequencing of the genomes of Arabidopsis thaliana and Oryza sativa and the recent completion of the first tree genome sequence, Populus trichocarpa, attention has turned to the current status of genomic research in Eucalyptus. For several eucalypt species, large segregating families have been established, high-resolution genetic maps constructed and large EST databases generated. Collaborative efforts have been initiated for the integration of diverse genomic projects and will provide the framework for future research including exploiting the sequence of the entire eucalypt genome which is currently being sequenced. This review summarises the current position of genomic research in Eucalyptus and discusses the direction of future research.

Functional analyses of PtRDM1 gene overexpression in poplars and evaluation of its effect on DNA methylation and response to salt stress.

Science.gov (United States)

Movahedi, Ali; Zhang, Jiaxin; Sun, Weibo; Mohammadi, Kourosh; Almasi Zadeh Yaghuti, Amir; Wei, Hui; Wu, Xiaolong; Yin, Tongming; Zhuge, Qiang

2018-06-01

Epigenetic modification by DNA methylation is necessary for all cellular processes, including genetic expression events, DNA repair, genomic imprinting and regulation of tissue development. It occurs almost exclusively at the C5 position of symmetric CpG and asymmetric CpHpG and CpHpH sites in genomic DNA. The RNA-directed DNA methylation (RDM1) gene is crucial for heterochromatin and DNA methylation. We overexpressed PtRDM1 gene from Populus trichocarpa to amplify transcripts of orthologous RDM1 in 'Nanlin895' (P. deltoides × P. euramericana 'Nanlin895'). This overexpression resulted in increasing RDM1 transcript levels: by ∼150% at 0 mM NaCl treatment and by ∼300% at 60 mM NaCl treatment compared to WT (control) poplars. Genomic cytosine methylation was monitored within 5.8S rDNA and histone H3 loci by bisulfite sequencing. In total, transgenic poplars revealed more DNA methylation than WT plants. In our results, roots revealed more methylated CG contexts than stems and leaves whereas, histone H3 presented more DNA methylation than 5.8S rDNA in both WT and transgenic poplars. The NaCl stresses enhanced more DNA methylation in transgenic poplars than WT plants through histone H3 and 5.8 rDNA loci. Also, the overexpression of PtRDM1 resulted in hyper-methylation, which affected plant phenotype. Transgenic poplars revealed significantly more regeneration of roots than WT poplars via NaCl treatments. Our results proved that RDM1 protein enhanced the DNA methylation by chromatin remodeling (e.g. histone H3) more than repetitive DNA sequences (e.g. 5.8S rDNA). Copyright © 2018 Elsevier Masson SAS. All rights reserved.

When do plants modify fluvial processes? Plant-hydraulic interactions under variable flow and sediment supply rates

Science.gov (United States)

Manners, Rebecca B.; Wilcox, Andrew C.; Kui, Li; Lightbody, Anne F.; Stella, John C.; Sklar, Leonard S.

2015-02-01

Flow and sediment regimes shape alluvial river channels; yet the influence of these abiotic drivers can be strongly mediated by biotic factors such as the size and density of riparian vegetation. We present results from an experiment designed to identify when plants control fluvial processes and to investigate the sensitivity of fluvial processes to changes in plant characteristics versus changes in flow rate or sediment supply. Live seedlings of two species with distinct morphologies, tamarisk (Tamarix spp.) and cottonwood (Populus fremontii), were placed in different configurations in a mobile sand-bed flume. We measured the hydraulic and sediment flux responses of the channel at different flow rates and sediment supply conditions representing equilibrium (sediment supply = transport rate) and deficit (sediment supply plant species and configuration. Species-specific traits controlled the hydraulic response: compared to cottonwood, which has a more tree-like morphology, the shrubby morphology of tamarisk resulted in less pronation and greater reductions in near-bed velocities, Reynolds stress, and sediment flux rates. Under sediment-deficit conditions, on the other hand, abiotic factors dampened the effect of variations in plant characteristics on the hydraulic response. We identified scenarios for which the highest stem-density patch, independent of abiotic factors, dominated the fluvial response. These results provide insight into how and when plants influence fluvial processes in natural systems.

Identification of Metabolic Routes and Catabolic Enzymes Involved in Phytoremediation of the Nitro-Substituted Explosives TNT, RDX, and HMX

Science.gov (United States)

2006-07-31

from various well-studied spermatophyte plants species (e.g., A. thaliana, Zea mays, Oryza sativa). The two P. trichocarpa housekeeping genes used as...Nitrate oxidoreductase from Aspergillus niger. Environ. Sci. Technol. 36, 3104-3108. Bhushan, B., Trott, S., Spain, J. C., Halasz, A., Pacquet, L

A single European aspen (Populus tremula) tree individual may potentially harbour dozens of Cenococcum geophilum ITS genotypes and hundreds of species of ectomycorrhizal fungi.

Science.gov (United States)

Bahram, Mohammad; Põlme, Sergei; Kõljalg, Urmas; Tedersoo, Leho

2011-02-01

Ectomycorrhizal fungi (EcMF) form diverse communities and link different host plants into mycorrhizal networks, yet little is known about the magnitude of mycobiont diversity of a single tree individual. This study addresses species richness and spatial structure of EcMF in the root system of a single European aspen (Populus tremula) individual in an old-growth boreal mixed forest ecosystem in Estonia. Combining morphological and molecular identification methods for both plant and fungi, 122 species of EcMF were recovered from 103 root samples of the single tree. Richness estimators predicted the total EcMF richness to range from 182 to 207 species, reflecting the observation of 62.3% singletons and doubletons within the community. Fine-scale genetic diversity in Cenococcum geophilum indicates the presence of 23 internal transcribed spacer genotypes. EcMF community was significantly spatially autocorrelated only at the lineage level up to 3 m distance, but not at the species level. Proximity of other hosts had a significant effect on the spatial distribution of EcMF lineages. This study demonstrates that a single tree may host as many EcMF species and individuals as recovered on multiple hosts in diverse communities over larger areas. © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

Significant differences in gene expression and key genetic components associated with high growth vigor in populus section tacamahaca as revealed by comparative transcriptome analysis

International Nuclear Information System (INIS)

Cheng, S.; Chen, M.; Li, Y.; Wang, J.; Sun, X.; Wang, J.

2017-01-01

To identify genetic components involved in high growth vigor in F1 Populus section Tacamahaca hybrid plants, high and low vigor plants showing significant differences in apical dominance during a rapid growth period were selected. Apical bud transcriptomes of high and low-growth-vigor hybrids and their parents were analyzed using high-throughput RNA sequencing on an Illumina HiSeq 2000 platform. A total of 5,542 genes were differently expressed between high growth vigor hybrid and its parents, the genes were significantly enriched in pathways related to processes such as photosynthesis, pyrimidine ribonucleotide biosynthetic processes and nucleoside metabolic processes. There were 1410 differentially expressed genes between high and low growth vigor hybrid, the genes were mainly involved in photosynthesis, chlorophyll biosynthetic process, carbon fixation in photosynthetic organisms, porphyrin and chlorophyll metabolism and nitrogen metabolism. Moreover, a k-core of a gene co-expression network analysis was performed to identify the potential functions of genes related to high growth vigor. The functions of 8 selected candidate genes were associated mainly with circadian rhythm, water transport, cellulose catabolic processes, sucrose biosynthesis, pyrimidine ribonucleotide biosynthesis, purine nucleotide biosynthesis, meristem maintenance, and carbohydrate metabolism. Our results may contribute to a better understanding of the molecular basis of high growth vigor in hybrids and its regulation. (author)

78 FR 9876 - Endangered and Threatened Wildlife and Plants; Endangered Status and Designation of Critical...

Science.gov (United States)

2013-02-12

... (Pinus flexilis); ponderosa pine (Pinus ponderosa); and aspen (Populus tremuloides); and (b) Has an... pine (Pinus flexilis); ponderosa pine (Pinus ponderosa); and aspen (Populus tremuloides); and (B) Has...

Flow regime effects on mature Populus fremontii (Fremont cottonwood) productivity on two contrasting dryland river floodplains

Science.gov (United States)

Andersen, Douglas C.

2016-01-01

I compared riparian cottonwood (Populus fremontii) productivity-discharge relationships in a relictual stand along the highly regulated Green River and in a naturally functioning stand along the unregulated Yampa River in semiarid northwest Colorado. I used multiple regression to model flow effects on annual basal area increment (BAI) from 1982 to 2011, after removing any autocorrelation present. Each BAI series was developed from 20 trees whose mean size (67 cm diameter at breast height [DBH]) was equivalent in the two stands. BAI was larger in the Yampa River stand except in 2 y when defoliating leaf beetles were present there. I found no evidence for a Yampa flood-magnitude threshold above which BAI declined. Flow variables explained ∼45% of residual BAI variability, with most explained by current-year maximum 90-d discharge (QM90) in the Yampa River stand and by a measure of the year-to-year change in QM90 in the Green River stand. The latter reflects a management-imposed ceiling on flood magnitude—Flaming Gorge Dam power plant capacity—infrequently exceeded during the study period. BAI in the relictual stand began to trend upward in 1992 when flows started to mimic a natural flow regime. Mature Fremont cottonwoods appear to be ecologically resilient. Their productivity along regulated rivers might be optimized using multiyear environmental flow designs.

Begin at the beginning: A BAC-end view of the passion fruit (Passiflora) genome.

Science.gov (United States)

Santos, Anselmo Azevedo; Penha, Helen Alves; Bellec, Arnaud; Munhoz, Carla de Freitas; Pedrosa-Harand, Andrea; Bergès, Hélène; Vieira, Maria Lucia Carneiro

2014-09-26

The passion fruit (Passiflora edulis) is a tropical crop of economic importance both for juice production and consumption as fresh fruit. The juice is also used in concentrate blends that are consumed worldwide. However, very little is known about the genome of the species. Therefore, improving our understanding of passion fruit genomics is essential and to some degree a pre-requisite if its genetic resources are to be used more efficiently. In this study, we have constructed a large-insert BAC library and provided the first view on the structure and content of the passion fruit genome, using BAC-end sequence (BES) data as a major resource. The library consisted of 82,944 clones and its levels of organellar DNA were very low. The library represents six haploid genome equivalents, and the average insert size was 108 kb. To check its utility for gene isolation, successful macroarray screening experiments were carried out with probes complementary to eight Passiflora gene sequences available in public databases. BACs harbouring those genes were used in fluorescent in situ hybridizations and unique signals were detected for four BACs in three chromosomes (n=9). Then, we explored 10,000 BES and we identified reads likely to contain repetitive mobile elements (19.6% of all BES), simple sequence repeats and putative proteins, and to estimate the GC content (~42%) of the reads. Around 9.6% of all BES were found to have high levels of similarity to plant genes and ontological terms were assigned to more than half of the sequences analysed (940). The vast majority of the top-hits made by our sequences were to Populus trichocarpa (24.8% of the total occurrences), Theobroma cacao (21.6%), Ricinus communis (14.3%), Vitis vinifera (6.5%) and Prunus persica (3.8%). We generated the first large-insert library for a member of Passifloraceae. This BAC library provides a new resource for genetic and genomic studies, as well as it represents a valuable tool for future whole genome

Expression and molecular evolution of two DREB1 genes in black poplar (Populus nigra.

Directory of Open Access Journals (Sweden)

Yanguang Chu

Full Text Available Environmental stresses such as low temperature, drought, and high salinity significantly affect plant growth and yield. As selective forces, these adverse factors play essential roles in shaping phenotypic variation in plant populations. Black poplar (Populus nigra is an economically and ecologically important forest tree species with widely distributed populations and is thus suitable for experiments detecting evolutionary footprints left by stress. Here, we performed expression and evolutionary analysis of two duplicated DREB A1-subgroup (DREB1 genes, PnDREB68 and PnDREB69, encoding transcription factors that are involved in stress responses. The two genes showed partially overlapping but distinct expression patterns in response to stresses. These genes were strongly and rapidly induced by cold stress in leaves, stems, and roots. In leaf tissue, dehydration stress induced the expression of PnDREB68 but not PnDREB69. PnDREB69 displayed more rapid responses and longer expression durations than PnDREB68 under salt and ABA stress, respectively. Based on single nucleotide polymorphism (SNP analysis, we found significant population genetic differentiation, with a greater FST value (0.09189 for PnDREB69 than for PnDREB68 (0.07743. Nucleotide diversity analysis revealed a two-fold higher πT for PnDREB68 than for PnDREB69 (0.00563 vs. 0.00243, reflecting strong purifying selection acting on the former. The results suggest that positive selection acted on PnDREB69, as evidenced by neutral testing using Tajima's D statistic. The distinct selective forces to which each of the genes was subjected may be associated with expression divergence. Linkage disequilibrium (LD was low for the sequenced region, with a higher level for PnDREB68 than for PnDREB69. Additionally, analysis of the relationship among carbon isotope ratios, SNP classes and gene expression, together with motif and domain analysis, suggested that 14 polymorphisms within the two genes may be

A study of polymerization of aspen (Populus) wood lipophilic extractives by SEC and Py-GC/MS

CSIR Research Space (South Africa)

Sithole, Bruce

2013-03-01

Full Text Available ) Orig inal manuscript received 13 June 2012, revision accepted 31 October 2012 Vol 66 No 1 January - March 2013 1 PEER REVIEWED A study of polymerization of aspen (Populus) wood lipophilic extractives by SEC and Py-GC/MS BRUCE SITHOLE1*, LUC... of polymerized wood resin that will be difficult to remove if present in pulp and paper products. On the other hand, these problems may be minor compared to using unseasoned wood. KEYWORDS: Aspen, extractives, polymerization, size exclusion chromatography, Py...

Determination of Fe, Hg, Mn, and Pb in three-rings of poplar (Populus alba L.) by U-shaped DC arc

Science.gov (United States)

Marković, D. M.; Novović, I.; Vilotić, D.; Ignjatović, Lj.

2007-09-01

The U-shaped DC arc with aerosol supply was applied for the determination of Fe, Hg, Mn, and Pb in poplar (Populus alba L.) tree-rings. By optimization of the operating parameters and by selection of the most appropriate signal integration time (20 s for Fe, Mn, and Pb and 30 s for Hg), the obtained limits of detection for Fe, Hg, Mn, and Pb are 5.8, 2.6, 1.6, and 2.0 ng/ml, respectively. The detection limits achieved by this method for Fe, Hg, Mn, and Pb are comparable with the detection limits obtained for these elements by such methods as inductively coupled plasma-atomic emission spectrometry (ICP-AES), direct coupled plasmatomic emission spectrometry (DCP-AES), and microwave-induced plasma-atomic emission spectrometry (MIP-AES). We used the tree-rings of poplar from two different locations. The first one is in the area close to the power plant “Nikola Tesla” TENT A, Obrenovac, while the other one is in the urban area of Novi Sad. In almost all cases, samples from the location at Obrenovac registered elevated average concentrations of Fe, Hg, Mn, and Pb in the tree-rings of poplar.

Avoiding transport bottlenecks in an expanding root system: xylem vessel development in fibrous and pioneer roots under field conditions.

Science.gov (United States)

Bagniewska-Zadworna, Agnieszka; Byczyk, Julia; Eissenstat, David M; Oleksyn, Jacek; Zadworny, Marcin

2012-09-01

Root systems develop to effectively absorb water and nutrients and to rapidly transport these materials to the transpiring shoot. In woody plants, roots can be born with different functions: fibrous roots are primarily used for water and nutrient absorption, whereas pioneer roots have a greater role in transport. Because pioneer roots extend rapidly in the soil and typically quickly produce fibrous roots, they need to develop transport capacity rapidly so as to avoid becoming a bottleneck to the absorbed water of the developing fibrous roots and, as we hypothesized, immediately activate a specific type of autophagy at a precise time of their development. Using microscopy techniques, we monitored xylem development in Populus trichocarpa roots in the first 7 d after emergence under field conditions. Newly formed pioneer roots contained more primary xylem poles and had larger diameter tracheary elements than fibrous roots. While xylogenesis started later in pioneer roots than in fibrous, it was completed at the same time, resulting in functional vessels on the third to fourth day following root emergence. Programmed cell death was responsible for creating the water conducting capacity of xylem. Although the early xylogenesis processes were similar in fibrous and pioneer roots, secondary vascular development proceeded much more rapidly in pioneer roots. Compared to fibrous roots, rapid development of transport capacity in pioneer roots is not primarily caused by accelerated xylogenesis but by larger and more numerous tracheary elements and by rapid initiation of secondary growth.

Overexpression of Pyrabactin Resistance-Like Abscisic Acid Receptors Enhances Drought, Osmotic, and Cold Tolerance in Transgenic Poplars

Directory of Open Access Journals (Sweden)

Jingling Yu

2017-10-01

Full Text Available Abscisic acid (ABA has been known participate in a wider range of adaptive responses to diverse environmental abiotic stresses such as drought, osmosis, and low temperatures. ABA signaling is initiated by its receptors PYR/PYL/RCARs, a type of soluble proteins with a conserved START domain which can bind ABA and trigger the downstream pathway. Previously, we discovered that poplar (Populus trichocarpa genome encodes 14 PYR/PYL/RCAR orthologs (PtPYRLs, and two of them, PtPYRL1 and PtPYRL5 have been functionally characterized to positively regulate drought tolerance. However, the physiological function of these ABA receptors in poplar remains uncharacterized. Here, we generated transgenic poplar plants overexpressing PtPYRL1 and PtPYRL5 and found that they exhibited more vigorous growth and produced greater biomass when exposed to drought stress. The improved drought tolerance was positively correlated with the key physiological responses dictated by the ABA signaling pathway, including increase in stomatal closure and decrease in leaf water loss. Further analyses revealed that overexpression lines showed improved capacity in scavenging reactive oxygen species and enhanced the activation of antioxidant enzymes under drought stress. Moreover, overexpression of PtPYRL1 or PtPYRL5 significantly increased the poplar resistance to osmotic and cold stresses. In summary, our results suggest that constitutive expression of PtPYRL1 and PtPYRL5 significantly enhances the resistance to drought, osmotic and cold stresses by positively regulating ABA signaling in poplar.

Molecular Characterization of Ferulate 5-Hydroxylase Gene from Kenaf (Hibiscus cannabinus L.

Directory of Open Access Journals (Sweden)

Jonggeun Kim

2013-01-01

Full Text Available The purpose of this study is to clone and characterize the expression pattern of a F5H gene encoding ferulate 5-hydroxylase in the phenylpropanoid pathway from kenaf (Hibiscus cannabinus L.. Kenaf is a fast-growing dicotyledonous plant valued for its biomass. F5H, a cytochrome P450-dependent monooxygenase (CYP84, is a key enzyme for syringyl lignin biosynthesis. The full length of the F5H ortholog was cloned and characterized. The full-length F5H ortholog consists of a 1,557-bp open reading frame (ORF encoding 518 amino acids (GenBank Accession number JX524278. The deduced amino acid sequence showed that kenaf F5H had the highest similarity (78% with that of Populus trichocarpa. Transcriptional analysis of F5H ortholog was conducted using quantitative real-time PCR during the developmental stages of various tissues and in response to various abiotic stresses. The highest transcript level of the F5H ortholog was observed in immature flower tissues and in early stage (6 week-old of stem tissues, with a certain level of expression in all tissues tested. The highest transcript level of F5H ortholog was observed at the late time points after treatments with NaCl (48 h, wounding (24 h, cold (24 h, abscisic acid (24 h, and methyl jasmonate (24 h.

Genetic, morphological, and spectral characterization of relictual Niobrara River hybrid aspens (Populus × smithii).

Science.gov (United States)

Deacon, Nicholas John; Grossman, Jake Joseph; Schweiger, Anna Katharina; Armour, Isabella; Cavender-Bares, Jeannine

2017-12-01

Aspen groves along the Niobrara River in Nebraska have long been a biogeographic curiosity due to morphological differences from nearby remnant Populus tremuloides populations. Pleistocene hybridization between P. tremuloides and P. grandidentata has been proposed, but the nearest P. grandidentata populations are currently several hundred kilometers east. We tested the hybrid-origin hypothesis using genetic data and characterized putative hybrids phenotypically. We compared nuclear microsatellite loci and chloroplast sequences of Niobrara River aspens to their putative parental species. Parental species and putative hybrids were also grown in a common garden for phenotypic comparison. On the common garden plants, we measured leaf morphological traits and leaf-level spectral reflectance profiles, from which chemical traits were derived. The genetic composition of the three unique Niobrara aspen genotypes is consistent with the hybridization hypothesis and with maternal chloroplast inheritance from P. grandidentata . Leaf margin dentition and abaxial pubescence differentiated taxa, with the hybrids showing intermediate values. Spectral profiles allowed statistical separation of taxa in short-wave infrared wavelengths, with hybrids showing intermediate values, indicating that traits associated with internal structure of leaves and water absorption may vary among taxa. However, reflectance values in the visible region did not differentiate taxa, indicating that traits related to pigments are not differentiated. Both genetic and phenotypic results support the hypothesis of a hybrid origin for these genetically unique aspens. However, low genetic diversity and ongoing ecological and climatic threats to the hybrid taxon present a challenge for conservation of these relictual boreal communities. © 2017 Botanical Society of America.

Nitrogen nutrient status induces sexual differences in responses to cadmium in Populus yunnanensis.

Science.gov (United States)

Chen, Lianghua; Han, Ying; Jiang, Hao; Korpelainen, Helena; Li, Chunyang

2011-10-01

Populus yunnanensis was employed as a model species to detect sexual differences in growth, physiological, biochemical, and ultrastructural responses to cadmium (Cd) stress, nitrogen (N) deposition, and their combination. Compared with the control conditions, Cd decreased plant biomass, damaged the photosynthetic apparatus, visible as a decreased maximum efficiency of photosystem II (PSII; F(v)/F(m)) and effective quantum yield of PSII (Yield), depressed gas exchange capacity, and induced oxidative stress, visible as the disruption of antioxidative enzymes and accumulation of reactive oxygen species (ROS), in both sexes. On the other hand, Cd toxicity was mitigated by the recovery of gas exchange capacity, a decrease in ROS, and improvement of the redox imbalance in both sexes when N deposition was applied. However, males showed a higher gas exchange capacity, lower enzyme inhibition and ROS accumulation, stronger abilities to maintain cellular redox homeostasis, and a better maintenance of chloroplast ultrastructure than did females when exposed to Cd stress alone. Although males exhibited a higher Cd content in leaves than did females, males also accumulated higher levels of non-protein thiols (NP-SHs) and free amino acids (FAAs) for detoxification than did females. Sexual differences induced by Cd, visible, for example, in F(v)/F(m), Yield, net photosynthesis rate (A), and stomatal conductance (g(s)), decreased under N deposition, as no significant differences between the sexes existed in these parameters under the combined treatment. The results indicated that females are more sensitive to Cd stress and suffer more injuries than do males. Moreover, N deposition can mitigate Cd toxicity and decrease sexual differences in Cd sensitivity.

The use of the white poplar (Populus alba L.) biomass as fuel

Institute of Scientific and Technical Information of China (English)

Tatiana Griu; Aurel Lunguleasa

2016-01-01

We determined the calorific value of white poplar (Populus alba L.) woody biomass to use it as fire-wood. The value of 19.133 MJ kg-1 obtained experimen-tally shows that the white poplar can be quite successfully used as firewood. Being of a lower quality in comparison with usual beech firewood, the white poplar has similar calorific value. The white poplar has a calorific density of 30.7%lower than that of current firewood. That is why the price of this firewood from white poplar is lower accord-ingly. Also, the prognosis of calorific value on the basis of the main chemical elements, being very close to the experimental value (?2.6%), indicates an appropriate value can be achieved to be used for investigation with the chemical element analysis.

Investigation of seedlings growth and development of some trees and shrubs grown on energetic ashes of two types. [Acer negundo; Fraxinus pennsylvanica; Populus alba; Myricaria germanica

Energy Technology Data Exchange (ETDEWEB)

Kluczynski, B

1973-01-01

Pot experiments concerning the degree of resistance, of chosen species of trees and shrubs to unfavorable physical and chemical properties of energetic ashes, obtained from burning brown (K) and pit (O) coal, were carried out. Seeds were sown out in prepared substrates, in 8 combinations. The investigation consisted of two parts. Seeds of 11 species of trees and shrubs and 1 herb plant were used in the first part. Seeds of 6 species of trees and shrubs were used in the second part. All the environmental variants were investigated in 4 replications (replication = pot). Each species was evaluated according to several features determining its usefulness on various substrates. These features were divided into two groups, characterizing seedlings survival (feature group ..cap alpha..) and health conditions and general vitality (feature group ..beta..). The obtained results indicate a need of examining the usefulness for dump recultivation in field conditions of Acer negundo, Fraxinus pennsylvanica, Populus alba and probably Myricaria germanica. 8 references, 17 tables.

Effect of plants on the bioavailability of metals and other chemical properties of biosolids in a column study.

Science.gov (United States)

Huynh, Trang T; Laidlaw, W Scott; Singh, Balwant; Zhang, Hao; Baker, Alan J M

2012-10-01

The effects of metal-accumulating plants (Salix x reichardtii and Populus balsamifera) on the chemical properties and dynamics of metals in biosolids were investigated using different techniques including diffusive gradients in thin films (DGT), sequential extraction procedures and partitioning coefficient (K(d)). Plants could effectively extract Cd, Ni, and Zn and decreased dissolved organic carbon (DOC). The presence of plants increased the potential bioavailability of these metals, as assessed by an increase in the ratio of metal measured by DGT and metals in the solution. The plants affected the Cd, Ni, and Zn pools (soluble/exchangeable; Fe/Mn oxide and organic matter bound) characterised by sequential extraction and K(d) but did not reduce the total metals in either substrate. However, plants had no effect on Cu, presumably because of the effective buffering of available Cu by organic matter in both solution and solid phases. A high density of plant roots was associated with increased leaching of metals.

Variation of leaf margin serration in Populus nigra of industrial dumps

Directory of Open Access Journals (Sweden)

Yu. A. Shtirs

2017-07-01

Full Text Available The variability of leaf margin serration of Populus nigra L. in conditions of industrial dumps (coal mines dumps and overburden dumps and city park is estimated. The value of this indicator is in the range from 1.25 to 1.76 and significantly increases along the gradient: coal mines dumps – overburden dumps – city park. From the number of selected gradations of P. nigra leaf blades, the gradation with values of 1.45-1.55 is most pronounced according to the analyzed index for industrial dumps, for the park – with the values of 1.55-1.65. The degree of serration of edge leaf blade is characterized by low values of variation – coefficient of variation is less than 10.0%. We registered the significant positive correlation between the average values of leaf margin serration and the length of P. nigra leaf blade.

Natural hybridization between Populus nigra L. and P. x canadensis Moench. Hybrid offspring competes for niches along the Rhine river in the Netherlands

NARCIS (Netherlands)

Smulders, M.J.M.; Beringen, R.; Volosyanchuk, R.; Vanden Broeck, A.; Schoot, van der J.; Arens, P.F.P.; Vosman, B.

2008-01-01

Black poplar (Populus nigra L.) is a major species for European riparian forests but its abundance has decreased over the decades due to human influences. For restoration of floodplain woodlands, the remaining black poplar stands may act as source population. A potential problem is that P. nigra and

Gaseous NO2 effects on stomatal behavior, photosynthesis and respiration of hybrid poplar leaves

Science.gov (United States)

In this study, we used poplar as a model plant and investigated the effects of gaseous nitrogen dioxide (NO2, 4 microliter per liter) on stomatal conductance, photosynthesis, dark- and photorespiration of Populus alba x Populus berolinensis hybrid leaves using the photosynthesis system and scanning...

Phytoextraction of risk elements by willow and poplar trees.

Science.gov (United States)

Kacálková, Lada; Tlustoš, Pavel; Száková, Jiřina

2015-01-01

To characterize the phytoextraction efficiency of two clones of willow trees (Salix x smithiana Willd., Salix rubens) and two clones of poplar trees (Populus nigra x maximowiczii, Populus nigra Wolterson) were planted in contaminated soil (0.4-2.0 mg Cd.kg(-1), 78-313 mg Zn.kg(-1), 21.3-118 mg Cu.kg(-1)). Field experiment was carried out in Czech Republic. The study investigated their ability to accumulate heavy metals (Cd, Zn, and Cu) in harvestable plant parts. The poplars produced higher amount of biomass than willows. Both Salix clones accumulated higher amount of Cd, Zn and Cu in their biomass (maximum 6.8 mg Cd.kg(-1), 909 mg Zn.kg(-1), and 17.7 mg Cu.kg(-1)) compared to Populus clones (maximum 2.06 mg Cd.kg(-1), 463 mg Zn.kg(-1), and 11.8 mg Cu.kg(-1)). There were no significant differences between clones of individual species. BCs for Cd and Zn were greater than 1 (the highest in willow leaves). BCs values of Cu were very low. These results indicate that Salix is more suitable plant for phytoextraction of Cd and Zn than Populus. The Cu phytoextraction potential of Salix and Populus trees was not confirmed in this experiment due to low soil availability of this element.

Enhanced salt tolerance of transgenic poplar plants expressing a manganese superoxide dismutase from Tamarix androssowii.

Science.gov (United States)

Wang, Yu Cheng; Qu, Guan Zheng; Li, Hong Yan; Wu, Ying Jie; Wang, Chao; Liu, Gui Feng; Yang, Chuan Ping

2010-02-01

Superoxide dismutases (SODs) play important role in stress tolerance of plants. In this study, an MnSOD gene (TaMnSOD) from Tamarix androssowii, under the control of the CaMV35S promoter, was introduced into poplar (Populus davidiana x P. bolleana). The physiological parameters, including SOD activity, malondialdehyde (MDA) content, relative electrical conductivity (REC) and relative weight gain, of transgenic lines and wild type (WT) plants, were measured and compared. The results showed that SOD activity was enhanced in transgenic plants, and the MDA content and REC were significantly decreased compared to WT plants when exposed to NaCl stress. In addition, the relative weight gains of the transgenic plants were 8- to 23-fold of those observed for WT plants after NaCl stress for 30 days. The data showed that the SOD activities that increased in transgenic lines are 1.3-4-folds of that increased in the WT plant when exposed to NaCl stress. Our analysis showed that increases in SOD activities as low as 0.15-fold can also significantly enhance salt tolerance in transgenic plants, suggesting an important role of increased SOD activity in plant salt tolerance

Gas exchange, dry weights, and chlorophyll contents of Populus tremuloides seedlings grown from gamma-irradiated seeds

International Nuclear Information System (INIS)

Salmonson, B.J.; Zavitkovski, J.

1977-01-01

Photosynthesis and respiration rates of Populus tremuloides seedlings grown from seeds acutely irradiated with gamma rays (at levels of 0, 0.47, 0.94, 1.8, 3.7, 7.5, and 15 kr) were measured using a closed system and infrared (IR) gas analyzer. Dry weights of seedling roots and shoots and chlorophyll contents were also determined. In general, gamma irradiation of seed had little effect on subsequent gas-exchange processes in the plant. Net photosynthesis and dark respiration rates of the seedling at any radiation level were not significantly different from those of the control group. Pooled net photosynthesis of all irradiated seedlings was nonsignificantly lower than that of the control seedlings. The data suggested a slight stimulation in dry-matter production of shoots by low levels of gamma radiation. At the highest levels of radiation, shoot dry weight was significantly reduced. Root production displayed a pattern similar to that of shoots. No trends different from controls were evident in the shoot/root ratios. Total chlorophyll concentrations of the seedling increased over the controls by radiation treatment. Age and radiation effects were evident in the chlorophyll a/b ratios. The chlorophyll a/b ratios decreased with age in both the control and treatment groups. Although in seedlings 39 through 46 days old chlorophyll a/b ratios were higher in the control, chlorophyll a/b ratios were significantly higher in the treatment seedlings at 68 days. Changes in chlorophyll a were primarily responsible for this change

Stem wood properties of Populus tremuloides, Betula papyrifera and Acer saccharum saplings after three years of treatments to elevated carbon dioxide and ozone

Science.gov (United States)

Seija Kaakinen; Katri Kostiainen; Fredrik Ek; Pekka Saranpaa; Mark E. Kubiske; Jaak Sober; David F. Karnosky; Elina Vapaavuori

2004-01-01

The aim of this study was to examine the effects of elevated carbon dioxide [CO2] and ozone [O3] and their interaction on wood chemistry and anatomy of five clones of 3-year-old trembling aspen (Populus tremuloides Michx.). Wood chemistry was studied also on paper birch (Betula papyrifera...

Structure and diversity of ground mesofauna inUlmus and Populus consortia in the industrial areas of mining and smelting complex of krivyi rig basin

Directory of Open Access Journals (Sweden)

V. V. Kachinskaya

2010-05-01

Full Text Available The structure and biological diversity of ground mesofauna on a consortium level of organisation of ecosystems are considered. Indicators of structural organisation and biodiversity of ground mesofauna were analised in Ulmus and Populus consortia in the conditions of industrial territories of mining and smelting complex of Krivyi Rig Basin. It is established that taxonomical structure of ground mesofauna is characterised by insignificant number and quantity of taxonomical groups. Prevalence of hortobionts and herpetobionts in morpho-ecological structure of the community testifies to their attachment to consortium’s determinants and influence of steppe climate on its structure. Dominance of phytophages and polyphages in trophic structure is caused by a combination of consortium determinants specificity and «a zone source» of the fauna formations. The structural organisation of ground mesofauna in consortia of Ulmus and Populus in the conditions of industrial sites is characterised by simplified taxonomical structure with low biodiversity at all levels.

Significance of stigma receptivity in intergeneric cross-pollination of Salix × Populus

Directory of Open Access Journals (Sweden)

Elżbieta Zenkteler

2016-09-01

Full Text Available The pollen–stigma interaction plays an important role in reproductive process and has been continuously studied in many interspecific and intergeneric crossing experiments. The aim of this study was to investigate stigma receptivity (SR of willow in order to determine the most suitable period for its pollination with poplar pollen and improve the effectiveness of Salix × Populus crosses. Tissue samples were examined histologically using light, epifluorescent, scanning, and transmission electron microscopy. Willow SR was determined by stigma morphological traits, test of pollen germination rate, Peroxtesmo test of peroxidase and esterase activity on stigma surface as well as papilla ultrastructure at anthesis. We have ascertained that the SR duration in willow is short, lasting from 1 to 2 DA. The poplar pollen germination rate on willow stigmas on 1 DA ranged from 26.3 to 11.2%.

Climate, migration, and the local food security context: Introducing Terra Populus

Science.gov (United States)

Schlak, Allison M.; Kugler, Tracy A.

2016-01-01

Studies investigating the connection between environmental factors and migration are difficult to execute because they require the integration of microdata and spatial information. In this article, we introduce the novel, publically available data extraction system Terra Populus (TerraPop), which was designed to facilitate population-environment studies. We showcase the use of TerraPop by exploring variations in the climate-migration association in Burkina Faso and Senegal based on differences in the local food security context. Food security was approximated using anthropometric indicators of child stunting and wasting derived from Demographic and Health Surveys (DHS) and linked to the TerraPop extract of climate and migration information. We find that an increase in heat waves was associated with a decrease in international migration from Burkina Faso, while excessive precipitation increased international moves from Senegal. Significant interactions reveal that the adverse effects of heat waves and droughts are strongly amplified in highly food insecure Senegalese departments. PMID:27974863

Identification of proteins from cambium tissues of the chinese white poplar (populus tomentosa) sampled during the growing season

International Nuclear Information System (INIS)

Xie, J.; Liu, S.; Qi, Q.; Hou, Y.

2014-01-01

Various protein extraction methods have been used to investigate Chinese white poplar (Populus tomentosa) proteomics. However, extracting and characterizing proteins from woody plants remains a challenge. Two-dimensional gel electrophoresis is a powerful, widely used method for the analysis of complex protein mixtures extracted from biological samples. The technique separates mixtures of proteins along two dimensions, by isoelectric point and molecular weight, and can resolve thousands of different proteins. Here, we report a new application of two-dimensional gel electrophoresis to investigate the proteomics of P. tomentosa cambium tissues over the course of a growing season. Of three protein extraction methods that we compared (the Tris-phenol method, trichloroacetic acid-acetone method, and trichloroacetic acid-acetone-phenol method), trichloroacetic acid-acetone was the most efficient approach for protein extraction from cambium tissues of P. tomentosa. After extraction, the proteins were separated using two-dimensional gel electrophoresis. The protein quantities of six spots changed over the course of the growing season from February to July. Five spots were identified using matrix-assisted laser desorption/ionization time-of-flight/time-of-flight mass spectrometry, and the sixth spot was identified by liquid chromatography-mass spectrometry. The proteins included enolase, class Ia chitinase, and four unnamed proteins. Our results show the best approach to proteomics in P. tomentosa and reveal trends in protein activities during a growing season in this tree species. (author)

Analysis of a Farquhar-von Caemmerer-Berry leaf-level photosynthetic rate model for Populus tremuloides in the context of modeling and measurement limitations

Science.gov (United States)

K.E. Lenz; G.E. Host; K. Roskoski; A. Noormets; A. Sober; D.F. Karnosky

2010-01-01

The balance of mechanistic detail with mathematical simplicity contributes to the broad use of the Farquhar, von Caemmerer and Berry (FvCB) photosynthetic rate model. Here the FvCB model was coupled with a stomatal conductance model to form an [A,gs] model, and parameterized for mature Populus tremuloides leaves under varying CO2...

Analysis of a Farquhar-von Caemmerer-Berry leaf-level photosynthetic rate model for Populus tremuloides in the context of modeling and measurement limitations

International Nuclear Information System (INIS)

Lenz, Kathryn E.; Host, George E.; Roskoski, Kyle; Noormets, Asko; Sober, Anu; Karnosky, David F.

2010-01-01

The balance of mechanistic detail with mathematical simplicity contributes to the broad use of the Farquhar, von Caemmerer and Berry (FvCB) photosynthetic rate model. Here the FvCB model was coupled with a stomatal conductance model to form an [A,g s ] model, and parameterized for mature Populus tremuloides leaves under varying CO 2 and temperature levels. Data were selected to be within typical forest light, CO 2 and temperature ranges, reducing artifacts associated with data collected at extreme values. The error between model-predicted photosynthetic rate (A) and A data was measured in three ways and found to be up to three times greater for each of two independent data sets than for a base-line evaluation using parameterization data. The evaluation methods used here apply to comparisons of model validation results among data sets varying in number and distribution of data, as well as to performance comparisons of [A,g s ] models differing in internal-process components. - A photosynthetic rate model is parameterized for Populus tremuloides and evaluated based on its ability to predict dependent as well as independent data.

Genetic improvement and evaluation of black cottonwood for short- rotation biomass production. Final report, 1987--1992

Energy Technology Data Exchange (ETDEWEB)

Stettler, R.F.; Hinckley, T.M. [Washington Univ., Seattle, WA (United States). Coll. of Forest Resources; Heilman, P.E. [Washington State Univ., Puyallup, WA (United States). Research and Extension Center; Bradshaw, H.D. Jr. [Washington Univ., Seattle, WA (United States). Dept. of Biochemistry

1993-04-30

This project was initiated in 1978 to serve three objectives: (1) develop genetically improved poplar cultivars offering increased productivity under short-rotation culture; (2) identify the major components of productivity in poplar and determine ways in which they can be manipulated, genetically and culturally; and (3) engage in technology transfer to regional industry and agencies so as to make poplar culture in the Pacific Northwest economically feasible. The project is aimed at capturing natural variation in the native black cottonwood. Populus trichocarpa T & G, and enhancing it through selective breeding. Major emphasis has been placed on hybridization of black cottonwood with P deltoides and P maximowiczii, more recently with p nigra. First-generation (F{sub 1}) hybrids have consistently outperformed black cottonwood by a factor of 1.5.-2. The high yields of woody biomass obtained from these clonally propagated hybrids, in rotations of 4-7 years, have fostered the establishment of large-scale plantations by the pulp and paper industry in the region. Physiological studies have helped to elucidate hybrid superiority and several of the underlying mechanisms.

Thaumatin-like proteins are differentially expressed and localized in phloem tissues of hybrid poplar

Directory of Open Access Journals (Sweden)

Dafoe Nicole J

2010-08-01

Full Text Available Abstract Background Two thaumatin-like proteins (TLPs were previously identified in phloem exudate of hybrid poplar (Populus trichocarpa × P. deltoides using proteomics methods, and their sieve element localization confirmed by immunofluorescence. In the current study, we analyzed different tissues to further understand TLP expression and localization in poplar, and used immunogold labelling to determine intracellular localization. Results Immunofluorescence using a TLP antiserum confirmed the presence of TLP in punctate, organelle-like structures within sieve elements. On western blots, the antiserum labeled two constitutively expressed proteins with distinct expression patterns. Immunogold labelling suggested that TLPs are associated with starch granules and starch-containing plastids in sieve elements and phloem parenchyma cells. In addition, the antiserum recognized TLPs in the inner cell wall and sieve plate region of sieve elements. Conclusions TLP localization in poplar cells and tissues is complex. TLP1 is expressed predominantly in tissues with a prominent vascular system such as midveins, petioles and stems, whereas the second TLP is primarily expressed in starch-storing plastids found in young leaves and the shoot apex.

Effects of two iron sources on iron and cadmium allocation in poplar (populus alba) plants exposed to cadmium

Energy Technology Data Exchange (ETDEWEB)

Fodor, F.; Gaspar, L.; Cseh, E.; Sarvari, E. [Eotvos Univ., Budapest (Hungary). Dept. of Plant Physiology; Morales, F.; Gogorcena, Y.; Abadia, J. [Consejo Superior de Investigaciones Cientificas, Zaragoza (Spain). Dept. de Nutricion Vegetal; Lucena, J.J. [Madrid Univ., Madrid (Spain). Dept. de Quimica Agricola; Kropfl, K. [Eotvos Univ., Budapest (Hungary). Dept. of Technology and Environmental Chemistry

2005-09-01

The phytotoxicity of heavy metals is often manifested as inhibition of plant growth, nitrate assimilation and photosynthesis, as well as disturbances in plant ion and water balances. Many of these plant responses are a result of inhibition of enzyme activity caused by the binding of heavy metal ions to sulfhydryl groups in the active sites of enzymes and by substitution of essential metals. This study investigated the effects of cadmium (Cd) nitrate on the utilization and allocation of iron (Fe) in poplar plants grown in a nutrient solution with Fe(III)-EDTA or Fe(III)-citrate as the Fe source. The effects of Cd were also compared with those of Fe deprivation. Results indicated that the accumulation of Fe in roots was 10-fold higher in plants grown with Fe-citrate than with Fe-ETDA. In addition, cadmium increased leaf chlorophyll concentrations and photosynthetic rates, and these decreases were more marked in plants grown with Fe-citrate than with Fe-EDTA. In both treatments, addition of Cd caused large increases in root and shoot apoplasmic and non-apoplasmic Cd contents and increases in root Fe content. However, Cd decreased shoot Fe content, especially in plants grown with Fe-citrate. New leaves of plants grown with Fe-citrate had small cellular Fe pools, whereas these pools were large in new leaves of plants grown with Fe-EDTA. Non-apoplasmic Cd pools in new leaves were smaller in plants grown with Fe-citrate than with Fe-EDTA, which indicated that inactivation of non-apoplasmic Cd pools is facilitated more by Fe-EDTA than by Fe-citrate. In the presence of Cd, Fe-EDTA was also superior to Fe-citrate in maintaining an adequate Fe supply to poplar shoots. It was concluded that because the amount of non-apoplasmic root Fe was higher in plants grown with Fe-citrate than with Fe-EDTA, the observed differences in plant responses to Fe-EDTA and Fe-citrate may reflect distances in long-distance transport of Fe rather than its acquisition of Fe by roots. 42 refs., 6

Xylem anatomy correlates with gas exchange, water-use efficiency and growth performance under contrasting water regimes: evidence from Populus deltoides x Populus nigra hybrids.

Science.gov (United States)

Fichot, Régis; Laurans, Françoise; Monclus, Romain; Moreau, Alain; Pilate, Gilles; Brignolas, Franck

2009-12-01

Six Populus deltoides Bartr. ex Marsh. x P. nigra L. genotypes were selected to investigate whether stem xylem anatomy correlated with gas exchange rates, water-use efficiency (WUE) and growth performance. Clonal copies of the genotypes were grown in a two-plot common garden test under contrasting water regimes, with one plot maintained irrigated and the other one subjected to moderate summer water deficit. The six genotypes displayed a large range of xylem anatomy, mean vessel and fibre diameter varying from about 40 to 60 microm and from 7.5 to 10.5 microm, respectively. Decreased water availability resulted in a reduced cell size and an important rise in vessel density, but the extent of xylem plasticity was both genotype and trait dependent. Vessel diameter and theoretical xylem-specific hydraulic conductivity correlated positively with stomatal conductance, carbon isotope discrimination and growth performance-related traits and negatively with intrinsic WUE, especially under water deficit conditions. Vessel diameter and vessel density measured under water deficit conditions correlated with the relative losses in biomass production in response to water deprivation; this resulted from the fact that a more plastic xylem structure was generally accompanied by a larger loss in biomass production.

Gain-of-function analysis of poplar CLE genes in Arabidopsis by exogenous application and over-expression assays.

Science.gov (United States)

Liu, Yisen; Yang, Shaohui; Song, Yingjin; Men, Shuzhen; Wang, Jiehua

2016-04-01

Among 50 CLE gene family members in the Populus trichocarpa genome, three and six PtCLE genes encode a CLE motif sequence highly homologous to Arabidopsis CLV3 and TDIF peptides, respectively, which potentially make them functional equivalents. To test and compare their biological activity, we first chemically synthesized each dodecapeptide and analysed itsi n vitro bioactivity on Arabidopsis seedlings. Similarly, but to a different extent, three types of poplar CLV3-related peptides caused root meristem consumption, phyllotaxis disorder, anthocyanin accumulation and failure to enter the bolting stage. In comparison, application of two poplar TDIF-related peptides led to root length promotion in a dose-dependent manner with an even stronger effect observed for poplar TDIF-like peptide than TDIF. Next, we constructed CaMV35S:PtCLE transgenic plants for each of the nine PtCLE genes. Phenotypic abnormalities exemplified by arrested shoot apical meristem and abnormal flower structure were found to be more dominant and severe in 35S:PtCLV3 and 35S:PtCLV3-like2 lines than in the 35S:PtCLV3-like line. Disordered vasculature was detected in both stem and hypocotyl cross-sections in Arabidopsis plants over-expressing poplar TDIF-related genes with the most defective vascular patterning observed for TDIF2 and two TDIF-like genes. Phenotypic difference consistently observed in peptide application assay and transgenic analysis indicated the functional diversity of nine poplar PtCLE genes under investigation. This work represents the first report on the functional analysis of CLE genes in a tree species and constitutes a basis for further study of the CLE peptide signalling pathway in tree development. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Phylogenomic Analysis and Dynamic Evolution of Chloroplast Genomes in Salicaceae

Directory of Open Access Journals (Sweden)

Yuan Huang

2017-06-01

Full Text Available Chloroplast genomes of plants are highly conserved in both gene order and gene content. Analysis of the whole chloroplast genome is known to provide much more informative DNA sites and thus generates high resolution for plant phylogenies. Here, we report the complete chloroplast genomes of three Salix species in family Salicaceae. Phylogeny of Salicaceae inferred from complete chloroplast genomes is generally consistent with previous studies but resolved with higher statistical support. Incongruences of phylogeny, however, are observed in genus Populus, which most likely results from homoplasy. By comparing three Salix chloroplast genomes with the published chloroplast genomes of other Salicaceae species, we demonstrate that the synteny and length of chloroplast genomes in Salicaceae are highly conserved but experienced dynamic evolution among species. We identify seven positively selected chloroplast genes in Salicaceae, which might be related to the adaptive evolution of Salicaceae species. Comparative chloroplast genome analysis within the family also indicates that some chloroplast genes are lost or became pseudogenes, infer that the chloroplast genes horizontally transferred to the nucleus genome. Based on the complete nucleus genome sequences from two Salicaceae species, we remarkably identify that the entire chloroplast genome is indeed transferred and integrated to the nucleus genome in the individual of the reference genome of P. trichocarpa at least once. This observation, along with presence of the large nuclear plastid DNA (NUPTs and NUPTs-containing multiple chloroplast genes in their original order in the chloroplast genome, favors the DNA-mediated hypothesis of organelle to nucleus DNA transfer. Overall, the phylogenomic analysis using chloroplast complete genomes clearly elucidates the phylogeny of Salicaceae. The identification of positively selected chloroplast genes and dynamic chloroplast-to-nucleus gene transfers in

Medicinal Plants Based Products Tested on Pathogens Isolated from Mastitis Milk

Directory of Open Access Journals (Sweden)

Claudia Pașca

2017-09-01

Full Text Available Bovine mastitis a major disease that is commonly associated with bacterial infection. The common treatment is with antibiotics administered intramammary into infected quarters of the udder. The excessive use of antibiotics leads to multidrug resistance and associated risks for human health. In this context, the search for alternative drugs based on plants has become a priority in livestock medicine. These products have a low manufacturing cost and no reports of antimicrobial resistance to these have been documented. In this context, the main objective of this study was to determine the antimicrobial effect of extracts and products of several indigenous, or acclimatized plants on pathogens isolated from bovine mastitis. A total of eleven plant alcoholic extracts and eight plant-derived products were tested against 32 microorganisms isolated from milk. The obtained results have shown an inhibition of bacterial growth for all tested plants, with better results for Evernia prunastri, Artemisia absinthium, and Lavandula angustifolia. Moreover, E. prunastri, Populus nigra, and L. angustifolia presented small averages of minimum inhibitory and bactericidal concentrations. Among the plant-derived products, three out of eight have shown a strong anti-microbial effect comparable with the effect of florfenicol and enrofloxacin, and better than individual plant extracts possibly due to synergism. These results suggest an important anti-microbial effect of these products on pathogens isolated from bovine mastitis with a possible applicability in this disease.

Elevated [CO2] magnifies isoprene emissions under heat and improves thermal resistance in hybrid aspen

OpenAIRE

Sun, Zhihong; H?ve, Katja; Vislap, Vivian; Niinemets, ?lo

2013-01-01

Isoprene emissions importantly protect plants from heat stress, but the emissions become inhibited by instantaneous increase of [CO2], and it is currently unclear how isoprene-emitting plants cope with future more frequent and severe heat episodes under high [CO2]. Hybrid aspen (Populus tremula x Populus tremuloides) saplings grown under ambient [CO2] of 380 ?mol mol?1 and elevated [CO2] of 780 ?mol mol?1 were used to test the hypothesis that acclimation to elevated [CO2] reduces the inhibito...

Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf,Stem and Root Dark Respiration of Populus tremuloides

Institute of Scientific and Technical Information of China (English)

X.Z.WANG; P.S.CURTIS; 等

2001-01-01

An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston,Michigan,USA,to study the effects of soil fertility and CO2 on leaf,sdtem and root dark respiration (Rd) of Populus tremuloides.Overall,area-based daytime leaf Rd(Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil,but not in low-fertility soil.Mass-based leaf Rd(Rdm) was overall greater for high-than for low-fertility soil grown trees at elevated,but not at ambient CO2 .Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2,nor was stem Rda ,which ranged from 1.0 to 1.4μmol m-2s-1 in the spring and 3.5 to 4.5μmol m-2s-1 in the summer.Root Rda was significantly higher in high-than in low-fertiliy soil,but was unaffected by CO2.Since biomass production of P.tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged,we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2.Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf, Stem and Root Dark Respiration of Populus tremuloides

Institute of Scientific and Technical Information of China (English)

无

2001-01-01

An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston, Michigan, USA, to study the effects of soil fertility and CO2 on leaf, stem and root dark respiration (Rd) of Populus tremuloides. Overall, area-based daytime leaf Rd (Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil, but not in low-fertility soil. Mass-based leaf Rd (Rdm) was overall greater for high- than for low-fertility soil grown trees at elevated, but not at ambient CO2. Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2, nor was stem Rda, which ranged from 1.0 to 1.4 μmol m-2 s-1 in the spring and 3.5 to 4.5 μmol m-2 s-1 in the summer. Root Rda was significantly higher in high- than in low-fertility soil, but was unaffected by CO2. Since biomass production of P. tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged, we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2. Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

Genome-wide patterns of differentiation and spatially varying selection between postglacial recolonization lineages of Populus alba (Salicaceae), a widespread forest tree.

Science.gov (United States)

Stölting, Kai N; Paris, Margot; Meier, Cécile; Heinze, Berthold; Castiglione, Stefano; Bartha, Denes; Lexer, Christian

2015-08-01

Studying the divergence continuum in plants is relevant to fundamental and applied biology because of the potential to reveal functionally important genetic variation. In this context, whole-genome sequencing (WGS) provides the necessary rigour for uncovering footprints of selection. We resequenced populations of two divergent phylogeographic lineages of Populus alba (n = 48), thoroughly characterized by microsatellites (n = 317), and scanned their genomes for regions of unusually high allelic differentiation and reduced diversity using > 1.7 million single nucleotide polymorphisms (SNPs) from WGS. Results were confirmed by Sanger sequencing. On average, 9134 high-differentiation (≥ 4 standard deviations) outlier SNPs were uncovered between populations, 848 of which were shared by ≥ three replicate comparisons. Annotation revealed that 545 of these were located in 437 predicted genes. Twelve percent of differentiation outlier genome regions exhibited significantly reduced genetic diversity. Gene ontology (GO) searches were successful for 327 high-differentiation genes, and these were enriched for 63 GO terms. Our results provide a snapshot of the roles of 'hard selective sweeps' vs divergent selection of standing genetic variation in distinct postglacial recolonization lineages of P. alba. Thus, this study adds to our understanding of the mechanisms responsible for the origin of functionally relevant variation in temperate trees. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

Use of atomic absorption spectrometry in assessment of biomonitor plants for lead, cadmium and copper pollution.

Science.gov (United States)

Gokce, Kaya; Mehmet, Yaman

2012-01-01

Eleven plant species were collected from the vicinity of lead-battery plant in the city of Gaziantep, Turkey. Lead, cadmium and copper concentrations in the soil and leaves of plants were determined by atomic absorption spectrometry. Lead, Cd and Cu concentrations in the soil samples taken from battery area were found to be in the ranges of 304-602, 0.4-0.44 and 31-37 mg x kg(-1), respectively. Significantly increased lead concentration up to 2 750 mg x kg(-1) was found in the leaves of Eleagnus angustifolia L. plant. The lead concentrations in the other plant leaves taken from 50 m around battery factory followed the order Ailanthus altissima > Morus sp. > Juglans regia L. > Ficus carica L. > Cydonia oblonga Miller > Prunus x domestica L. The plants, Populus nigra L. , Eleagnus angustifolia L. and Salix sp. were found useful for Cd, and the plant, Eleagnus angusti folia L. for Pb, to be considered as potential biomonitor. Especially, leaves of trees and plants taken from the distance of 50 m from battery plant have relatively higher Pb concentrations. Therefore, people who and animals which live in this area and benefit from these soil and plants have vital risks.

Effects of dams and geomorphic context on riparian forests of the Elwha River, Washington

Science.gov (United States)

Shafroth, Patrick B.; Perry, Laura G; Rose, Chanoane A; Braatne, Jeffrey H

2016-01-01

Understanding how dams affect the shifting habitat mosaic of river bottomlands is key for protecting the many ecological functions and related goods and services that riparian forests provide and for informing approaches to riparian ecosystem restoration. We examined the downstream effects of two large dams on patterns of forest composition, structure, and dynamics within different geomorphic contexts and compared them to upstream reference conditions along the Elwha River, Washington, USA. Patterns of riparian vegetation in river segments downstream of the dams were driven largely by channel and bottomland geomorphic responses to a dramatically reduced sediment supply. The river segment upstream of both dams was the most geomorphically dynamic, whereas the segment between the dams was the least dynamic due to substantial channel armoring, and the segment downstream of both dams was intermediate due to some local sediment supply. These geomorphic differences were linked to altered characteristics of the shifting habitat mosaic, including older forest age structure and fewer young Populus balsamifera subsp. trichocarpa stands in the relatively static segment between the dams compared to more extensive early-successional forests (dominated by Alnus rubra and Salix spp.) and pioneer seedling recruitment upstream of the dams. Species composition of later-successional forest communities varied among river segments as well, with greater Pseudotsuga menziesii and Tsuga heterophylla abundance upstream of both dams, Acer spp. abundance between the dams, and P. balsamifera subsp. trichocarpa and Thuja plicata abundance below both dams. Riparian forest responses to the recent removal of the two dams on the Elwha River will depend largely on channel and geomorphic adjustments to the release, transport, and deposition of the large volume of sediment formerly stored in the reservoirs, together with changes in large wood dynamics.

ADVANCING PROTOCOLS FOR POPLARS in vitro PROPAGATION, REGENERATION AND SELECTION OF TRANSFORMANTS

Directory of Open Access Journals (Sweden)

Nataliia Kutsokon

2013-02-01

Full Text Available Poplars (genus Populus have emerged as a model organism for forest biotechnology, and genetic modification is more advanced for this genus than for any other tree. So far several protocols for microclonal propagation and regeneration for Populus species have been developed. However it is well known that these protocols differ for various species and need to be adapted even for different clones of the same species. This work was focused on developing of protocols for propagation, regeneration and putative transformant´s selection of aspen Populus tremula L. and other two fast-growing Populus species (P. nigra L., P. x canadensis Moench. The regeneration ability for black poplar explants was demonstrated to be three times higher compared to those for aspen and hybrid poplar. It was found that concentration 1 mg/L of phosphinothricin and 25 mg/L of kanamycin is toxic for non- transgenic plant tissues of P. x canadensis and can be applied in transformation experiments when genes of resistance to the corresponding selective agents into the plant genome are introduced.

FT overexpression induces precocious flowering and normal reproductive development in Eucalyptus.

Science.gov (United States)

Klocko, Amy L; Ma, Cathleen; Robertson, Sarah; Esfandiari, Elahe; Nilsson, Ove; Strauss, Steven H

2016-02-01

Eucalyptus trees are among the most important species for industrial forestry worldwide. However, as with most forest trees, flowering does not begin for one to several years after planting which can limit the rate of conventional and molecular breeding. To speed flowering, we transformed a Eucalyptus grandis × urophylla hybrid (SP7) with a variety of constructs that enable overexpression of FLOWERING LOCUS T (FT). We found that FT expression led to very early flowering, with events showing floral buds within 1-5 months of transplanting to the glasshouse. The most rapid flowering was observed when the cauliflower mosaic virus 35S promoter was used to drive the Arabidopsis thaliana FT gene (AtFT). Early flowering was also observed with AtFT overexpression from a 409S ubiquitin promoter and under heat induction conditions with Populus trichocarpa FT1 (PtFT1) under control of a heat-shock promoter. Early flowering trees grew robustly, but exhibited a highly branched phenotype compared to the strong apical dominance of nonflowering transgenic and control trees. AtFT-induced flowers were morphologically normal and produced viable pollen grains and viable self- and cross-pollinated seeds. Many self-seedlings inherited AtFT and flowered early. FT overexpression-induced flowering in Eucalyptus may be a valuable means for accelerating breeding and genetic studies as the transgene can be easily segregated away in progeny, restoring normal growth and form. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Incremento volumétrico de un ensayo con híbridos de Populus spp.

Directory of Open Access Journals (Sweden)

Oscar Vallejos-Barra

2015-09-01

Full Text Available El aumento de los requerimientos energéticos demandados por la sociedad ha impulsado el interés por establecer ensayos para seleccionar especies o híbridos que en el menor tiempo posible generen la mayor cantidad de volumen o biomasa. En esta investigación, se determinó el incremento medio anual del volumen de un ensayo con híbridos de Populus con la finalidad de dar a conocer la potencialidad de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca. De este catálogo se escogieron los seis híbridos más promisorios y se compararon con seis híbridos comerciales. El ensayo se estableció a 10 km al norte de la ciudad de Talca, en la estación experimental Panguilemo de la Universidad de Talca. En terreno se midió el diámetro basal y la altura por tres años a las seis plantas centrales de cada parcela, con cuatro repeticiones por híbrido para ambas densidades de plantación (5.000 y 10.000 plantas por hectárea. El volumen se calculó utilizando el exponente mórfico de un Paracono. El incremento volumétrico varió entre 5,306 y 15,828 m3 ha-1 año-1, detectando diferencias significativas entre los híbridos. El grupo de mayor productividad estuvo compuesto por cinco híbridos todos del catálogo del CTA. Este resultado demuestra que si se desea una mayor productividad en plantaciones dendroenergéticas que utilicen híbridos de Populus se deberían considerar algunos de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca.

The applications of populus fiber in removal of Cr{sup (VI)} from aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Lyu, Aichao; Liu, Yuanfa, E-mail: morning309@126.com; Zhang, Hong, E-mail: zhang_hong1234@sina.com

2016-10-15

Highlights: • A sorbent for heavy metal ions based on populus fibers is prepared by a green way. • The chromium adsorption on the sorbent accords with the pseudo-second-order kinetics. • The proposed adsorption involves static attraction and chelation by the sorbent on chromium. • The sorbent is expected to be applied in universal conditions. - Abstract: The surface modification of natural materials to be applied in removal of Cr{sup (VI)} from aqueous solutions has attracted much attention. A natural sorbent for Cr{sup (VI)} based on natural populus fibers (PF) is prepared by transforming the cyano groups (AN) in polyacrylonitriles (PAN) grafted from PF into amidoxime groups (AO), which has strong ability to attract and chelate heavy metal ions. The prepared sorbent is characterized by Fourier Transform Infrared Spectra (FT-IR), thermogravimetric analysis (TGA), solid-state nuclear magnetic resonance ({sup 13}C NMR) and scanning electron microscope (SEM). As potassium dichromate solution (K{sub 2}Cr{sub 2}O{sub 7}) is used as a target solution for detecting adsorption capacity of the sorbent, the adsorption kinetics of the sorbent for chromiun is consistent with the pseudo-second-order kinetic model by analyzing the adsorption amount as a function of the sorbent dispersed duration in solution at pH = 2. The expected adsorption mechanism is that the Cr{sup (VI)} in anionic ions Cr{sub 2}O{sub 7}{sup 2−} and HCrO{sub 4}{sup −} are adsorbed through electrostatic attraction but when Cr{sup (VI)} is reduced to Cr{sup (III)} by AO, the electronegative nitrogen and oxygen in AO chelate it through coordination bond. The as-prepared PF derivant with high adsorption efficiency of chromium 180.5 mg/g (3.47 mmol/g), low cost, reusability and greenly preparation process suggests that the development of natural PF as a sorbent in removal of Cr{sup (VI)} from aqueous solutions is a destined significant approach.

The poplar basic helix-loop-helix transcription factor BEE3 – Like gene affects biomass production by enhancing proliferation of xylem cells in poplar

Energy Technology Data Exchange (ETDEWEB)

Noh, Seol Ah, E-mail: s6022029@korea.ac.kr; Choi, Young-Im, E-mail: yichoi99@forest.go.kr; Cho, Jin-Seong, E-mail: jinsung3932@gmail.com; Lee, Hyoshin, E-mail: hslee@forest.go.kr

2015-06-19

Brassinosteroids (BRs) play important roles in many aspects of plant growth and development, including regulation of vascular cambium activities and cell elongation. BR-induced BEE3 (brassinosteroid enhanced expression 3) is required for a proper BR response. Here, we identified a poplar (Populus alba × Populus glandulosa) BEE3-like gene, PagBEE3L, encoding a putative basic helix-loop-helix (bHLH)-type transcription factor. Expression of PagBEE3L was induced by brassinolide (BL). Transcripts of PagBEE3L were mainly detected in stems, with the internode having a low level of transcription and the node having a relatively higher level. The function of the PagBEE3L gene was investigated through phenotypic analyses with PagBEE3L-overexpressing (ox) transgenic lines. This work particularly focused on a potential role of PagBEE3L in stem growth and development of polar. The PagBEE3L-ox poplar showed thicker and longer stems than wild-type plants. The xylem cells from the stems of PagBEE3L-ox plants revealed remarkably enhanced proliferation, resulting in an earlier thickening growth than wild-type plants. Therefore, this work suggests that xylem development of poplar is accelerated in PagBEE3L-ox plants and PagBEE3L plays a role in stem growth by increasing the proliferation of xylem cells to promote the initial thickening growth of poplar stems. - Highlights: • We identify the BEE3-like gene form hybrid poplar (Populus alba × Populus glandulosa). • We examine effects of overexpression of PagBEE3L on growth in poplar. • We found that 35S:BEE3L transgenic plants showed more rapid growth than wild-type plants. • BEE3L protein plays an important role in the development of plant stem.

The poplar basic helix-loop-helix transcription factor BEE3 – Like gene affects biomass production by enhancing proliferation of xylem cells in poplar

International Nuclear Information System (INIS)

Noh, Seol Ah; Choi, Young-Im; Cho, Jin-Seong; Lee, Hyoshin

2015-01-01

Brassinosteroids (BRs) play important roles in many aspects of plant growth and development, including regulation of vascular cambium activities and cell elongation. BR-induced BEE3 (brassinosteroid enhanced expression 3) is required for a proper BR response. Here, we identified a poplar (Populus alba × Populus glandulosa) BEE3-like gene, PagBEE3L, encoding a putative basic helix-loop-helix (bHLH)-type transcription factor. Expression of PagBEE3L was induced by brassinolide (BL). Transcripts of PagBEE3L were mainly detected in stems, with the internode having a low level of transcription and the node having a relatively higher level. The function of the PagBEE3L gene was investigated through phenotypic analyses with PagBEE3L-overexpressing (ox) transgenic lines. This work particularly focused on a potential role of PagBEE3L in stem growth and development of polar. The PagBEE3L-ox poplar showed thicker and longer stems than wild-type plants. The xylem cells from the stems of PagBEE3L-ox plants revealed remarkably enhanced proliferation, resulting in an earlier thickening growth than wild-type plants. Therefore, this work suggests that xylem development of poplar is accelerated in PagBEE3L-ox plants and PagBEE3L plays a role in stem growth by increasing the proliferation of xylem cells to promote the initial thickening growth of poplar stems. - Highlights: • We identify the BEE3-like gene form hybrid poplar (Populus alba × Populus glandulosa). • We examine effects of overexpression of PagBEE3L on growth in poplar. • We found that 35S:BEE3L transgenic plants showed more rapid growth than wild-type plants. • BEE3L protein plays an important role in the development of plant stem

Expression of multiple resistance genes enhances tolerance to environmental stressors in transgenic poplar (Populus × euramericana 'Guariento'.

Directory of Open Access Journals (Sweden)

Xiaohua Su

Full Text Available Commercial and non-commercial plants face a variety of environmental stressors that often cannot be controlled. In this study, transgenic hybrid poplar (Populus × euramericana 'Guariento' harboring five effector genes (vgb, SacB, JERF36, BtCry3A and OC-I were subjected to drought, salinity, waterlogging and insect stressors in greenhouse or laboratory conditions. Field trials were also conducted to investigate long-term effects of transgenic trees on insects and salt tolerance in the transformants. In greenhouse studies, two transgenic lines D5-20 and D5-21 showed improved growth, as evidenced by greater height and basal diameter increments and total biomass relative to the control plants after drought or salt stress treatments. The improved tolerance to drought and salt was primarily attributed to greater instantaneous water use efficiency (WUEi in the transgenic trees. The chlorophyll concentrations tended to be higher in the transgenic lines under drought or saline conditions. Transformed trees in drought conditions accumulated more fructan and proline and had increased Fv/Fm ratios (maximum quantum yield of photosystem II under waterlogging stress. Insect-feeding assays in the laboratory revealed a higher total mortality rate and lower exuviation index of leaf beetle [Plagiodera versicolora (Laicharting] larvae fed with D5-21 leaves, suggesting enhanced insect resistance in the transgenic poplar. In field trials, the dominance of targeted insects on 2-year-old D5-21 transgenic trees was substantially lower than that of the controls, indicating enhanced resistance to Coleoptera. The average height and DBH (diameter at breast height of 2.5-year-old transgenic trees growing in naturally saline soil were 3.80% and 4.12% greater than those of the control trees, but these increases were not significant. These results suggested that multiple stress-resistance properties in important crop tree species could be simultaneously improved, although

Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China.

Science.gov (United States)

He, Xuemin; Lv, Guanghui; Qin, Lu; Chang, Shunli; Yang, Min; Yang, Jianjun; Yang, Xiaodong

2015-01-01

One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N). This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1) were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (Pdesert ecosystem of the Ebinur Lake area, N deposition indirectly changes the soil respiration rate by altering soil properties.

Plant response to nutrient availability across variable bedrock geologies

Science.gov (United States)

Castle, S.C.; Neff, J.C.

2009-01-01

We investigated the role of rock-derived mineral nutrient availability on the nutrient dynamics of overlying forest communities (Populus tremuloides and Picea engelmanni-Abies lasiocarpa v. arizonica) across three parent materials (andesite, limestone, and sandstone) in the southern Rocky Mountains of Colorado. Broad geochemical differences were observed between bedrock materials; however, bulk soil chemistries were remarkably similar between the three different sites. In contrast, soil nutrient pools were considerably different, particularly for P, Ca, and Mg concentrations. Despite variations in nutrient stocks and nutrient availability in soils, we observed relatively inflexible foliar concentrations and foliar stoichiometries for both deciduous and coniferous species. Foliar nutrient resorption (P and K) in the deciduous species followed patterns of nutrient content across substrate types, with higher resorption corresponding to lower bedrock concentrations. Work presented here indicates a complex plant response to available soil nutrients, wherein plant nutrient use compensates for variations in supply gradients and results in the maintenance of a narrow range in foliar stoichiometry. ?? 2008 Springer Science+Business Media, LLC.

Uprooting force balance for pioneer woody plants: A quantification of the relative contribution of above- and below-ground plant architecture to uprooting susceptibility

Science.gov (United States)

Bywater-Reyes, S.; Wilcox, A. C.; Lightbody, A.; Skorko, K.; Stella, J. C.

2012-12-01

Cottonwood (Populus), willow (Salix), and tamarisk (Tamarix) populate riparian areas in many dryland regions, and their recruitment depends heavily on hydrogeomorphic conditions. The survival of pioneer woody seedlings depends in part on the establishment of root systems capable of anchoring plants in subsequent floods, and this root system development in turn influences the cohesion that plants provide to bars. The factors influencing the anchoring ability and resistance to scour of woody seedlings include plant frontal area and flexibility, root structure, and water table elevation. This study aims to quantify the factors comprising the force balance to uproot woody seedlings and saplings in two field sites characterized by different hydrologic conditions. The Bill Williams River (AZ) is an impounded river with elevated water table elevations produced by dam-released base flows. The Bitterroot River (MT) is an unimpounded river with a snowmelt hydrograph and seasonal fluctuations in river and water table elevation. We simulate uprooting from flooding events by saturating substrates and applying force near the base of the plant in a lateral, downstream direction until uprooting occurs, for a range of plant sizes but with a focus on small (plants, with cottonwood and tamarisk seedlings showing greater variability than willow. In contrast, root length and stem diameter are only weakly correlated with pull-out force. By combining pull test results with measurements of geomorphic and groundwater conditions, this study provides insights into the relative contribution of a plant's above-ground and below-ground architecture to uprooting potential and into the feedbacks between vegetation and morphodynamics on river bars.

Epiphytic vegetation of Populus balsamifera and its significance as an air pollution indicator in Sudbury, Ontario

Energy Technology Data Exchange (ETDEWEB)

Leblanc, F; Rao, D N; Comeau, G

1972-01-01

Indices of atmospheric purity (IAP) of 31 sites, selected in the SO/sub 2/-polluted as well as in the nonpolluted areas around Sudbury were determined on the basis of number, frequency-coverage, and resistance factor of the epiphytes of Populus balsamifera. Based on these indices, arranged into convenient ranges, the investigated area was delimited into five different IAP zones. These zones were then compared with SO/sub 2/ pollution zones based on the ground-level average concentration of the gas prevailing in the area. From this comparison it is clear that the biological method provides a valid, quick, and economical way for assessing and mapping the long-range effect of pollution of a given area.

The role of peu-miR164 and its target PeNAC genes in response to abiotic stress in Populus euphratica.

Science.gov (United States)

Lu, Xin; Dun, Hui; Lian, Conglong; Zhang, Xiaofei; Yin, Weilun; Xia, Xinli

2017-06-01

Plant miR164 family is highly conserved and miR164 members regulate conserved targets belonging to NAC transcription factors. Our previous studies have revealed that peu-miR164a-e and its target gene POPTR_0007s08420 participate in abiotic stress response in Populus euphratica according to deep sequencing and degradome sequencing. In this study, miR164 family comprises six members that generate two mature products (miR164a-e and miR164f) and target seven NAC genes in P. euphratica. Co-expression in Nicotiana benthamiana and 5' RACE confirmed that peu-miR164 directs PeNAC070, PeNAC012 and PeNAC028 mRNAs cleavage. Expression profiles of primary peu-miR164 a/b/c/d/e bear similarity to those of peu-miR164a-e, whereas PeNAC070 and PeNAC081 showed inverse expression patterns with peu-miR164a-e under abiotic stresses. Existence of cis-acting elements in PeNAC070 promoter (ABRE,MBs, Box-W1, GC-motif, and W-box) and in peu-MIR164b promoter (HSE) further confirmed different responses of peu-miR164 and PeNAC070 to abiotic stresses. Histochemical β-glucuronidase (GUS) staining revealed that GUS activities increased when Pro PeNAC070 ::GUS transgenic Arabidopsis plants were exposed to NaCl, mannitol and abscisic acid (ABA), whereas GUS activity of Pro peu-MIR164b ::GUS plants decreased under ABA treatment. Subcellular localization and transactivation assays showed that PeNAC070 protein was localized to the nucleus and exhibited transactivation activity at the C-terminal. Overexpression of PeNAC070 in Arabidopsis promoted lateral root development, delayed stem elongation, and increased sensitivity of transgenic plants to drought and salt stresses. This study aids in understanding the adaptability of P. euphratica to extreme drought and salt environment by analysing tissue-specific expression patterns of miR164-regulated and specific promoter-regulated PeNAC genes. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Identification, classification and differential expression of oleosin genes in tung tree (Vernicia fordii).

Science.gov (United States)

Cao, Heping; Zhang, Lin; Tan, Xiaofeng; Long, Hongxu; Shockey, Jay M

2014-01-01

Triacylglycerols (TAG) are the major molecules of energy storage in eukaryotes. TAG are packed in subcellular structures called oil bodies or lipid droplets. Oleosins (OLE) are the major proteins in plant oil bodies. Multiple isoforms of OLE are present in plants such as tung tree (Vernicia fordii), whose seeds are rich in novel TAG with a wide range of industrial applications. The objectives of this study were to identify OLE genes, classify OLE proteins and analyze OLE gene expression in tung trees. We identified five tung tree OLE genes coding for small hydrophobic proteins. Genome-wide phylogenetic analysis and multiple sequence alignment demonstrated that the five tung OLE genes represented the five OLE subfamilies and all contained the "proline knot" motif (PX5SPX3P) shared among 65 OLE from 19 tree species, including the sequenced genomes of Prunus persica (peach), Populus trichocarpa (poplar), Ricinus communis (castor bean), Theobroma cacao (cacao) and Vitis vinifera (grapevine). Tung OLE1, OLE2 and OLE3 belong to the S type and OLE4 and OLE5 belong to the SM type of Arabidopsis OLE. TaqMan and SYBR Green qPCR methods were used to study the differential expression of OLE genes in tung tree tissues. Expression results demonstrated that 1) All five OLE genes were expressed in developing tung seeds, leaves and flowers; 2) OLE mRNA levels were much higher in seeds than leaves or flowers; 3) OLE1, OLE2 and OLE3 genes were expressed in tung seeds at much higher levels than OLE4 and OLE5 genes; 4) OLE mRNA levels rapidly increased during seed development; and 5) OLE gene expression was well-coordinated with tung oil accumulation in the seeds. These results suggest that tung OLE genes 1-3 probably play major roles in tung oil accumulation and/or oil body development. Therefore, they might be preferred targets for tung oil engineering in transgenic plants.

Identification, classification and differential expression of oleosin genes in tung tree (Vernicia fordii.

Directory of Open Access Journals (Sweden)

Heping Cao

Full Text Available Triacylglycerols (TAG are the major molecules of energy storage in eukaryotes. TAG are packed in subcellular structures called oil bodies or lipid droplets. Oleosins (OLE are the major proteins in plant oil bodies. Multiple isoforms of OLE are present in plants such as tung tree (Vernicia fordii, whose seeds are rich in novel TAG with a wide range of industrial applications. The objectives of this study were to identify OLE genes, classify OLE proteins and analyze OLE gene expression in tung trees. We identified five tung tree OLE genes coding for small hydrophobic proteins. Genome-wide phylogenetic analysis and multiple sequence alignment demonstrated that the five tung OLE genes represented the five OLE subfamilies and all contained the "proline knot" motif (PX5SPX3P shared among 65 OLE from 19 tree species, including the sequenced genomes of Prunus persica (peach, Populus trichocarpa (poplar, Ricinus communis (castor bean, Theobroma cacao (cacao and Vitis vinifera (grapevine. Tung OLE1, OLE2 and OLE3 belong to the S type and OLE4 and OLE5 belong to the SM type of Arabidopsis OLE. TaqMan and SYBR Green qPCR methods were used to study the differential expression of OLE genes in tung tree tissues. Expression results demonstrated that 1 All five OLE genes were expressed in developing tung seeds, leaves and flowers; 2 OLE mRNA levels were much higher in seeds than leaves or flowers; 3 OLE1, OLE2 and OLE3 genes were expressed in tung seeds at much higher levels than OLE4 and OLE5 genes; 4 OLE mRNA levels rapidly increased during seed development; and 5 OLE gene expression was well-coordinated with tung oil accumulation in the seeds. These results suggest that tung OLE genes 1-3 probably play major roles in tung oil accumulation and/or oil body development. Therefore, they might be preferred targets for tung oil engineering in transgenic plants.

Susceptibility of riparian wetland plants to perfluorooctanoic acid (PFOA) accumulation.

Science.gov (United States)

Mudumbi, J B N; Ntwampe, S K O; Muganza, M; Okonkwo, J O

2014-01-01

As plants have been shown to accumulate organic compounds from contaminated sediments, there is a potential for long-lasting ecological impact as a result of contaminant accumulation in riparian areas of wetlands, particularly the accumulation of non-biodegradable contaminants such as perfluorooctanoic acid (PFOA). In this study, commonly found riparian wetland plants including reeds, i.e., Xanthium strumarium, Phragmites australis, Schoenoplectus corymbosus, Ruppia maritime; Populus canescens, Polygonum salicifolium, Cyperus congestus; Persicaria amphibian, Ficus carica, Artemisia schmidtiana, Eichhornia crassipes, were studied to determine their susceptibility to PFOA accumulation from PFOA contaminated riparian sediment with a known PFOA concentration, using liquid chromatography/tandem mass spectrometry (LC/MS/MS). The bioconcentration factor (BCF) indicated that the plants affinity to PFOA accumulation was; E. crassipes, > P. sali-cifolium, > C. congestus, > P. x canescens, > P. amphibian, > F. carica, > A. schmidtiana, > X. strumarium,> P. australis, > R. maritime, > S. corymbosus. The concentration of PFOA in the plants and/or reeds was in the range 11.7 to 38 ng/g, with a BCF range of 0.05 to 0.37. The highest BCF was observed in sediment for which its core water had a high salinity, total organic carbon and a pH which was near neutral. As the studied plants had a higher affinity for PFOA, the resultant effect is that riparian plants such as E. crassipes, X. strumarium, and P. salicifolium, typified by a fibrous rooting system, which grow closer to the water edge, exacerbate the accumulation of PFOA in riparian wetlands.

Multi-omics approach identifies molecular mechanisms of plant-fungus mycorrhizal interaction

Directory of Open Access Journals (Sweden)

Peter E Larsen

2016-01-01

Full Text Available In mycorrhizal symbiosis, plant roots form close, mutually beneficial interactions with soil fungi. Before this mycorrhizal interaction can be established however, plant roots must be capable of detecting potential beneficial fungal partners and initiating the gene expression patterns necessary to begin symbiosis. To predict a plant root – mycorrhizal fungi sensor systems, we analyzed in vitro experiments of Populus tremuloides (aspen tree and Laccaria bicolor (mycorrhizal fungi interaction and leveraged over 200 previously published transcriptomic experimental data sets, 159 experimentally validated plant transcription factor binding motifs, and more than 120-thousand experimentally validated protein-protein interactions to generate models of pre-mycorrhizal sensor systems in aspen root. These sensor mechanisms link extracellular signaling molecules with gene regulation through a network comprised of membrane receptors, signal cascade proteins, transcription factors, and transcription factor biding DNA motifs. Modeling predicted four pre-mycorrhizal sensor complexes in aspen that interact with fifteen transcription factors to regulate the expression of 1184 genes in response to extracellular signals synthesized by Laccaria. Predicted extracellular signaling molecules include common signaling molecules such as phenylpropanoids, salicylate, and, jasmonic acid. This multi-omic computational modeling approach for predicting the complex sensory networks yielded specific, testable biological hypotheses for mycorrhizal interaction signaling compounds, sensor complexes, and mechanisms of gene regulation.

Elimination behaviour and soil mineral nitrogen load in an organic system with lactating sows – comparing pasture based systems with and without access to poplar (Populus sp.) trees

DEFF Research Database (Denmark)

Jakobsen, Malene; Hermansen, John Erik; Andersen, Heidi Mai-Lis

2017-01-01

There is an urgent need to introduce innovative strategies in the current free-range pig production to improve the environmental performance. Based on previous experiences, inclusion of a zone with poplar (Populus sp.) trees in individual sow paddocks was hypothesized to improve the system’s nitr...

Testing Transgenic Aspen Plants with bar Gene for Herbicide Resistance under Semi-natural Conditions.

Science.gov (United States)

Lebedev, V G; Faskhiev, V N; Kovalenko, N P; Shestibratov, K A; Miroshnikov, A I

2016-01-01

Obtaining herbicide resistant plants is an important task in the genetic engineering of forest trees. Transgenic European aspen plants (Populus tremula L.) expressing the bar gene for phosphinothricin resistance have been produced using Agrobacterium tumefaciens-mediated transformation. Successful genetic transformation was confirmed by PCR analysis for thirteen lines derived from two elite genotypes. In 2014-2015, six lines were evaluated for resistance to herbicide treatment under semi-natural conditions. All selected transgenic lines were resistant to the herbicide Basta at doses equivalent to 10 l/ha (twofold normal field dosage) whereas the control plants died at 2.5 l/ha. Foliar NH4-N concentrations in transgenic plants did not change after treatment. Extremely low temperatures in the third ten-day period of October 2014 revealed differences in freeze tolerance between the lines obtained from Pt of f2 aspen genotypes. Stable expression of the bar gene after overwintering outdoors was confirmed by RT-PCR. On the basis of the tests, four transgenic aspen lines were selected. The bar gene could be used for retransformation of transgenic forest trees expressing valuable traits, such as increased productivity.

Populus balsamifera Extract and Its Active Component Salicortin Reduce Obesity and Attenuate Insulin Resistance in a Diet-Induced Obese Mouse Model

Directory of Open Access Journals (Sweden)

Despina Harbilas

2013-01-01

Full Text Available Populus balsamifera L. (BP is a medicinal plant stemming from the traditional pharmacopoeia of the Cree of Eeyou Istchee (CEI—Northern Quebec. In vitro screening studies revealed that it strongly inhibited adipogenesis in 3T3-L1 adipocytes, suggesting potential antiobesity activity. Salicortin was identified, through bioassay-guided fractionation, as the active component responsible for BP’s activity. The present study aimed to assess the potential of BP and salicortin at reducing obesity and features of the metabolic syndrome, in diet-induced obese C57Bl/6 mice. Mice were subjected to high fat diet (HFD for sixteen weeks, with BP (125 or 250 mg/kg or salicortin (12.5 mg/kg introduced in the HFD for the last eight of the sixteen weeks. BP and salicortin effectively reduced whole body and retroperitoneal fat pad weights, as well as hepatic triglyceride accumulation. Glycemia, insulinemia, leptin, and adiponectin levels were also improved. This was accompanied by a small yet significant reduction in food intake in animals treated with BP. BP and salicortin (slightly also modulated key components in signaling pathways involved with glucose regulation and lipid oxidation in the liver, muscle, and adipose tissue. These results confirm the validity of the CEI pharmacopoeia as alternative and complementary antiobesity and antidiabetic therapies.

Vernalization and the Chilling Requirement to Exit Bud Dormancy: Shared or Separate Regulation?

Directory of Open Access Journals (Sweden)

Amy M Brunner

2014-12-01

Full Text Available Similarities have long been recognized between vernalization, the prolonged exposure to cold temperatures that promotes the floral transition in many plants, and the chilling requirement to release bud dormancy in woody plants of temperate climates. In both cases the extended chilling period occurring during winter is used to coordinate developmental events to the appropriate seasonal time. However, whether or not these processes share common regulatory components and molecular mechanisms remain largely unknown. Both gene function and association genetics studies in Populus are beginning to answer this question. In Populus, studies have revealed that orthologs of the antagonistic flowering time genes FT and CEN/TFL1 might have central roles in both processes. We review Populus seasonal shoot development related to dormancy release and the floral transition and evidence for FT/TFL1-mediated regulation of these processes to consider the question of regulatory overlap. In addition, we discuss the potential for and challenges to integrating functional and population genomics studies to uncover the regulatory mechanisms underpinning these processes in woody plant systems.

Boron accumulation and toxicity in hybrid poplar (Populus nigra × euramericana).

Science.gov (United States)

Rees, Rainer; Robinson, Brett H; Menon, Manoj; Lehmann, Eberhard; Günthardt-Goerg, Madeleine S; Schulin, Rainer

2011-12-15

Poplars accumulate high B concentrations and are thus used for the phytomanagement of B contaminated soils. Here, we performed pot experiments in which Populus nigra × euramericana were grown on a substrate with B concentrations ranging from 13 to 280 mg kg(-1) as H(3)BO(3). Salix viminalis, Brassica juncea, and Lupinus albus were grown under some growing conditions for comparison. Poplar growth was unaffected at soil B treatment levels up to 93 mg kg(-1). Growth was progressively reduced at levels of 168 and 280 mg kg(-1). None of the other species survived at these substrate B levels. At leaf B concentrations toxicity. Neutron radiography revealed that chlorotic leaf tissues had B concentrations of 1000-2000 mg kg(-1), while necrotic tissues had >2000 mg kg(-1). Average B concentrations of up to 3500 mg kg(-1) were found in leaves, while spots within leaves had concentrations >7000 mg kg(-1), showing that B accumulation in leaf tissue continued even after the onset of necrosis. The B accumulation ability of P. nigra × euramericana is associated with B hypertolerance in the living tissue and storage of B in dead leaf tissue.

Scale dependence of disease impacts on quaking aspen (Populus tremuloides) mortality in the southwestern United States

Science.gov (United States)

Bell, David M.; Bradford, John B.; Lauenroth, William K.

2015-01-01

Depending on how disease impacts tree exposure to risk, both the prevalence of disease and disease effects on survival may contribute to patterns of mortality risk across a species' range. Disease may accelerate tree species' declines in response to global change factors, such as drought, biotic interactions, such as competition, or functional traits, such as allometry. To assess the role of disease in mediating mortality risk in quaking aspen (Populus tremuloides), we developed hierarchical Bayesian models for both disease prevalence in live aspen stems and the resulting survival rates of healthy and diseased aspen near the species' southern range limit using 5088 individual trees on 281 United States Forest Service Forest Inventory and Analysis plots in the southwestern United States.

Invasive alien woody plants of the Orange Free State

Directory of Open Access Journals (Sweden)

L. Henderson

1991-09-01

Full Text Available The frequency and abundance of invasive alien woody plants were recorded along roadsides and at watercourse crossings in 66% (151/230 of the quarter degree squares in the study area. The survey yielded 64 species of which the most prominent (in order of prominence in streambank habitats were:  Salix babylonica, Populus x  canescens, Acacia dealbata and  Salix fragilis (fide R.D. Meikle pers. comm . The most prominent species (in order of prominence in roadside and veld habitats were:  Opunlia ficus-indica, Prunus persica, Eucalyptus spp..  Rosa eglanteria, Pyracantha angustifolia and Acacia dealbata.Little invasion was recorded for most of the province. The greatest intensity of invasion was recorded along the perennial rivers and rocky hillsides in the moist grassland of the eastern mountain region bordering on Lesotho and Natal.

Distribution of invasive and native riparian woody plants across the western USA in relation to climate, river flow, floodplain geometry and patterns of introduction

Science.gov (United States)

Ryan McShane,; Daniel Auerbach,; Friedman, Jonathan M.; Auble, Gregor T.; Shafroth, Patrick B.; Michael Merigliano,; Scott, Michael L.; N. Leroy Poff,

2015-01-01

Management of riparian plant invasions across the landscape requires understanding the combined influence of climate, hydrology, geologic constraints and patterns of introduction. We measured abundance of nine riparian woody taxa at 456 stream gages across the western USA. We constructed conditional inference recursive binary partitioning models to discriminate the influence of eleven environmental variables on plant occurrence and abundance, focusing on the two most abundant non-native taxa, Tamarix spp. and Elaeagnus angustifolia, and their native competitor Populus deltoides. River reaches in this study were distributed along a composite gradient from cooler, wetter higher-elevation reaches with higher stream power and earlier snowmelt flood peaks to warmer, drier lower-elevation reaches with lower power and later peaks. Plant distributions were strongly related to climate, hydrologic and geomorphic factors, and introduction history. The strongest associations were with temperature and then precipitation. Among hydrologic and geomorphic variables, stream power, peak flow timing and 10-yr flood magnitude had stronger associations than did peak flow predictability, low-flow magnitude, mean annual flow and channel confinement. Nearby intentional planting of Elaeagnus was the best predictor of its occurrence, but planting of Tamarix was rare. Higher temperatures were associated with greater abundance of Tamarix relative to P. deltoides, and greater abundance of P. deltoides relative toElaeagnus. Populus deltoides abundance was more strongly related to peak flow timing than was that of Elaeagnus or Tamarix. Higher stream power and larger 10-yr floods were associated with greater abundance of P. deltoides and Tamarix relative to Elaeagnus. Therefore, increases in temperature could increase abundance of Tamarix and decrease that of Elaeagnus relative to P. deltoides, changes in peak flow timing caused by climate change or dam operations could

The effects of gamma irradiation on growth and expression of genes encoding DNA repair-related proteins in Lombardy poplar (Populus nigra var. italica).

Science.gov (United States)

Nishiguchi, Mitsuru; Nanjo, Tokihiko; Yoshida, Kazumasa

2012-07-01

In this study, to elucidate the mechanisms of adaptation and tolerance to ionizing radiation in woody plants, we investigated the various biological effects of γ-rays on the Lombardy poplar (Populus nigra L. var. italica Du Roi). We detected abnormal leaf shape and color, fusion, distorted venation, shortened internode, fasciation and increased axillary shoots in γ-irradiated poplar plants. Acute γ-irradiation with a dose of 100Gy greatly reduced the height, stem diameter and biomass of poplar plantlets. After receiving doses of 200 and 300Gy, all the plantlets stopped growing, and then most of them withered after 4-10 weeks of γ-irradiation. Comet assays showed that nuclear DNA in suspension-cultured poplar cells had been damaged by γ-rays. To determine whether DNA repair-related proteins are involved in the response to γ-rays in Lombardy poplars, we cloned the PnRAD51, PnLIG4, PnKU70, PnXRCC4, PnPCNA and PnOGG1 cDNAs and investigated their mRNA expression. The PnRAD51, PnLIG4, PnKU70, PnXRCC4 and PnPCNA mRNAs were increased by γ-rays, but the PnOGG1 mRNA was decreased. Moreover, the expression of PnLIG4, PnKU70 and PnRAD51 was also up-regulated by Zeocin known as a DNA cleavage agent. These observations suggest that the morphogenesis, growth and protective gene expression in Lombardy poplars are severely affected by the DNA damage and unknown cellular events caused by γ-irradiation. Copyright © 2012 Elsevier Ltd. All rights reserved.

Near-ambient ozone concentrations reduce the vigor of Betula and Populus species in Finland.

Science.gov (United States)

Oksanen, Elina; Manninen, Sirkku; Vapaavuori, Elina; Holopainen, Toini

2009-12-01

In this review the main growth responses of Finnish birch (Betula pendula, B. pubescens) and aspen species (Populus tremula and P. tremuloides x P. tremula) are correlated with ozone exposure, indicated as the AOT40 value. Data are derived from 23 different laboratory, open-top chamber, and free-air fumigation experiments. Our results indicate that these tree species are sensitive to increasing ozone concentrations, though high intraspecific variation exists. The roots are the most vulnerable targets in both genera. These growth reductions, determined from trees grown under optimal nutrient and water supply, were generally accompanied by increased visible foliar injuries, carbon allocation toward defensive compounds, reduced carbohydrate contents of leaves, impaired photosynthesis processes, disturbances in stomatal function, and earlier autumn senescence. Because both genera have shown complex ozone defense and response mechanisms, which are modified by variable environmental conditions, a mechanistically based approach is necessary for accurate ozone risk assessment.

Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China

Science.gov (United States)

He, Xuemin; Lv, Guanghui; Qin, Lu; Chang, Shunli; Yang, Min; Yang, Jianjun; Yang, Xiaodong

2015-01-01

One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N). This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1) were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (Psoil respiration rate by approximately 66.7±2.7% (Psoil moisture, whereas N deposition significantly increased the soil temperature in the 0–5 cm layer (Psoil respiration rate by altering soil properties. PMID:26379186

Physiological and morphological responses of Tamarix ramosissima and Populus euphratica to altered groundwater availability.

Science.gov (United States)

Li, J; Yu, B; Zhao, C; Nowak, Robert S; Zhao, Z; Sheng, Y; Li, J

2013-01-01

Riparian plants in arid areas are subject to frequent hydrological fluctuations induced through natural flow variation and water use by humans. Although many studies have focused on the success of Tamarix ramosissima Ledeb. in its invaded ranges, its major competitor in its home range, Populus euphratica Oliv., historically has dominated riparian forests where both species occur naturally. Thus, identifying ecophysiological differences between T. ramosissima and its co-evolved competitor under varying hydrological conditions may help us understand how flow regimes affect dominance in its home range and promote invasion in new ranges. We examined ecophysiological responses of T. ramosissima and P. euphratica, which are both native to the Tarim River Basin, northwest China, to experimental alterations in groundwater. Seedlings of both species were grown in lysimeters, first under well-watered conditions and then exposed to different groundwater treatments: inundation, drought, and relatively shallow, moderate and deep groundwater. Under inundation, T. ramosissima showed little growth whereas P. euphratica died after ~45 days. Droughted seedlings of both species suffered from considerable water stress evidenced by slow growth, decreased total leaf area and specific leaf area, and decreased xylem water potential (ψ), maximum photosynthetic rate and carboxylation efficiency. Both species had better ecophysiological performances under shallow and moderate groundwater conditions. When groundwater declined below rooting depth, seedlings of both species initially experienced decreased ψ, but ψ of T. ramosissima recovered late in the experiment whereas P. euphratica maintained decreased ψ. This ability of T. ramosissima to recover from water deficit might result from its rapid root elongation and subsequent ability to acquire groundwater, which in turn likely provides ecophysiological advantages over P. euphratica. Our results suggest that recent groundwater declines

[A review of the genomic and gene cloning studies in trees].

Science.gov (United States)

Yin, Tong-Ming

2010-07-01

Supported by the Department of Energy (DOE) of U.S., the first tree genome, black cottonwood (Populus trichocarpa), has been completely sequenced and publicly release. This is the milestone that indicates the beginning of post-genome era for forest trees. Identification and cloning genes underlying important traits are one of the main tasks for the post-genome-era tree genomic studies. Recently, great achievements have been made in cloning genes coordinating important domestication traits in some crops, such as rice, tomato, maize and so on. Molecular breeding has been applied in the practical breeding programs for many crops. By contrast, molecular studies in trees are lagging behind. Trees possess some characteristics that make them as difficult organisms for studying on locating and cloning of genes. With the advances in techniques, given also the fast growth of tree genomic resources, great achievements are desirable in cloning unknown genes from trees, which will facilitate tree improvement programs by means of molecular breeding. In this paper, the author reviewed the progress in tree genomic and gene cloning studies, and prospected the future achievements in order to provide a useful reference for researchers working in this area.

Low nitrogen stress stimulating the indole-3-acetic acid biosynthesis of Serratia sp. ZM is vital for the survival of the bacterium and its plant growth-promoting characteristic.

Science.gov (United States)

Ouyang, Liming; Pei, Haiyan; Xu, Zhaohui

2017-04-01

Serratia sp. ZM is a plant growth-promoting (PGP) bacterial strain isolated from the rhizospheric soil of Populus euphratica in northwestern China. In this study, low nitrogen supply significantly stimulated the production of indole-3-acetic acid (IAA) in Serratia sp.ZM. The inoculation of the bacterium to wheat seedlings improved plant growth compared with the uninoculated group, and the stimulating effect was more prominent under low nitrogen stress. Inactivation of the predicted key gene in the IAA biosynthesis pathway impaired IAA production and significantly hampered mutant growth in poor medium. Furthermore, the IAA-deficient mutant lost the PGP effect under either normal or low nitrogen conditions in plant experiments. This study revealed the significant impact of environmental nitrogen levels on IAA production in the PGP strain and the vital effect of IAA on resistance physiology of both the bacterium and host plant. The characteristics of Serratia sp. ZM also indicated its application potential as a biofertilizer for plants, especially those suffering from poor nitrogen soil.

Genetic manipulation of woody plants and its applications. Rinboku no idenshi sosa to sono oyo

Energy Technology Data Exchange (ETDEWEB)

Ebinuma, H. (Jujo Paper Co. Ltd., Tokyo (Japan))

1992-06-01

The advance of plant biotechnology has been further accelerated by the development of the new epoch-making technique typified by the DNA amplification using the PCR (polymerase chain reaction) method. In the application of plant biotechnology to trees, the introduction of useful genes into genetically elite trees and short-period mass propagation of recombinants by micropropagation are considered to be rational strategies. In the utilization of recombinants, non-edible industrial product materials such as trees are considered to pass the safety standards more easily and also to be profitable. This paper discusses the possibilities of tree recombinants, the imparting of disease-resistance to elite trees and the biosynthetic control of lignin. The paper introduces a topic that the imparting of disease-resistance to elite trees is in a stage of transference to experiments of recombinants in a closed-system greenhouse by the construction of the crown gall resistant gene and the establishment of the gene introduction system into crossed populus sieboldii miquel. 19 refs., 4 figs.

Visualization of plant Regulomics Network in Graph using Neo4j

Directory of Open Access Journals (Sweden)

Ganesh Panzade

2017-10-01

Full Text Available Plants have highly interacted with the environment through phenotypically. The phenotype of plants controls via epigenome by DNA methylation, histone modification, small RNAs like (miRNAs/siRNAs, transcription factors and repetitive elements. These all regulatory factors work together in various stress conditions of plants for the protection or survival. The regulators perform their function in the module of a mechanism at TGS or PTGS. Some regulators may be activated or deactivated according to their action of the mechanism. Such type of interaction briefly called Regulomics which control or regulate the genotype through epigenomics. In, various types of interaction have been considering for the case studies. Most important interactions related to small RNAs and DNA methylation for their expressional silencing of key genes in various pathways. The possible interaction of miR-Gene, miR-TF, TF-miR, TF-Gene and Gene-Gene is mostly found in the complex network of plants. Need to provide a dynamic, interactive, systematic and versatile visualization technique to provide a comprehensive platform to view such complex interaction graph networks for plants. Graph based interaction networks visualization available for  regulomics contains various interaction. For these Neo4j have been emerging NoSQL based graph tool to visualize versatile networks in graphical as well as user defined formats. We provide the graph based big-data networks in various plants like Thale cress, Soyabean, Maize, Rice, Populus, medicago, tomato, etc. Each plants networks have more than ~30,000 nodes and their edges or relationships. It has been very fast and friendly for users. This facility provides vital impact for plant sciences in the area of network interaction in future.

Black poplar-tree (Populus nigra L.) bark as an alternative indicator of urban air pollution by chemical elements

International Nuclear Information System (INIS)

Berlizov, A.N.; Malyuk, I.A.; Tryshyn, V.V.

2008-01-01

Capabilities of black poplar-tree (Populus nigra L.) bark as a biomonitor of atmospheric air pollution by chemical elements were tested against epiphytic lichens Xanthoria parietina (L.) and Physcia adscendens (Fr.). Concentrations of 40 macro and trace elements were determined using epicadmium and instrumental NAA. The data obtained were processed using non-parametric tests. A good correlation was found between concentrations of majority of elements in bark and lichens. On the accumulation capability bark turned out to be competitive with both lichens examined. The main inorganic components of black poplar-tree bark were revealed. A substrate influence on the concentrations of some elements in epiphytic lichens was established. An optimized procedure of bark pre-irradiation treatment was suggested. (author)

In-situ reduced silver nanoparticles on populus fiber and the catalytic application

Energy Technology Data Exchange (ETDEWEB)

Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Wang, Wenheng; Xu, Guangpeng; Liu, Yuanfa; Guo, Jing, E-mail: guojing8161@163.com

2017-02-01

Highlights: • A composite involved in in-situ chelating AgNPs on natural cellulose was prepared. • Polyamidoxime grafted from the cellulose adsorbed Ag+ which was reduced to AgNPs. • The composite exhibits excellent catalytic activity in reducing 4-nitrophenol. - Abstract: One kind of composites involved in silver nanoparticles (AgNPs) loading in-situ on natural populus fiber (PF) matrix was prepared by polyamidoxime (PAO) functionalized the cellulose fiber. In which PAO worked as trapping and stabilizing agents chelating silver ions and made it reduced in-situ to obtain AgNPs by borohydride at room temperature. The synthesized composites were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), thermogravimetric analysis (TGA) and scanning electron microscopy (SEM). Moreover, the composites showed significant catalytic activity 1.87 s{sup −1} g{sup −1} and repeated usability more than 7 cycles in reducing 4-nitrophenol (4-NP) into 4-aminophenol (4-AP) detected by UV–vis spectrophotometer in aqueous solution due to the surface-enhanced immobility and large amount of AgNPs. The natural cellulose fiber provides a green platform to react and support other noble metals for wide catalytic reactions.

Petroleum Contamination and Plant Identity Influence Soil and Root Microbial Communities While AMF Spores Retrieved from the Same Plants Possess Markedly Different Communities.

Science.gov (United States)

Iffis, Bachir; St-Arnaud, Marc; Hijri, Mohamed

2017-01-01

Phytoremediation is a promising in situ green technology based on the use of plants to cleanup soils from organic and inorganic pollutants. Microbes, particularly bacteria and fungi, that closely interact with plant roots play key roles in phytoremediation processes. In polluted soils, the root-associated microbes contribute to alleviation of plant stress, improve nutrient uptake and may either degrade or sequester a large range of soil pollutants. Therefore, improving the efficiency of phytoremediation requires a thorough knowledge of the microbial diversity living in the rhizosphere and in close association with plant roots in both the surface and the endosphere. This study aims to assess fungal ITS and bacterial 16S rRNA gene diversity using high-throughput sequencing in rhizospheric soils and roots of three plant species ( Solidago canadensis, Populus balsamifera , and Lycopus europaeus ) growing spontaneously in three petroleum hydrocarbon polluted sedimentation basins. Microbial community structures of rhizospheric soils and roots were compared with those of microbes associated with arbuscular mycorrhizal fungal (AMF) spores to determine the links between the root and rhizosphere communities and those associated with AMF. Our results showed a difference in OTU richness and community structure composition between soils and roots for both bacteria and fungi. We found that petroleum hydrocarbon pollutant (PHP) concentrations have a significant effect on fungal and bacterial community structures in both soils and roots, whereas plant species identity showed a significant effect only on the roots for bacteria and fungi. Our results also showed that the community composition of bacteria and fungi in soil and roots varied from those associated with AMF spores harvested from the same plants. This let us to speculate that in petroleum hydrocarbon contaminated soils, AMF may release chemical compounds by which they recruit beneficial microbes to tolerate or degrade the

Petroleum Contamination and Plant Identity Influence Soil and Root Microbial Communities While AMF Spores Retrieved from the Same Plants Possess Markedly Different Communities

Directory of Open Access Journals (Sweden)

Bachir Iffis

2017-08-01

Full Text Available Phytoremediation is a promising in situ green technology based on the use of plants to cleanup soils from organic and inorganic pollutants. Microbes, particularly bacteria and fungi, that closely interact with plant roots play key roles in phytoremediation processes. In polluted soils, the root-associated microbes contribute to alleviation of plant stress, improve nutrient uptake and may either degrade or sequester a large range of soil pollutants. Therefore, improving the efficiency of phytoremediation requires a thorough knowledge of the microbial diversity living in the rhizosphere and in close association with plant roots in both the surface and the endosphere. This study aims to assess fungal ITS and bacterial 16S rRNA gene diversity using high-throughput sequencing in rhizospheric soils and roots of three plant species (Solidago canadensis, Populus balsamifera, and Lycopus europaeus growing spontaneously in three petroleum hydrocarbon polluted sedimentation basins. Microbial community structures of rhizospheric soils and roots were compared with those of microbes associated with arbuscular mycorrhizal fungal (AMF spores to determine the links between the root and rhizosphere communities and those associated with AMF. Our results showed a difference in OTU richness and community structure composition between soils and roots for both bacteria and fungi. We found that petroleum hydrocarbon pollutant (PHP concentrations have a significant effect on fungal and bacterial community structures in both soils and roots, whereas plant species identity showed a significant effect only on the roots for bacteria and fungi. Our results also showed that the community composition of bacteria and fungi in soil and roots varied from those associated with AMF spores harvested from the same plants. This let us to speculate that in petroleum hydrocarbon contaminated soils, AMF may release chemical compounds by which they recruit beneficial microbes to tolerate

Petroleum Contamination and Plant Identity Influence Soil and Root Microbial Communities While AMF Spores Retrieved from the Same Plants Possess Markedly Different Communities

Science.gov (United States)

Iffis, Bachir; St-Arnaud, Marc; Hijri, Mohamed

2017-01-01

Phytoremediation is a promising in situ green technology based on the use of plants to cleanup soils from organic and inorganic pollutants. Microbes, particularly bacteria and fungi, that closely interact with plant roots play key roles in phytoremediation processes. In polluted soils, the root-associated microbes contribute to alleviation of plant stress, improve nutrient uptake and may either degrade or sequester a large range of soil pollutants. Therefore, improving the efficiency of phytoremediation requires a thorough knowledge of the microbial diversity living in the rhizosphere and in close association with plant roots in both the surface and the endosphere. This study aims to assess fungal ITS and bacterial 16S rRNA gene diversity using high-throughput sequencing in rhizospheric soils and roots of three plant species (Solidago canadensis, Populus balsamifera, and Lycopus europaeus) growing spontaneously in three petroleum hydrocarbon polluted sedimentation basins. Microbial community structures of rhizospheric soils and roots were compared with those of microbes associated with arbuscular mycorrhizal fungal (AMF) spores to determine the links between the root and rhizosphere communities and those associated with AMF. Our results showed a difference in OTU richness and community structure composition between soils and roots for both bacteria and fungi. We found that petroleum hydrocarbon pollutant (PHP) concentrations have a significant effect on fungal and bacterial community structures in both soils and roots, whereas plant species identity showed a significant effect only on the roots for bacteria and fungi. Our results also showed that the community composition of bacteria and fungi in soil and roots varied from those associated with AMF spores harvested from the same plants. This let us to speculate that in petroleum hydrocarbon contaminated soils, AMF may release chemical compounds by which they recruit beneficial microbes to tolerate or degrade the

Cuticle lipids on heteromorphic leaves of Populus euphratica Oliv. growing in riparian habitats differing in available soil moisture.

Science.gov (United States)

Xu, Xiaojing; Xiao, Lei; Feng, Jinchao; Chen, Ningmei; Chen, Yue; Song, Buerbatu; Xue, Kun; Shi, Sha; Zhou, Yijun; Jenks, Matthew A

2016-11-01

Populus euphratica is an important native tree found in arid regions from North Africa and South Europe to China, and is known to tolerate many forms of environmental stress, including drought. We describe cuticle waxes, cutin and cuticle permeability for the heteromorphic leaves of P. euphratica growing in two riparian habitats that differ in available soil moisture. Scanning electron microscopy revealed variation in epicuticular wax crystallization associated with leaf type and site. P. euphratica leaves are dominated by cuticular wax alkanes, primary-alcohols and fatty acids. The major cutin monomers were 10,16-diOH C 16 :0 acids. Broad-ovate leaves (associated with adult phase growth) produced 1.3- and 1.6-fold more waxes, and 2.1- and 0.9-fold more cutin monomers, than lanceolate leaves (associated with juvenile phase growth) at the wetter site and drier site, respectively. The alkane-synthesis-associated ECERIFERUM1 (CER1), as well as ABC transporter- and elongase-associated genes, were expressed at much higher levels at the drier than wetter sites, indicating their potential function in elevating leaf cuticle lipids in the dry site conditions. Higher cuticle lipid amounts were closely associated with lower cuticle permeability (both chlorophyll efflux and water loss). Our results implicate cuticle lipids as among the xeromorphic traits associated with P. euphratica adult-phase broad-ovate leaves. Results here provide useful information for protecting natural populations of P. euphratica and their associated ecosystems, and shed new light on the functional interaction of cuticle and leaf heterophylly in adaptation to more arid, limited-moisture environments. © 2016 Scandinavian Plant Physiology Society.

Management of Animal Carcass Disposal Sites Using a Biochar Permeable Reactive Barrier and Fast Growth Tree (Populus euramericana: A Field Study in Korea

Directory of Open Access Journals (Sweden)

Jung-Hwan Yoon

2017-03-01

Full Text Available Among many disposal options of animal carcasses due to animal diseases including foot-and-mouth disease (FMD and avian influenza (AI, on-farm burial has been the most frequently used one in Korea. Animal carcasses generate contaminants such as ammonium-N and chloride. This study aimed at testing biochar (BC as a permeable reactive barrier (PRB material in combination with fast growing tree species (Populus euramericana to mitigate groundwater pollution from animal burial sites. For this, a PRB filled with BC was installed and 400 poplar tree (P. euramericana seedlings were planted. Tested BC was obtained from rice husk and its efficiency to mitigate contaminant migration from a burial site of pig carcasses was tested using ammonium-N, chloride, electrical conductivity (EC, and pH as monitoring parameters. Monitoring wells downstream from the burial site were used. Leachates from a monitoring well, three wells inside the burial site close to PRB and three wells outside the burial site close to PRB were sampled and analyzed for ammonium-N, Cl−, EC, and pH for four years from PRB installation. The pH, EC, and ammonium-N of leachate fluctuated during the test period depending on precipitation. pH, EC, and ammonium-N of the leachate samples collected from outside of the burial site close to PRB decreased compared to those from inside of the burial site close to PRB. The concentrations of ammonium-N in the leachate from the monitoring well kept under the threshold value of 10 mg·L−1 for two years from PRB construction. In addition, the growth of poplar plants appeared to be increased via uptaking available N and P released from the burial sites. Achieved results suggest that BC PRBs can be used to in situ mitigate contaminant release from buried animal carcasses.

Different Routes for Conifer- and Sinapaldehyde and Higher Saccharification upon Deficiency in the Dehydrogenase CAD1

OpenAIRE

Van Acker, Rebecca; Dejardin, Annabelle; Desmet, Sandrien; Hoengenaert, Lennart; Vanholme, Ruben; Morreel, Kris; Laurans, Françoise; Kim, Hoon; Santoro, Nicholas; Foster, Cliff; Goeminne, Geert; Legée, Frédéric; Lapierre, Catherine; Pilate, Gilles; Ralph, John

2017-01-01

In the search for renewable energy sources, genetic engineering is a promising strategy to improve plant cell wall composition for biofuel and bioproducts generation. Lignin is a major factor determining saccharification efficiency and, therefore, is a prime target to engineer. Here, lignin content and composition were modified in poplar (Populus tremula 3 Populus alba) by specifically down-regulating CINNAMYL ALCOHOL DEHYDROGENASE1 (CAD1) by a hairpin-RNA-mediated silencing approach, which r...

Unexpected ancestry of Populus seedlings from a hybrid zone implies a large role for postzygotic selection in the maintenance of species.

Science.gov (United States)

Lindtke, Dorothea; Gompert, Zachariah; Lexer, Christian; Buerkle, C Alex

2014-09-01

In the context of potential interspecific gene flow, the integrity of species will be maintained by reproductive barriers that reduce genetic exchange, including traits associated with prezygotic isolation or poor performance of hybrids. Hybrid zones can be used to study the importance of different reproductive barriers, particularly when both parental species and hybrids occur in close spatial proximity. We investigated the importance of barriers to gene flow that act early vs. late in the life cycle of European Populus by quantifying the prevalence of homospecific and hybrid matings within a mosaic hybrid zone. We obtained genotypic data for 11 976 loci from progeny and their maternal parents and constructed a Bayesian model to estimate individual admixture proportions and hybrid classes for sampled trees and for the unsampled pollen parent. Matings that included one or two hybrid parents were common, resulting in admixture proportions of progeny that spanned the whole range of potential ancestries between the two parental species. This result contrasts strongly with the distribution of admixture proportions in adult trees, where intermediate hybrids and each of the parental species are separated into three discrete ancestry clusters. The existence of the full range of hybrids in seedlings is consistent with weak reproductive isolation early in the life cycle of Populus. Instead, a considerable amount of selection must take place between the seedling stage and maturity to remove many hybrid seedlings. Our results highlight that high hybridization rates and appreciable hybrid fitness do not necessarily conflict with the maintenance of species integrity. © 2014 John Wiley & Sons Ltd.

IAA oxidase activity in relation to adventitious root formation on stem cuttings of some forest tree species. [Salix tetrasperma, Populus Robusta, Hibiscus rosa-sinensis, Eucalyptus citriodora

Energy Technology Data Exchange (ETDEWEB)

Bansal, M.P.; Nanda, K.K.

1981-01-01

In rooting tests with stem cuttings, IAA oxidase activity was found to be very high in Salix tetrasperma and Populus 'Robusta' both of which rooted profusely, less in Hibiscus rosa-sinensis which rooted but weakly and insignificant in Eucalyptus citriodora, which did not root at all. Proteins extracted from the stem cuttings of E. citriodora inhibited IAA oxidase activity, and also root formation on hypocotyl cuttings of Phaseolus mungo.

Group Self-Definitions and Religious Collectivities in the 16th Book of the Theodosian Code. Notes on the Term coetus (with a Preliminary Analysis of populus

Directory of Open Access Journals (Sweden)

Alessandro Saggioro

2015-06-01

Full Text Available This essay starts from the well-known definition of populus as well as it appears in some Cicero’s works and aims at analyze the religious significance of coetus, a term strictly connected with the first, at least focusing on the 16th book of the Theodosian Code. This article intends to cast light some transformations and representations of religious groups between Constantinian and Post-Constantinian ages.

Volatile-Mediated within-Plant Signaling in Hybrid Aspen: Required for Systemic Responses.

Science.gov (United States)

Li, Tao; Blande, James D

2017-04-01

Plant volatiles play crucial roles in signaling between plants and their associated community members, but their role in within-plant signaling remains largely unexplored, particularly under field conditions. Using a system comprising the hybrid aspen (Populus tremula x tremuloides) and the specialized herbivorous leaf beetle (Phratora laticollis) and, combining field, greenhouse and laboratory experiments, we examined whether local damage triggered systemic responses in undamaged branches that lack vascular connection to the damaged branches, and to what extent this was caused by airborne volatile signals versus internal signals. An experiment tracing dye through the vasculature of saplings revealed no downward movement of the dye from upper to lower branches, suggesting a lack of vascular connectivity among branches. However, we found under both field and laboratory conditions that herbivore feeding on upper branches elicited volatile emissions by undamaged lower branches. Greenhouse experiments manipulating air contact between damaged and undamaged branches showed that systemic induction of volatiles was almost eliminated when air contact was interrupted. Our findings clearly demonstrate that herbivore-induced volatiles overcome vascular constraints and mediate within-plant signaling. Further, we found that volatile signaling led to induction of different classes of volatiles under field and environment controlled conditions, with a weaker response observed in the field. This difference not only reflects the dose- and time-dependent nature of volatile signaling, but also points out that future studies should focus more on field observations to better understand the ecological role of volatile-mediated within-plant signaling.

Trace element accumulation in woody plants of the Guadiamar Valley, SW Spain: A large-scale phytomanagement case study

International Nuclear Information System (INIS)

Dominguez, Maria T.; Maranon, Teodoro; Murillo, Jose M.; Schulin, Rainer; Robinson, Brett H.

2008-01-01

Phytomanagement employs vegetation and soil amendments to reduce the environmental risk posed by contaminated sites. We investigated the distribution of trace elements in soils and woody plants from a large phytomanaged site, the Guadiamar Valley (SW Spain), 7 years after a mine spill, which contaminated the area in 1998. At spill-affected sites, topsoils (0-25 cm) had elevated concentrations of As (129 mg kg -1 ), Bi (1.64 mg kg -1 ), Cd (1.44 mg kg -1 ), Cu (115 mg kg -1 ), Pb (210 mg kg -1 ), Sb (13.8 mg kg -1 ), Tl (1.17 mg kg -1 ) and Zn (457 mg kg -1 ). Trace element concentrations in the studied species were, on average, within the normal ranges for higher plants. An exception was white poplar (Populus alba), which accumulated Cd and Zn in leaves up to 3 and 410 mg kg -1 respectively. We discuss the results with regard to the phytomanagement of trace element contaminated sites. - There is a low trace element transfer from contaminated soils to the aboveground parts of afforested woody plants under a semi-arid climate

Antioxidant and antimicrobial activities of selected medicinal plants from Algeria

Institute of Scientific and Technical Information of China (English)

Krimat Soumia; Dob Tahar; Lamari Lynda; Boumeridja Saida; Chelghoum Chabane; Metidji Hafidha

2014-01-01

Objective:To evaluate the antioxidant and antimicrobial activity of methanolic extract extracts of selected Algerian medicinal plants. Methods:Antioxidant activity of extracts was evaluated in terms of radical scavenging potential (2,2-diphenyl-1-picrylhydrazyl) and β-carotene bleaching assay. Total phenolic contents and flavonoid contents were also measured. Antimicrobial activity of these plants was examined against Bacillus subtilis, Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa and Candida albicans. Results:The values of IC50 ranged from 4.30 μg/mL to 486.6 μg/mL for the DPPH method, while total antioxidant activity using β-carotene/linoleic acid bleaching assay ranged from 17.03%to 86.13%. It was found that Pistacia lentiscus showed the highest antioxidant capacities using DPPH assay (IC50=4.30 μg/mL), while Populus trimula, Origanum glandulosum, Centaurea calcitrapa, Sysimbrium officinalis and Rhamnus alaternus showed the highest percent of total antioxidant activity inβ-carotene/linoleic acid bleaching assay. Total phenolic and flavonoid contents ranged from 3.96 to 259.65 mg GAE/g extract and from 1.13 to 26.84 mg QE/g extract, respectively. The most interesting antimicrobial activity was obtained from Sysimbrium officinalis, Rhamnus alaternus, Origanum glandulosum, Cupressus sempervirens, Pinus halipensis and Centaurea calcitrapa. Conclusions:The results indicated that the plants tested may be potential sources for isolation of natural antioxidant and antimicrobial compounds.

Ectopic expression of a horseradish peroxidase enhances growth rate and increases oxidative stress resistance in hybrid aspen.

Science.gov (United States)

Kawaoka, Akiyoshi; Matsunaga, Etsuko; Endo, Saori; Kondo, Shinkichi; Yoshida, Kazuya; Shinmyo, Atsuhiko; Ebinuma, Hiroyasu

2003-07-01

We previously demonstrated that overexpression of the horseradish (Armoracia rusticana) peroxidase prxC1a gene stimulated the growth rate of tobacco (Nicotiana tabacum) plants. Here, the cauliflower mosaic virus 35S::prxC1a construct was introduced into hybrid aspen (Populus sieboldii x Populus grandidentata). The growth rate of these transformed hybrid aspen plants was substantially increased under greenhouse conditions. The average stem length of transformed plants was 25% greater than that of control plants. There was no other obvious phenotypic difference between the transformed and control plants. Fast-growing transformed hybrid aspen showed high levels of expression of prxC1a and had elevated peroxidase activities toward guaiacol and ascorbate. However, there was no increase of the endogenous class I ascorbate peroxidase activities in the transformed plants by separate assay and activity staining of native polyacrylamide gel electrophoresis. Furthermore, calli derived from the transformed hybrid aspen grew faster than those from control plants and were resistant to the oxidative stress imposed by hydrogen peroxide. Therefore, enhanced peroxidase activity affects plant growth rate and oxidative stress resistance.

Stem respiration of Populus species in the third year of free-air CO2 enrichment.

Science.gov (United States)

Gielen, Birgit; Scarascia-Mugnozza, Giuseppe; Ceulemans, Reinhart

2003-04-01

Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO2 concentrations. Regarding this question, effects of elevated [CO2] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-11), P. nigra L. (Clone Jean Pourtet), and P. x euramericana (Clone I-214)) was measured in a managed, high-density forest plantation exposed to free-air CO2 enrichment (POPFACE). During the period of measurements, in May of the third year, stem respiration rates were not affected by the FACE treatment. Moreover, FACE did not influence the relationships between respiration rate and both stem temperature and relative growth rate. The results were supported by the reported absence of a FACE-effect on growth and stem wood density.

Rapid continental-scale vegetation response to the Younger Dryas Cool Episode

Science.gov (United States)

Peros, M.; Gajewski, K.; Viau, A.

2006-12-01

The Younger Dryas Cool Episode had rapid and widespread effects on flora and fauna throughout the Americas. Fossil pollen records document how plant communities responded to this event, although such data are generally only representative of changes at local- to regional-scales. We use a new approach to provide insight into vegetation responses to the Younger Dryas at a continental-scale, by focusing on data extracted for a single taxon (Populus poplar, cottonwood, aspen) from pollen diagrams throughout North America. We show that Populus underwent a rapid and continent-wide decline as the climate rapidly cooled and dried. At the termination of the Younger Dryas, Populus underwent another widespread decline, this time in response to competition from boreal and temperate taxa as the climate abruptly warmed. Late glacial-early Holocene pollen assemblages with high quantities of Populus pollen often lack modern analogues and thus confound quantitative paleoclimatic reconstructions; our results provide a context to interpret these assemblages. Furthermore, while Populus may continue to expand in the future in response to human disturbance and increasing temperatures, its sensitivity to competition may eventually put it at risk as global warming accelerates.

Arbuscular mycorrhizal fungi differentially affect the response to high zinc concentrations of two registered poplar clones

International Nuclear Information System (INIS)

Lingua, Guido; Franchin, Cinzia; Todeschini, Valeria; Castiglione, Stefano; Biondi, Stefania; Burlando, Bruno; Parravicini, Valerio; Torrigiani, Patrizia; Berta, Graziella

2008-01-01

The effects of a high concentration of zinc on two registered clones of poplar (Populus alba Villafranca and Populus nigra Jean Pourtet), inoculated or not with two arbuscular mycorrhizal fungi (Glomus mosseae or Glomus intraradices) before transplanting them into polluted soil, were investigated, with special regard to the extent of root colonization by the fungi, plant growth, metal accumulation in the different plant organs, and leaf polyamine concentration. Zinc accumulation was lower in Jean Pourtet than in Villafranca poplars, and it was mainly translocated to the leaves; the metal inhibited mycorrhizal colonization, compromised plant growth, and, in Villafranca, altered the putrescine profile in the leaves. Most of these effects were reversed or reduced in plants pre-inoculated with G. mosseae. Results indicate that poplars are suitable for phytoremediation purposes, confirming that mycorrhizal fungi can be useful for phytoremediation, and underscore the importance of appropriate combinations of plant genotypes and fungal symbionts. - Inoculation with arbuscular mycorrhizal fungi can improve poplar tolerance to heavy metals in phytoremediation programmes

Invasive, naturalized and casual alien plants in southern Africa: a sum­mary based on the Southern African Plant Invaders Atlas (SAPIA

Directory of Open Access Journals (Sweden)

L. Henderson

2007-08-01

Full Text Available The primary objective of this publication is to provide an overview of the species identity, invasion status, geographical extent, and abundance of alien plants in South Africa, Swaziland and Lesotho, based on field records from 1979 to the end of 2000. The dataset is all the species records for the study area in the Southern African Plant Invaders Atlas (SAPIA database during this time period. A total of 548 naturalized and casual alien plant species were catalogued and invasion was recorded almost throughout the study area. Most invasion, in terms of both species numbers and total species abundance, was recorded along the southern, southwestern and eastern coastal belts and in the adjacent interior. This area includes the whole of the Fynbos and Forest Biomes, and the moister eastern parts of the Grassland and Savanna Biomes. This study reinforces previous studies that the Fynbos Biome is the most extensively invaded vegetation type in South Africa but it also shows that parts of Savanna and Grassland are as heavily invaded as parts of the Fynbos. The Fabaceae is prominent in all biomes and Acacia with 17 listed species, accounts for a very large proportion of all invasion. Acacia mearmii was by far the most prominent invasive species in the study area, followed by A. saligna, Lantana camara, A. cyclops, Opuntia ficus-indica. Solarium mauritianum, Populus alba/xcanescens, Melia azedarach, A. dealbata and species of Prosopis.

parámetros en híbridos de populus

Directory of Open Access Journals (Sweden)

O. S. Vallejos-Barra

2007-01-01

Full Text Available La variable diámetro a la altura del pecho, medido a 1.3 m desde el suelo (DAP es lognormal si log(DAP-θ se distribuye normalmente. Para simplificar el ajuste de esta función de densidad de probabilidad (fdp se supone que el parámetro de localización (θ es cero en híbridos de Populus; sin embargo, en algunos casos esta simplificación no asegura el mejor ajuste de la fdp, incidiendo en la representación de la estructura horizontal de los híbridos. El objetivo de la investigación fue calcular el parámetro θ que proporcione el mejor ajuste de la fdp lognormal del DAP en los híbridos I-488 e I-63/51. Para este cálculo se utilizó un algoritmo de búsqueda binaria, que minimizó el estadístico Dn de la prueba de Kolmogorov-Smirnov. 38 % de las parcelas presentó un parámetro θ distinto de cero, originando una mejoría del valor de probabilidad (P entre 0.02 y 55.4 %. Se hizo un análisis de varianza no paramétrico de la variable “√n * Dn”, ya que la variable original y múltiples transformaciones no permitieron aceptar los supuestos del análisis paramétrico. El tipo de ajuste presentó diferencias estadísticas altamente significativas con un valor de 17.1 (P0.800 y las edades un valor de 11.2 (P>0.260.

Stomatal uptake and stomatal deposition of ozone in isoprene and monoterpene emitting plants.

Science.gov (United States)

Fares, S; Loreto, F; Kleist, E; Wildt, J

2008-01-01

Volatile isoprenoids were reported to protect plants against ozone. To understand whether this could be the result of a direct scavenging of ozone by these molecules, the stomatal and non-stomatal uptake of ozone was estimated in plants emitting isoprene or monoterpenes. Ozone uptake by holm oak (Quercus ilex, a monoterpene emitter) and black poplar (Populus nigra, an isoprene emitter) was studied in whole plant enclosures (continuously stirred tank reactors, CSTR). The ozone uptake by plants was estimated measuring ozone concentration at the inlet and outlet of the reactors, after correcting for the uptake of the enclosure materials. Destruction of ozone at the cuticle or at the plant stems was found to be negligible compared to the ozone uptake through the stomata. For both plant species, a relationship between stomatal conductance and ozone uptake was found. For the poplar, the measured ozone losses were explained by the uptake of ozone through the stomata only, and ozone destruction by gas phase reactions with isoprene was negligible. For the oak, gas phase reactions of ozone with the monoterpenes emitted by the plants contributed significantly to ozone destruction. This was confirmed by two different experiments showing a) that in cases of high stomatal conductance but under low CO(2) concentration, a reduction of monoterpene emission was still associated with reduced O(3) uptake; and b) that ozone losses due to the gas phase reactions only can be measured when using the exhaust from a plant chamber to determine the gas phase reactivity in an empty reaction chamber. Monoterpenes can therefore relevantly scavenge ozone at leaf level contributing to protection against ozone.

Urbanization-related changes in European aspen (Populus tremula L.): Leaf traits and litter decomposition

International Nuclear Information System (INIS)

Nikula, Suvi; Vapaavuori, Elina; Manninen, Sirkku

2010-01-01

We investigated foliar and litter responses of European aspen (Populus tremula L.) to urbanization, including factors such as increased temperature, moisture stress and nitrogen (N) deposition. Leaf samples were collected in 2006-2008 from three urban and three rural forest stands in the Helsinki Metropolitan Area, southern Finland, and reciprocal litter transplantations were established between urban and rural sites. Urban leaves exhibited a higher amount of epicuticular waxes and N concentration, and a lower C:N ratio than rural ones, but there was no difference in specific leaf area. Urban litter had a slightly higher N concentration, lower concentrations of lignin and total phenolics, and was more palatable to a macrofaunal decomposer. Moreover, litter decay was faster at the urban site and for urban litter. Urbanization thus resulted in foliar acclimatization in terms of increased amount of epicuticular waxes, as well as in accelerated decomposition of the N-richer leaf litter. - Urbanization can modify leaf traits of aspen and accelerate litter decomposition through changes in litter traits as well as in environmental conditions at the decomposition site.

Microstructural and Topochemical Characterization of Thermally Modified Poplar (Populus cathayaha Cell Wall

Directory of Open Access Journals (Sweden)

Zhe Ling

2015-11-01

Full Text Available Although many studies have been conducted on the wood property and chemical changes caused by thermal modification, little has been reported on the microstructural and topochemical changes occurring in the cell wall during heat treatment. In this study, poplar (Populus cathayaha was treated within a temperature range from 180 to 220 °C for 4 h. Chemical analyses by Fourier transform infrared spectroscopy (FTIR and nuclear magnetic resonance (NMR indicated that heat treatment resulted in deacetylation of hemicelluloses and cleavage of lignin chains, thus generating new carbonyl and phenolic linkages. Transformation of matrix substances contributed to microstructural changes that appeared in clearly distorted and collapsed fiber and vessel walls along with the delamination of compound middle lamella (CML and secondary walls (S, which showed a reduced capability to resist deformation. It was also observed by fluorescence microscopy (FM and scanning electron microscope coupled with energy dispersive X-ray analysis (SEM-EDXA that the concentration of lignin increased, probably because of the degradation of hemicelluloses and the generation of new carbonyl groups. These results on cell wall microstructure and topochemistry can help explain the altered wood properties revealed by dynamic mechanical analysis (DMA and equilibrium moisture content (EMC testing after heat treatment.

Thermo-mechanical Densification of Populus tomentosa var. tomentosa with Low Moisture Content

Directory of Open Access Journals (Sweden)

Dengyun Tu

2014-05-01

Full Text Available This study used thermo-mechanical densification technology to compress low-moisture content (3~5% rapid-growth Populus tomentosa var. tomentosa trees to produce specimens with a low-compression ratio (small volume loss and a uniform density profile and desirable properties. Furthermore, the densified specimens were subjected to post-heat treatment at 180, 190, and 200 °C for 2, 3, and 4 h, respectively. Microscopic examination was performed to observe the changes that occurred in the wood vessels after densification. To determine the influence of post-heat treatment on the set recovery, the specimens were subjected to eight cycles of soaking and drying in 20 °C water and two cycles in boiling water. The density profile tendencies of the densified specimens were in accord with undensified specimens. Microscopic observation revealed that the deformations present in the densified wood resulted from the viscous buckling of cell walls without fracture. The volume of the void areas in the specimens decreased uniformly. Post-heat treatment can decrease compressive deformation, especially when applied at 200 °C for 4 h. After two boiling water cycles of soaking and drying, the densified wood still had a certain set recovery. Therefore, densified wood should be used sparingly in high temperature and high humidity environments.

Soil and vegetation influence in plants natural radionuclides uptake at a uranium mining site

Science.gov (United States)

Charro, E.; Moyano, A.

2017-12-01

The main objective of this work is to investigate the uptake of several radionuclides by the vegetation characteristic of a dehesa ecosystem in uranium mining-impacted soils in Central-West of Spain. The activity concentration for 238U, 226Ra, 210Pb, 232Th, and 224Ra was measured in soil and vegetation samples using a Canberra n-type HPGe gamma-ray spectrometer. Transfer factors of natural radionuclides in different tissues (leaves, branches, twigs, and others) of native plants were evaluated. From these data, the influence of the mine, the physicochemical parameters of the soils and the type of vegetation were analyzed in order to explain the accumulation of radionuclides in the vegetation. A preferential uptake of 210Pb and 226Ra by plants, particularly by trees of the Quercus species (Quercus pyrenaica and Quercus ilex rotundifolia), has been observed, being the transfer factors for 226Ra and 210Pb in these tree species higher than those for other plants (like Pinus pinaster, Rubur ulmifolius and Populus sp.). The analysis of radionuclide contents and transfer factors in the vegetation showed no evidence of influence of the radionuclide concentration in soils, although it could be explained in terms of the type of plants and, in particular, of the tree's species, with special attention to the tree's rate of growth, being higher in slow growing species.

ISOLATION OF MESOPHYLL PROTOPLASTS FROM MEDITERRANEAN WOODY PLANTS FOR THE STUDY OF DNA INTEGRITY UNDER ABIOTIC STRESS

Directory of Open Access Journals (Sweden)

Elena Kuzminsky

2016-08-01

Full Text Available Abiotic stresses have considerable negative impact on Mediterranean plant ecosystems and better comprehension of the genetic control of response and adaptation of trees to global changes is urgently needed. The Single Cell Gel Electrophoresis assay could be considered a good estimator of DNA damage in an individual eukaryotic cell. This method has been mainly employed in animal tissues, because the plant cell wall represents an obstacle for the extraction of nuclei; moreover, in Mediterranean woody species, especially in the sclerophyll plants, this procedure can be quite difficult because of the presence of sclerenchyma and hardened cells. On the other hand, these plants represent an interesting material to be studied because of the ability of these plants to tolerate abiotic stress. For instance, holm oak (Quercus ilex L. has been selected as the model plant to identify critical levels of O3 for Southern European forests. Consequently, a quantitative method for the evaluation of cell injury of leaf tissues of this species is required. Optimal conditions for high-yield nuclei isolation were obtained by using protoplast technology and a detailed description of the method is provided and discussed. White poplar (Populus alba L. was used as an internal control for protoplast isolation. Such a method has not been previously reported in newly fully developed leaves of holm oak. This method combined with Single Cell Gel Electrophoresis assay represents a new tool for testing the DNA integrity of leaf tissues in higher plants under stress conditions.

Local biotic adaptation of trees and shrubs to plant neighbors

Science.gov (United States)

Grady, Kevin C.; Wood, Troy E.; Kolb, Thomas E.; Hersch-Green, Erika; Shuster, Stephen M.; Gehring, Catherine A.; Hart, Stephen C.; Allan, Gerard J.; Whitham, Thomas G.

2017-01-01

Natural selection as a result of plant–plant interactions can lead to local biotic adaptation. This may occur where species frequently interact and compete intensely for resources limiting growth, survival, and reproduction. Selection is demonstrated by comparing a genotype interacting with con- or hetero-specific sympatric neighbor genotypes with a shared site-level history (derived from the same source location), to the same genotype interacting with foreign neighbor genotypes (from different sources). Better genotype performance in sympatric than allopatric neighborhoods provides evidence of local biotic adaptation. This pattern might be explained by selection to avoid competition by shifting resource niches (differentiation) or by interactions benefitting one or more members (facilitation). We tested for local biotic adaptation among two riparian trees, Populus fremontii and Salix gooddingii, and the shrub Salix exigua by transplanting replicated genotypes from multiple source locations to a 17 000 tree common garden with sympatric and allopatric treatments along the Colorado River in California. Three major patterns were observed: 1) across species, 62 of 88 genotypes grew faster with sympatric neighbors than allopatric neighbors; 2) these growth rates, on an individual tree basis, were 44, 15 and 33% higher in sympatric than allopatric treatments for P. fremontii, S. exigua and S. gooddingii, respectively, and; 3) survivorship was higher in sympatric treatments for P. fremontiiand S. exigua. These results support the view that fitness of foundation species supporting diverse communities and dominating ecosystem processes is determined by adaptive interactions among multiple plant species with the outcome that performance depends on the genetic identity of plant neighbors. The occurrence of evolution in a plant-community context for trees and shrubs builds on ecological evolutionary research that has demonstrated co-evolution among herbaceous taxa, and

Association of Pinus banksiana Lamb. and Populus tremuloides Michx. seedling fine roots with Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina).

Science.gov (United States)

Potvin, Lynette R; Richter, Dana L; Jurgensen, Martin F; Dumroese, R Kasten

2012-11-01

Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina, Hydanaceae), commonly regarded as a wood decay fungus, was consistently isolated from bareroot nursery Pinus banksiana Lamb. seedlings. S. brinkmannii was found in ectomycorrhizae formed by Thelephora terrestris Ehrh., Laccaria laccata (Scop.) Cooke, and Suillus luteus (L.) Roussel. In pure culture combinations with sterile P. banksiana and Populus tremuloides Michx. seedlings, S. brinkmannii colonized root cortical cells while not killing seedlings. Colonization by S. brinkmannii appeared to be intracellular but typical endo- or ectomycorrhizae were not formed. The fungus did not decay roots, although it was shown to produce cellulase in enzyme tests. Results suggest a unique association between S. brinkmannii and seedling roots that is neither mycorrhizal nor detrimental; its exact function remains to be elucidated.

Phytoremediation potential of wild plants growing on soil contaminated with heavy metals.

Science.gov (United States)

Čudić, Vladica; Stojiljković, Dragoslava; Jovović, Aleksandar

2016-09-01

Phytoremediation is an emerging technology that employs higher plants to cleanup contaminated environments, including metal-polluted soils. Because it produces a biomass rich in extracted toxic metals, further treatment of this biomass is necessary. The aim of our study was to assess the five-year potential of the following native wild plants to produce biomass and remove heavy metals from a polluted site: poplar (Populus ssp.), ailanthus (Ailanthus glandulosa L.), false acacia (Robinia pseudoacacia L.), ragweed (Artemisia artemisiifolia L.), and mullein (Verbascum thapsus L). Average soil contamination with Pb, Cd, Zn, Cu, Ni, Cr, and As in the root zone was 22,948.6 mg kg-1, 865.4 mg kg-1, 85,301.7 mg kg-1, 3,193.3 mg kg-1, 50.7 mg kg-1, 41.7 mg kg-1,and 617.9 mg kg-1, respectively. We measured moisture and ash content, concentrations of Pb, Cd, Zn, Cu, Ni, Cr, and As in the above-ground parts of the plants and in ash produced by combustion of the plants, plus gross calorific values. The plants' phytoextraction and phytostabilisation potential was evaluated based on their bioconcentration factor (BCF) and translocation factor (TF). Mullein was identified as a hyperaccumulator for Cd. It also showed a higher gross calorific value (19,735 kJ kg-1) than ragweed (16,469 kJ kg-1).The results of this study suggest that mullein has a great potential for phytoextraction and for biomass generation, and that ragweed could be an effective tool of phytostabilisation.

Transcriptional transitions in Nicotiana benthamiana leaves upon induction of oil synthesis by WRINKLED1 homologs from diverse species and tissues.

Science.gov (United States)

Grimberg, Åsa; Carlsson, Anders S; Marttila, Salla; Bhalerao, Rishikesh; Hofvander, Per

2015-08-08

Carbon accumulation and remobilization are essential mechanisms in plants to ensure energy transfer between plant tissues with different functions or metabolic needs and to support new generations. Knowledge about the regulation of carbon allocation into oil (triacylglycerol) in plant storage tissue can be of great economic and environmental importance for developing new high-yielding oil crops. Here, the effect on global gene expression as well as on physiological changes in leaves transiently expressing five homologs of the transcription factor WRINKLED1 (WRI1) originating from diverse species and tissues; Arabidopsis thaliana and potato (Solanum tuberosum) seed embryo, poplar (Populus trichocarpa) stem cambium, oat (Avena sativa) grain endosperm, and nutsedge (Cyperus esculentus) tuber parenchyma, were studied by agroinfiltration in Nicotiana benthamiana. All WRI1 homologs induced oil accumulation when expressed in leaf tissue. Transcriptome sequencing revealed that all homologs induced the same general patterns with a drastic shift in gene expression profiles of leaves from that of a typical source tissue to a source-limited sink-like tissue: Transcripts encoding enzymes for plastid uptake and metabolism of phosphoenolpyruvate, fatty acid and oil biosynthesis were up-regulated, as were also transcripts encoding starch degradation. Transcripts encoding enzymes in photosynthesis and starch synthesis were instead down-regulated. Moreover, transcripts representing fatty acid degradation were up-regulated indicating that fatty acids might be degraded to feed the increased need to channel carbons into fatty acid synthesis creating a futile cycle. RT-qPCR analysis of leaves expressing Arabidopsis WRI1 showed the temporal trends of transcripts selected as 'markers' for key metabolic pathways one to five days after agroinfiltration. Chlorophyll fluorescence measurements of leaves expressing Arabidopsis WRI1 showed a significant decrease in photosynthesis, even though

Transcriptomic analysis of grain amaranth (Amaranthus hypochondriacus using 454 pyrosequencing: comparison with A. tuberculatus, expression profiling in stems and in response to biotic and abiotic stress

Directory of Open Access Journals (Sweden)

Vargas-Ortiz Erandi

2011-07-01

stems of Arabidopsis and black cottonwood (Populus trichocarpa. Conclusions This study represents the first large-scale transcriptomic analysis of A. hypochondriacus, considered to be a highly nutritious and stress-tolerant crop. Numerous genes were found to be induced in response to (abiotic stress, many of which could further the understanding of the mechanisms that contribute to multiple stress-resistance in plants, a trait that has potential biotechnological applications in agriculture.

Growth responses and metal accumulation capabilities of woody plants during the phytoremediation of tannery sludge.

Science.gov (United States)

Shukla, O P; Juwarkar, Asha A; Singh, S K; Khan, Shoeb; Rai, U N

2011-01-01

Five woody plants species (i.e. Terminalia arjuna, Prosopis juliflora, Populus alba, Eucalyptus tereticornis and Dendrocalamus strictus) were selected for phytoremediation and grow on tannery sludge dumps of Common Effluent Treatment Plant (CETP), Unnao (Uttar Pradesh), India. Concentration of toxic metals were observed high in the raw tannery sludge i.e. Fe-1667>Cr-628>Zn-592>Pb-427>Cu-354>Mn-210>Cd-125>Ni-76 mg kg(-1) dw, respectively. Besides, physico-chemical properties of the raw sludge represented the toxic nature to human health and may pose numerous risks to local environment. The growth performances of woody plants were assessed in terms of various growth parameters such as height, diameter at breast height (DBH) and canopy area of plants. All the plant species have the capabilities to accumulate substantial amount of toxic metals in their tissues during the remediation. The ratio of accumulated metals in the plants were found in the order Fe>Cr>Mn>Pb>Zn>Cu>Cd>Ni and significant changes in physico-chemical parameters of tannery sludge were observed after treatment. All the woody plants indicated high bioconcentration factor for different metals in the order Fe>Cr>Mn>Ni>Cd>Pb>Zn>Cu. After one year of phytoremediation, the level of toxic metals were removed from tannery sludge up to Cr (70.22)%, Ni (59.21)%, Cd (58.4)%, Fe (49.75)%, Mn (30.95)%, Zn (22.80)%, Cu (20.46)% and Pb (14.05)%, respectively. Copyright © 2010 Elsevier Ltd. All rights reserved.

Seasonal trends in reduced leaf gas exchange and ozone-induced foliar injury in three ozone sensitive woody plant species

International Nuclear Information System (INIS)

Novak, K.; Schaub, M.; Fuhrer, J.; Skelly, J.M.; Hug, C.; Landolt, W.; Bleuler, P.; Kraeuchi, N.

2005-01-01

Seasonal trends in leaf gas exchange and ozone-induced visible foliar injury were investigated for three ozone sensitive woody plant species. Seedlings of Populus nigra L., Viburnum lantana L., and Fraxinus excelsior L. were grown in charcoal-filtered chambers, non-filtered chambers and open plots. Injury assessments and leaf gas exchange measurements were conducted from June to October during 2002. All species developed typical ozone-induced foliar injury. For plants exposed to non-filtered air as compared to the charcoal-filtered air, mean net photosynthesis was reduced by 25%, 21%, and 18% and mean stomatal conductance was reduced by 25%, 16%, and 8% for P. nigra, V. lantana, and F. excelsior, respectively. The timing and severity of the reductions in leaf gas exchange were species specific and corresponded to the onset of visible foliar injury. - Reductions in leaf gas exchange corresponded to the onset of ozone-induced visible foliar injury for seedlings exposed to ambient ozone exposures

Seasonal trends in reduced leaf gas exchange and ozone-induced foliar injury in three ozone sensitive woody plant species

Energy Technology Data Exchange (ETDEWEB)

Novak, K. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland)]. E-mail: kristopher.novak@wsl.ch; Schaub, M. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Fuhrer, J. [Swiss Federal Research Station for Agroecology and Agriculture FAL, 8046 Zurich (Switzerland); Skelly, J.M. [Department of Plant Pathology, The Pennsylvania State University, University Park, PA 16802 (United States); Hug, C. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Landolt, W. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Bleuler, P. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Kraeuchi, N. [Swiss Federal Institute for Forest, Snow and Landscape Research WSL, Zuercherstrasse 111, 8903 Birmensdorf (Switzerland)

2005-07-15

Seasonal trends in leaf gas exchange and ozone-induced visible foliar injury were investigated for three ozone sensitive woody plant species. Seedlings of Populus nigra L., Viburnum lantana L., and Fraxinus excelsior L. were grown in charcoal-filtered chambers, non-filtered chambers and open plots. Injury assessments and leaf gas exchange measurements were conducted from June to October during 2002. All species developed typical ozone-induced foliar injury. For plants exposed to non-filtered air as compared to the charcoal-filtered air, mean net photosynthesis was reduced by 25%, 21%, and 18% and mean stomatal conductance was reduced by 25%, 16%, and 8% for P. nigra, V. lantana, and F. excelsior, respectively. The timing and severity of the reductions in leaf gas exchange were species specific and corresponded to the onset of visible foliar injury. - Reductions in leaf gas exchange corresponded to the onset of ozone-induced visible foliar injury for seedlings exposed to ambient ozone exposures.

Biochemical, physiological and climatic influence on the emission of isoprenoides from Grey Poplar (Populus x canescens (Aiton) Sm.) and Holm Oak (Quercus ilex L.); Biochemische, physiologische und klimatische Einfluesse auf die Isoprenoidemission der Graupappel (Populus x canescens (Aiton) Sm.) und der Steineiche (Quercus ilex L.)

Energy Technology Data Exchange (ETDEWEB)

Mayrhofer, S.

2007-05-15

Because of their important role for the atmospheric chemistry, global daily and seasonal emission rates of isoprene and monoterpenes have to be estimated with accuracy. Therefore, detailed knowledge of biochemical and physiological processes within the plant metabolism has to be gathered. Afterwards the gained cognitions are used as information for process-based model calculations. The major scope of the work was therefore to enlarge basic knowledge of the regulation of isoprenoid emission, which is known to be dependent on several environmental factors, especially light and temperature. Measurements of diurnal isoprene emission have been performed in parallel on physiological, translational and transcriptional level on leaves of Grey Poplar (Populus x canescens), a strong isoprene emitting species. Additionally, examinations of diurnal monoterpene emission in connection to physiologic and enzymatic processes was conducted in leaves of Holm Oak (Quercus ilex), which emits a large spectrum of monoterpenes. Furthermore a hypothesis was tested, whether isoprene emission may serve the plant as antioxidative protection mechanism in order to overcome oxidative stress. In main parts, the following results have been reached: 1. In the first part of this work, isolation of PcDXR (DXR of Grey Poplar) from a cDNA-Genbank and heterologous expression of the isolated gene was accomplished. 2. Daytime variation of physiological and biochemical parameters of the isoprene emission of Grey Poplar was measured twice on 2 following days in 2 years. All together, measurements have been performed on 8 representative plants. 3. Quantitative RT-PCR elucidated the gene expression pattern of PcDXR and PcISPS in parallel to diurnal gas exchange measurements. Gene expression of PcISPS showed distinct diurnal courses with maximum values on the late morning, whereas PcDXR transcript levels stayed consistent over the day. No short-term influence of PPFD and leaf temperature has been observed on

Tissue- and Cell-Specific Cytokinin Activity in Populus × canescens Monitored by ARR5::GUS Reporter Lines in Summer and Winter.

Science.gov (United States)

Paul, Shanty; Wildhagen, Henning; Janz, Dennis; Teichmann, Thomas; Hänsch, Robert; Polle, Andrea

2016-01-01

Cytokinins play an important role in vascular development. But knowledge on the cellular localization of this growth hormone in the stem and other organs of woody plants is lacking. The main focus of this study was to investigate the occurrence and cellular localization of active cytokinins in leaves, roots, and along the stem of Populus × canescens and to find out how the pattern is changed between summer and winter. An ARR5::GUS reporter construct was used to monitor distribution of active cytokinins in different tissues of transgenic poplar lines. Three transgenic lines tested under outdoor conditions showed no influence of ARR5::GUS reporter construct on the growth performance compared with the wild-type, but one line lost the reporter activity. ARR5::GUS activity indicated changes in the tissue- and cell type-specific pattern of cytokinin activity during dormancy compared with the growth phase. ARR5::GUS activity, which was present in the root tips in the growing season, disappeared in winter. In the stem apex ground tissue, ARR5::GUS activity was higher in winter than in summer. Immature leaves from tissue-culture grown plants showed inducible ARR5::GUS activity. Leaf primordia in summer showed ARR5::GUS activity, but not the expanded leaves of outdoor plants or leaf primordia in winter. In stem cross sections, the most prominent ARR5::GUS activity was detected in the cortex region and in the rays of bark in summer and in winter. In the cambial zone the ARR5::GUS activity was more pronounced in the dormant than in growth phase. The pith and the ray cells adjacent to the vessels also displayed ARR5::GUS activity. In silico analyses of the tissue-specific expression patterns of the whole PtRR type-A family of poplar showed that PtRR10, the closest ortholog to the Arabidopsis ARR5 gene, was usually the most highly expressed gene in all tissues. In conclusion, gene expression and tissue-localization indicate high activity of cytokinins not only in summer, but

Litter Quality of Populus Species as Affected by Free-Air CO2 Enrichment and N-Fertilization

International Nuclear Information System (INIS)

Vermue, E.; Buurman, P.; Hoosbeek, M.R.

2010-01-01

The effect of elevated CO 2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher contents of phenols and benzofurans/pyrans. The difference between replications was at least as large as the effect of treatments, so that no systematic chemical changes were attributable to CO 2 effect or N-fertilization effect. The chemistry of SOM under the various species and treatments did not show significant changes either. The low number of available replicates that is two was clearly insufficient to overcome the effect of spatial variation on litter chemistry and detect small differences in molecular litter chemistry.

Litter Quality of Populus Species as Affected by Free-Air CO2 Enrichment and N-Fertilization

Directory of Open Access Journals (Sweden)

Esther Vermue

2009-01-01

Full Text Available The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher contents of phenols and benzofurans/pyrans. The difference between replications was at least as large as the effect of treatments, so that no systematic chemical changes were attributable to CO2 effect or N-fertilization effect. The chemistry of SOM under the various species and treatments did not show significant changes either. The low number of available replicates that is two was clearly insufficient to overcome the effect of spatial variation on litter chemistry and detect small differences in molecular litter chemistry.

Biochemical and Physiological Studies on the Effects of Senescence Leaves of Populus deltoides on Triticum vulgare

Directory of Open Access Journals (Sweden)

Tejinder Pal Khaket

2014-01-01

Full Text Available Triticum vulgare (Wheat based products are the major dietary source of food in developing countries. In India, it grows in association with boundary plantations of Populus deltoids (poplar. During winter, poplar enters in dormancy which cause a heavy leaf fall at the time of wheat seed germination. Large number of poplar senescence leaves may adversely affect the wheat. Therefore, the present study was performed to examine the effect of senescence poplar leaves on wheat germ and some other biochemical parameters. Seed’s germination rate was determined by measuring root and shoot lengths, percent germination, germination index, and inhibition percentage. Biochemical parameters, namely, pigment, carbohydrate, protein, and phenol content, were estimated. Activities of catalase and polyphenol oxidase which are stress marker enzymes were also measured. Results revealed that germination and other biochemical parameters of wheat were severely affected by senescence poplar leaves even at very low concentration. So, intercropping of poplar along with wheat may be chosen carefully as wheat is the major dietary staple.

Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.

Directory of Open Access Journals (Sweden)

Silvia Dal Santo

Full Text Available BACKGROUND: Expansins are proteins that loosen plant cell walls in a pH-dependent manner, probably by increasing the relative movement among polymers thus causing irreversible expansion. The expansin superfamily (EXP comprises four distinct families: expansin A (EXPA, expansin B (EXPB, expansin-like A (EXLA and expansin-like B (EXLB. There is experimental evidence that EXPA and EXPB proteins are required for cell expansion and developmental processes involving cell wall modification, whereas the exact functions of EXLA and EXLB remain unclear. The complete grapevine (Vitis vinifera genome sequence has allowed the characterization of many gene families, but an exhaustive genome-wide analysis of expansin gene expression has not been attempted thus far. METHODOLOGY/PRINCIPAL FINDINGS: We identified 29 EXP superfamily genes in the grapevine genome, representing all four EXP families. Members of the same EXP family shared the same exon-intron structure, and phylogenetic analysis confirmed a closer relationship between EXP genes from woody species, i.e. grapevine and poplar (Populus trichocarpa, compared to those from Arabidopsis thaliana and rice (Oryza sativa. We also identified grapevine-specific duplication events involving the EXLB family. Global gene expression analysis confirmed a strong correlation among EXP genes expressed in mature and green/vegetative samples, respectively, as reported for other gene families in the recently-published grapevine gene expression atlas. We also observed the specific co-expression of EXLB genes in woody organs, and the involvement of certain grapevine EXP genes in berry development and post-harvest withering. CONCLUSION: Our comprehensive analysis of the grapevine EXP superfamily confirmed and extended current knowledge about the structural and functional characteristics of this gene family, and also identified properties that are currently unique to grapevine expansin genes. Our data provide a model for the

WGDB: Wood Gene Database with search interface.

Science.gov (United States)

Goyal, Neha; Ginwal, H S

2014-01-01

Wood quality can be defined in terms of particular end use with the involvement of several traits. Over the last fifteen years researchers have assessed the wood quality traits in forest trees. The wood quality was categorized as: cell wall biochemical traits, fibre properties include the microfibril angle, density and stiffness in loblolly pine [1]. The user friendly and an open-access database has been developed named Wood Gene Database (WGDB) for describing the wood genes along the information of protein and published research articles. It contains 720 wood genes from species namely Pinus, Deodar, fast growing trees namely Poplar, Eucalyptus. WGDB designed to encompass the majority of publicly accessible genes codes for cellulose, hemicellulose and lignin in tree species which are responsive to wood formation and quality. It is an interactive platform for collecting, managing and searching the specific wood genes; it also enables the data mining relate to the genomic information specifically in Arabidopsis thaliana, Populus trichocarpa, Eucalyptus grandis, Pinus taeda, Pinus radiata, Cedrus deodara, Cedrus atlantica. For user convenience, this database is cross linked with public databases namely NCBI, EMBL & Dendrome with the search engine Google for making it more informative and provides bioinformatics tools named BLAST,COBALT. The database is freely available on www.wgdb.in.

Suitable woody species for a land application alternative to pulp and paper mill wastewater disposal

International Nuclear Information System (INIS)

Aw, M.; Wagner, M.R.

1993-01-01

Saline pulp and paper wastewater produced by Stone Container Corporation in Snowflake, Arizona was used to irrigate 32 different species/genotypes/hybrids of woody plants to test their suitability as an alternative treatment to the current wastewater disposal method. Suitability was measured in terms of survival and height growth. Among the 32 species, six were found to be a very good choice for wastewater treatment and biomass production. Their suitability is further justified by the fact that some have salt tolerance and others fix nitrogen. These species are Tamarix ramosissima, Atriplex canescens, Robinia pseudoacacia, Eleagnus angustifoliz, Ulmus pumila, and Populus deltoides x Populus nigra. Three other species are possible candidates. These include Caragana arborescens, Gleditsia triacanthos and Populus deltoides var. siouxland. In general, conifers performed poorly because of the harsh environment and other silvicultural problems

Ecological aspects of air pollution from an iron-sintering plant at Wawa, Ontario

Energy Technology Data Exchange (ETDEWEB)

Gordon, A G; Gorham, E

1963-01-01

At Wawa, in northern Ontario, vegetation has been damaged severely by sulphur dioxide pollution from an iron-sintering plant. Damage is mainly restricted to a narrow strip northeast from the sinter plant, since southwest winds are strongly predominant. It is traceable from the air for at least 20 miles in this direction and is estimated as severe within 11 miles and very severe within 5 miles. Within about 10 miles NE. From the sinter plant ground flora variety declines markedly, from about 20-40 species per 40 square meter quadrant beyond this distance to 0-1 species within 2 miles of the pollution source. At the same time sulphate in lake and pond waters increases greatly, from normal levels of about 0.2-0.3 milliequivalents per liter to more than 0.5 meq/l within 11 miles NE and up to 2 meq/l within 2 miles NE from the sinter plant. Waters within about 5 miles NE are strongly acid (pH 3.2-3.8), but are not low in calcium. Soluble sulphate in the surface soil rises sharply within about 4 miles NE from the pollution source, where, also, soil erosion is very pronounced, though traceable farther out. The phanerogms most tolerant of air pollution are Polygonum cilinode and Sambucus pubens, which are infrequent in the normal forest vegetation. In quadrant studies along a northeast transect, seedlings of Pinus strobus were not observed within 30 miles from the sinter plant, while those of Picea glauca, P. mariana, and Populus tremuliodes were not recorded within 15 miles.

Woody riparian vegetation response to different alluvial water table regimes

Science.gov (United States)

Shafroth, P.B.; Stromberg, J.C.; Patten, D.T.

2000-01-01

Woody riparian vegetation in western North American riparian ecosystems is commonly dependent on alluvial groundwater. Various natural and anthropogenic mechanisms can cause groundwater declines that stress riparian vegetation, but little quantitative information exists on the nature of plant response to different magnitudes, rates, and durations of groundwater decline. We observed groundwater dynamics and the response of Populus fremontii, Salix gooddingii, and Tamarix ramosissima saplings at 3 sites between 1995 and 1997 along the Bill Williams River, Arizona. At a site where the lowest observed groundwater level in 1996 (-1.97 m) was 1.11 m lower than that in 1995 (-0.86 m), 92-100% of Populus and Salix saplings died, whereas 0-13% of Tamarix stems died. A site with greater absolute water table depths in 1996 (-2.55 m), but less change from the 1995 condition (0.55 m), showed less Populus and Salix mortality and increased basal area. Excavations of sapling roots suggest that root distribution is related to groundwater history. Therefore, a decline in water table relative to the condition under which roots developed may strand plant roots where they cannot obtain sufficient moisture. Plant response is likely mediated by other factors such as soil texture and stratigraphy, availability of precipitation-derived soil moisture, physiological and morphological adaptations to water stress, and tree age. An understanding of the relationships between water table declines and plant response may enable land and water managers to avoid activities that are likely to stress desirable riparian vegetation.

Evaluation of Internal Cracks and Collapse in Poplar Wood (Populus nigra during a Conventional Drying Process with Ultrasonic Inspection

Directory of Open Access Journals (Sweden)

Saeid ESHAGHI

2012-05-01

Full Text Available In this research, internal cracks and collapse of wood, formed during drying process, were measured using ultrasonic inspection. For this purpose, seven poplar (Populus nigra small blocks were dried, according to a time-based schedule. Ultrasonic waves� propagation velocity was measured at both parallel and perpendicular to grain directions, using Sylvatest ultrasound device, during kiln drying process. Results showed that in all dried blocks, waves� propagation velocity in the parallel direction was higher than in the perpendicular direction to grain. Ultrasonic waves� propagation test for non-destructive identification of internal cracks, which occurs in wood during drying process in the parallel direction, was more successful compared to the perpendicular direction. Using ultrasonic waves� propagation test for detection of collapse that occurs in wood during drying process was not useful.

Evaluation of Internal Cracks and Collapse in Poplar Wood (Populus nigra during a Conventional Drying Process with Ultrasonic Inspection

Directory of Open Access Journals (Sweden)

Saeid ESHAGHI

2012-05-01

Full Text Available In this research, internal cracks and collapse of wood, formed during drying process, were measured using ultrasonic inspection. For this purpose, seven poplar (Populus nigra small blocks were dried, according to a time-based schedule. Ultrasonic waves propagation velocity was measured at both parallel and perpendicular to grain directions, using Sylvatest ultrasound device, during kiln drying process. Results showed that in all dried blocks, waves propagation velocity in the parallel direction was higher than in the perpendicular direction to grain. Ultrasonic waves propagation test for non-destructive identification of internal cracks, which occurs in wood during drying process in the parallel direction, was more successful compared to the perpendicular direction. Using ultrasonic waves propagation test for detection of collapse that occurs in wood during drying process was not useful.

The yield of natural trembling aspen (populus tremula L.) stands (northern and eastern anatolia)

International Nuclear Information System (INIS)

Misir, M.; Misir, N.

2013-01-01

Trembling aspen (Populus tremula L.) is one of the most resistant to cold natural species in Turkey. In spite of its importance, there is no research on the yield. Hence, site productivity was determined and yield Table for undisturbed natural trembling aspen stands in Turkey was developed. Data were obtained from a total of 46 plots ranging in age from 17 to 82 years. Yield Table indicates that trembling aspen is very slow growing in young and middle age and Current Annual Increment (CAI) and Mean Annual Increment (MAI) values do not reach its maximum value, even at age 70. This is a proof that trembling aspen is not a fast growing species as expected. The reason for its slow growth is attributed to very short period of growth at very high altitudes. However, in the event of 50 years rotation age, mean annual volume increments of 8.0, 3.6 and 1.1 m3 are estimated for trembling aspen for site classes I, II and III, respectively. At extended rotations, trees of pole sizes could be obtained on all site classes. (author)

Cytospora species from Populus and Salix in China with C. davidiana sp. nov.

Science.gov (United States)

Wang, Yan-Li; Lu, Quan; Decock, Cony; Li, Yong-Xia; Zhang, Xing-Yao

2015-05-01

Poplar and willow plantations have become widespread in China, in order to meet national economic and environmental needs. The emergence of several pathogens is enhanced by climatic change and associated human factors. Species of Cytospora are well-known pathogens on poplar and willow, and cause stem cankers and diebacks. In the present study, we conducted a survey of Cytospora species occurring on Populus spp. and Salix spp. in China. We used morphological examination and phylogenetic inferences, based on the DNA sequence data from the internal transcribed spacer regions (ITS1, 5.8S rDNA, and ITS2) and partial β-tubulin gene, to identify six Cytospora species occurring on poplar and willow. Five of these species belonged to known taxa, viz. Cytospora chrysosperma (asexual state of Valsa sordida), Cytospora translucens (asexual state of Leucostoma translucens), Cytospora fugax (asexual state of Valsa salicina), Cytospora atrocirrhata, and Cytospora kantschavelii. Our study yielded a new species, Cytospora davidiana sp. nov., on poplar. The new species is characterized by typical torsellioid conidiomata. An additional Cytospora sp. 1, which formed a distinct clade in the phylogenetic inferences, remains unnamed; the paucity of available materials prevented phenotypical characterization. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

Comparative genomic sequence analysis of strawberry and other rosids reveals significant microsynteny

Directory of Open Access Journals (Sweden)

Abbott Albert

2010-06-01

Full Text Available Abstract Background Fragaria belongs to the Rosaceae, an economically important family that includes a number of important fruit producing genera such as Malus and Prunus. Using genomic sequences from 50 Fragaria fosmids, we have examined the microsynteny between Fragaria and other plant models. Results In more than half of the strawberry fosmids, we found syntenic regions that are conserved in Populus, Vitis, Medicago and/or Arabidopsis with Populus containing the greatest number of syntenic regions with Fragaria. The longest syntenic region was between LG VIII of the poplar genome and the strawberry fosmid 72E18, where seven out of twelve predicted genes were collinear. We also observed an unexpectedly high level of conserved synteny between Fragaria (rosid I and Vitis (basal rosid. One of the strawberry fosmids, 34E24, contained a cluster of R gene analogs (RGAs with NBS and LRR domains. We detected clusters of RGAs with high sequence similarity to those in 34E24 in all the genomes compared. In the phylogenetic tree we have generated, all the NBS-LRR genes grouped together with Arabidopsis CNL-A type NBS-LRR genes. The Fragaria RGA grouped together with those of Vitis and Populus in the phylogenetic tree. Conclusions Our analysis shows considerable microsynteny between Fragaria and other plant genomes such as Populus, Medicago, Vitis, and Arabidopsis to a lesser degree. We also detected a cluster of NBS-LRR type genes that are conserved in all the genomes compared.

A survey of poplar (populus nigra rust and identification of fungal agent species with conventional and molecular approaches in Maragheh area of Iran.

Directory of Open Access Journals (Sweden)

Seyed Mohsen Damadi

2014-12-01

Full Text Available In a survey for rust diseases in Maragheh area rust symptoms were observed on poplars (Populus nigra in Maragheh city parks and orchards near the city. Uredinia and urediniospores typical of Melampsora were present on the underside of leaves. Paraphyses were clavate with walls evenly thick and Telia, formed on the leaves early in the autumn, were epiphyllous and subepidermal. DNA was extracted from urediniospores and the primers ITS1 and ITS4 were used to amplify the internal transcribed spacer region of the ribosomal DNA. Based on the key provided by Bagyanarayana and the species description by Pei and Shang, and the result of sequencing, the causal agent was identified as Melampsora allii-populina Kelb. Melampsora species are mainly determined based on their morphology, alternate hosts and telial host range. However, in most cases, only one or two spore stages could be found at the time of observation and there is no information of the alternate hosts. This is the first study of poplar rust disease to the species level in the area. Rust disease is likely to be the most important disease on poplar in this area. As poplar rust can cause severe damages to nursery plants and young trees, there must be further research to understand the epidemiology of the rust disease. A key question to be answered is whether the rust goes through a full life-cycle, possible via known alternate host Allium spp. or only uredinial and telial stages are present in the studied area.

Spring leaf flush in aspen (Populus tremuloides) clones is altered by long-term growth at elevated carbon dioxide and elevated ozone concentration

International Nuclear Information System (INIS)

McGrath, Justin M.; Karnosky, David F.; Ainsworth, Elizabeth A.

2010-01-01

Early spring leaf out is important to the success of deciduous trees competing for light and space in dense forest plantation canopies. In this study, we investigated spring leaf flush and how long-term growth at elevated carbon dioxide concentration ([CO 2 ]) and elevated ozone concentration ([O 3 ]) altered leaf area index development in a closed Populus tremuloides (aspen) canopy. This work was done at the Aspen FACE experiment where aspen clones have been grown since 1997 in conditions simulating the [CO 2 ] and [O 3 ] predicted for ∼2050. The responses of two clones were compared during the first month of spring leaf out when CO 2 fumigation had begun, but O 3 fumigation had not. Trees in elevated [CO 2 ] plots showed a stimulation of leaf area index (36%), while trees in elevated [O 3 ] plots had lower leaf area index (-20%). While individual leaf area was not significantly affected by elevated [CO 2 ], the photosynthetic operating efficiency of aspen leaves was significantly improved (51%). There were no significant differences in the way that the two aspen clones responded to elevated [CO 2 ]; however, the two clones responded differently to long-term growth at elevated [O 3 ]. The O 3 -sensitive clone, 42E, had reduced individual leaf area when grown at elevated [O 3 ] (-32%), while the tolerant clone, 216, had larger mature leaf area at elevated [O 3 ] (46%). These results indicate a clear difference between the two clones in their long-term response to elevated [O 3 ], which could affect competition between the clones, and result in altered genotypic composition in future atmospheric conditions. - Spring leaf flush is stimulated by elevated [CO 2 ] and suppressed by elevated [O 3 ] in aspen (Populus tremuloides).

Isolation and functional characterization of JcFT, a FLOWERING LOCUS T (FT) homologous gene from the biofuel plant Jatropha curcas.

Science.gov (United States)

Li, Chaoqiong; Luo, Li; Fu, Qiantang; Niu, Longjian; Xu, Zeng-Fu

2014-05-08

Physic nut (Jatropha curcas L.) is a potential feedstock for biofuel production because Jatropha oil is highly suitable for the production of the biodiesel and bio-jet fuels. However, Jatropha exhibits low seed yield as a result of unreliable and poor flowering. FLOWERING LOCUS T (FT) -like genes are important flowering regulators in higher plants. To date, the flowering genes in Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an FT homolog was isolated from Jatropha and designated as JcFT. Sequence analysis and phylogenetic relationship of JcFT revealed a high sequence similarity with the FT genes of Litchi chinensis, Populus nigra and other perennial plants. JcFT was expressed in all tissues of adult plants except young leaves, with the highest expression level in female flowers. Overexpression of JcFT in Arabidopsis and Jatropha using the constitutive promoter cauliflower mosaic virus 35S or the phloem-specific promoter Arabidopsis SUCROSE TRANSPORTER 2 promoter resulted in an extremely early flowering phenotype. Furthermore, several flowering genes downstream of JcFT were up-regulated in the JcFT-overexpression transgenic plant lines. JcFT may encode a florigen that acts as a key regulator in flowering pathway. This study is the first to functionally characterize a flowering gene, namely, JcFT, in the biofuel plant Jatropha.

Evaluation of Populus and Salix continuously irrigated with landfill leachate II. soils and early tree development.

Science.gov (United States)

Zalesny, Ronald S; Bauer, Edmund O

2007-01-01

Soil contaminant levels and early tree growth data are helpful for assessing phytoremediation systems. Populus (DN17, DN182, DN34, NM2, and NM6) and Salix (94003, 94012, S287, S566, and SX61) genotypes were irrigated with landfill leachate or municipal water and tested for differences in (1) element concentrations (P, K, Ca, Mg, S, Zn, B, Mn, Fe, Cu, Al, and Na) of a topsoil layer and a layer of sand in tanks with a cover crop of trees or no trees and (2) height, diameter, volume, and dry mass of leaves, stems, and roots. Trees were irrigated with leachate or water during the final 12 wk of the 18-wk study. Differences in most soil element concentrations were negligible (P > 0.05) for irrigation treatments and cover main effects. Phosphorous, K, Mg, S, Zn, Mn, Fe, and Al concentrations were greater in topsoil than sand (P = 0.0011 for Mg; P tree yield. From a practical standpoint, these results may be used as a baseline for the development of future remediation systems.

Stem respiration of Populus species in the third year of free-air CO{sub 2} enrichment

Energy Technology Data Exchange (ETDEWEB)

Bielen, B.; Geulemans, R. [Univ. of Antwerp, Dept. of Biology, Research Group of Plant and Vegetation Ecology, Wilrijk (Belgium); Scarascia-Mugnozza, G. [Univ. degli Studi della Tuscia, Dept. of Forest Environment and Resources, Viterbo (Italy)

2003-04-01

Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO{sub 2} concentrations. Regarding this question, effects of elevated [CO{sub 2}] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-11), P. nigra L. (Clone Jean Pourtet), and P. x euramericana (Clone I-214)) was measured in a managed, high-density forest plantation exposed to free-air CO{sub 2} enrichment (POPFACE). During the period of measurements, in May of the third year, stem respiration rates were not affected by the FACE treatment. Moreover, FACE did not influence the relationships between respiration rate and both stem temperature and relative growth rate. The results were supported by the reported absence of a FACE-effect on growth and stem wood density. (au)

Biotechnology and genetic optimization of fast-growing hardwoods

Energy Technology Data Exchange (ETDEWEB)

Garton, S.; Syrkin-Wurtele, E.; Griffiths, H.; Schell, J.; Van Camp, L.; Bulka, K. (NPI, Salt Lake City, UT (United States))

1991-02-01

A biotechnology research program was initiated to develop new clones of fast-growing Populus clones resistant to the herbicide glyphosate and resistant to the leaf-spot and canker disease caused by the fungus Septoria musiva. Glyphosate-resistant callus was selected from stem segments cultured in vitro on media supplemented with the herbicide. Plants were regenerated from the glyphosate-resistant callus tissue. A portion of plants reverted to a glyphosate susceptible phenotype during organogenesis. A biologically active filtrate was prepared from S. musiva and influenced fresh weight of Populus callus tissue. Disease-resistant plants were produced through somaclonal variation when shoots developed on stem internodes cultured in vitro. Plantlets were screened for disease symptoms after spraying with a suspension of fungal spores. A frequency of 0.83 percent variant production was observed. Genetically engineered plants were produced after treatment of plant tissue with Agrobacterium tumefasciens strains carrying plasmid genes for antibiotic resistance. Transformers were selected on media enriched with the antibiotic, kanamycin. Presence of foreign DNA was confirmed by Southern blot analysis. Protoplasts of popular were produced but did not regenerate into plant organs. 145 refs., 12 figs., 36 tabs.

Dendroclimatic potential of plains cottonwood (Populus deltoides subsp. monilifera) from the Northern Great Plains, USA

Science.gov (United States)

Edmonson, Jesse; Friedman, Jonathan; Meko, David; Touchan, Ramzi; Scott, Julian; Edmonson, Alan

2014-01-01

A new 368-year tree-ring chronology (A.D. 1643–2010) has been developed in western North Dakota using plains cottonwood (Populus deltoides subsp. monilifera) growing on the relatively undisturbed floodplain of the Little Missouri River in the North Unit of Theodore Roosevelt National Park. We document many slow-growing living trees between 150–370 years old that contradict the common understanding that cottonwoods grow fast and die young. In this northern location, cottonwood produces distinct annual rings with dramatic interannual variability that strongly crossdate. The detrended tree-ring chronology is significantly positively correlated with local growing season precipitation and soil moisture conditions (r  =  0.69). This time series shows periods of prolonged low radial tree growth during the known droughts of the instrumental record (e.g. 1931–1939 and 1980–1981) and also during prehistory (e.g. 1816–1823 and 1856–1865) when other paleoclimate studies have documented droughts in this region. Tree rings of cottonwood will be a useful tool to help reconstruct climate, streamflow, and the floodplain history of the Little Missouri River and other northern river systems.

Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China.

Directory of Open Access Journals (Sweden)

Xuemin He

Full Text Available One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N. This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1 were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (P<0.05, whereas low N deposition significantly increased the soil respiration rate by approximately 66.7±2.7% (P<0.05. These differences were clearer in the final growth stage (September. The different levels of N deposition had little effect on soil moisture, whereas N deposition significantly increased the soil temperature in the 0-5 cm layer (P<0.05. These results suggest that in the desert ecosystem of the Ebinur Lake area, N deposition indirectly changes the soil respiration rate by altering soil properties.

Proteome analysis reveals an energy-dependent central process for Populus×canadensis seed germination.

Science.gov (United States)

Zhang, Hong; Zhou, Ke-Xin; Wang, Wei-Qing; Liu, Shu-Jun; Song, Song-Quan

2017-06-01

Poplar (Populus×canadensis) seeds rapidly germinated in darkness at 10, 15, and 20°C and reached 50% seed germination after about 22, 4.5, and 3.5h, respectively. Germination of poplar seeds was markedly inhibited by abscisic acid (ABA) at 50μM and cycloheximide (CHX) at 100μM, and these inhibitive roles were temperature-dependent. In the present study, mature poplar seeds were used to investigate the differentially changed proteome of seeds germinating in water, ABA, and CHX. A total of 130 protein spots showed a significant change (1.5-fold increase/decrease, Pgermination of poplar seeds is closely related with the increase in those proteins involved in amino acid and lipid metabolism, the tricarboxylic acid cycle and pentose phosphate pathway, protein synthesis and destination, cell defense and rescue, and degradation of storage proteins. ABA and CHX inhibit the germination of poplar seeds by decreasing the protein abundance associated with protein proteolysis, protein folding, and storage proteins. We conclude that poplar seed germination is an energy-dependent active process, and is accompanied by increasing amino acid activation, protein synthesis and destination, as well as cell defense and rescue, and degradation of storage proteins. Copyright © 2017 Elsevier GmbH. All rights reserved.

Changes in lignocellulosic supramolecular and ultrastructure during dilute acid pretreatment of Populus and switchgrass

International Nuclear Information System (INIS)

Foston, Marcus; Ragauskas, Art J.

2010-01-01

Dilute acid pretreatment (DAP) is commonly employed prior to enzymatic deconstruction of cellulose to increase overall sugar and subsequent ethanol yields from downstream bioconversion processes. Typically optimization of pretreatment is evaluated by determining hemicellulose removal, subsequent reactivity towards enzymatic deconstruction, and recoverable polysaccharide yields. In this study, the affect of DAP on the supramolecular and ultrastructure of lignocellulosic biomass was evaluated. A series of dilute acidic pretreatments, employing ∼0.10-0.20 mol/m 3 H 2 SO 4 at ∼160-180 o C, for varying residence times were conducted on both Populus and switchgrass samples. The untreated and pretreated biomass samples were characterized by carbohydrate and lignin analysis, gel permeation chromatography (GPC) and 13 C cross polarization magic angle spinning (CPMAS) NMR spectroscopy. GPC analysis shows a reduction in the molecular weight of cellulose and change in its polydispersity index (PDI) with increasing residence time, indicating that pretreatment is actually degrading the cellulose chains. 13 C CPMAS and non-linear line-fitting of the C 4 region in the carbon spectrum of the isolated cellulose not only showed that the crystallinity index increases with residence time, but that the lateral fibril dimension (LFD) and lateral fibril aggregate dimension (LFAD) increase as well.

Characterising the water use and hydraulic properties of riparian ...

African Journals Online (AJOL)

2018-04-10

Apr 10, 2018 ... Invasive alien plants (IAPs) pose a serious threat to the already limited water resources ... impacts of key species such as Populus canescens (P. canescens) ..... mearnsii): implications for the link between removal of invading.

Development and bin mapping of a Rosaceae Conserved Ortholog Set (COS of markers

Directory of Open Access Journals (Sweden)

Kozik Alex

2009-01-01

Full Text Available Abstract Background Detailed comparative genome analyses within the economically important Rosaceae family have not been conducted. This is largely due to the lack of conserved gene-based molecular markers that are transferable among the important crop genera within the family [e.g. Malus (apple, Fragaria (strawberry, and Prunus (peach, cherry, apricot and almond]. The lack of molecular markers and comparative whole genome sequence analysis for this family severely hampers crop improvement efforts as well as QTL confirmation and validation studies. Results We identified a set of 3,818 rosaceaous unigenes comprised of two or more ESTs that correspond to single copy Arabidopsis genes. From this Rosaceae Conserved Orthologous Set (RosCOS, 1039 were selected from which 857 were used for the development of intron-flanking primers and allele amplification. This led to successful amplification and subsequent mapping of 613 RosCOS onto the Prunus TxE reference map resulting in a genome-wide coverage of 0.67 to 1.06 gene-based markers per cM per linkage group. Furthermore, the RosCOS primers showed amplification success rates from 23 to 100% across the family indicating that a substantial part of the RosCOS primers can be directly employed in other less studied rosaceaous crops. Comparisons of the genetic map positions of the RosCOS with the physical locations of the orthologs in the Populus trichocarpa genome identified regions of colinearity between the genomes of Prunus-Rosaceae and Populus-Salicaceae. Conclusion Conserved orthologous genes are extremely useful for the analysis of genome evolution among closely and distantly related species. The results presented in this study demonstrate the considerable potential of the mapped Prunus RosCOS for genome-wide marker employment and comparative whole genome studies within the Rosaceae family. Moreover, these markers will also function as useful anchor points for the genome sequencing efforts currently

Development and bin mapping of a Rosaceae Conserved Ortholog Set (COS) of markers.

Science.gov (United States)

Cabrera, Antonio; Kozik, Alex; Howad, Werner; Arus, Pere; Iezzoni, Amy F; van der Knaap, Esther

2009-11-29

Detailed comparative genome analyses within the economically important Rosaceae family have not been conducted. This is largely due to the lack of conserved gene-based molecular markers that are transferable among the important crop genera within the family [e.g. Malus (apple), Fragaria (strawberry), and Prunus (peach, cherry, apricot and almond)]. The lack of molecular markers and comparative whole genome sequence analysis for this family severely hampers crop improvement efforts as well as QTL confirmation and validation studies. We identified a set of 3,818 rosaceaous unigenes comprised of two or more ESTs that correspond to single copy Arabidopsis genes. From this Rosaceae Conserved Orthologous Set (RosCOS), 1039 were selected from which 857 were used for the development of intron-flanking primers and allele amplification. This led to successful amplification and subsequent mapping of 613 RosCOS onto the Prunus TxE reference map resulting in a genome-wide coverage of 0.67 to 1.06 gene-based markers per cM per linkage group. Furthermore, the RosCOS primers showed amplification success rates from 23 to 100% across the family indicating that a substantial part of the RosCOS primers can be directly employed in other less studied rosaceaous crops. Comparisons of the genetic map positions of the RosCOS with the physical locations of the orthologs in the Populus trichocarpa genome identified regions of colinearity between the genomes of Prunus-Rosaceae and Populus-Salicaceae. Conserved orthologous genes are extremely useful for the analysis of genome evolution among closely and distantly related species. The results presented in this study demonstrate the considerable potential of the mapped Prunus RosCOS for genome-wide marker employment and comparative whole genome studies within the Rosaceae family. Moreover, these markers will also function as useful anchor points for the genome sequencing efforts currently ongoing in this family as well as for comparative QTL

Sapflow of hybrid poplar (Populus nigra L.xP. maximowiczii A. Henry 'NM6') during phytoremediation of landfill leachate

Energy Technology Data Exchange (ETDEWEB)

Zalesny, Ronald S.; Wiese, Adam H.; Bauer, Edmund O.; Riemenschneider, Don E. [USDA Forest Service, North Central Research Station, Forestry Sciences Laboratory, 5985 Highway K, Rhinelander, WI 54501 (United States)

2006-08-15

Poplars are ideal for phytoremediation because of their high water usage, fast growth, and deep root systems. We measured in 2002 and 2003 the sapflow of hybrid poplars (Populus nigra L.xP. maximowiczii A. Henry 'NM6') planted in 1999 for phytoremediation of a landfill in Rhinelander, WI, USA (45.6{sup o}N, 89.4{sup o}W). Mean sap velocity per tree was 100+/-10 and 120+/-10{mu}ms{sup -1} for 2002 and 2003, respectively. Mean sapflow per tree was 1.4000+/-0.1698 and 5.6760+/-0.2997kgh{sup -1} for 2002 and 2003, respectively. Sapflow was negatively correlated with temperature, wind speed, precipitation, and vapor pressure deficit for both years (0.002

Effects on the forest of sulfur dioxide from a sulfur fire near Edson, Alberta

Energy Technology Data Exchange (ETDEWEB)

Hocking, D

1975-01-01

Sulfur was burnt in a sanitary landfill during August 9 and 10, 1974. Resulting sulfur dioxide impinged on the surrounding mixed forest for 29 h. About 4 ha of forest displayed visible injury symptoms of varying intensity soon after. However, only .4 ha remained permanently injured the next season. Here, white spruce (Picea glauca (Moench) Voss) and scattered individuals of balsam poplar (Populus balsamifera L.), alder (Alnus tenuifolia Nutt.), and trembling aspen (Populus tremuloides Michx.) were killed. This report describes the extent of injury, relative sensitivities of affected plant species, and recovery in the spring in 1975.

Spectroscopy and atomic force microscopy of biomass.

Science.gov (United States)

Tetard, L; Passian, A; Farahi, R H; Kalluri, U C; Davison, B H; Thundat, T

2010-05-01

Scanning probe microscopy has emerged as a powerful approach to a broader understanding of the molecular architecture of cell walls, which may shed light on the challenge of efficient cellulosic ethanol production. We have obtained preliminary images of both Populus and switchgrass samples using atomic force microscopy (AFM). The results show distinctive features that are shared by switchgrass and Populus. These features may be attributable to the lignocellulosic cell wall composition, as the collected images exhibit the characteristic macromolecular globule structures attributable to the lignocellulosic systems. Using both AFM and a single case of mode synthesizing atomic force microscopy (MSAFM) to characterize Populus, we obtained images that clearly show the cell wall structure. The results are of importance in providing a better understanding of the characteristic features of both mature cells as well as developing plant cells. In addition, we present spectroscopic investigation of the same samples.

Root growth and physiology of potted and field-grown trembling aspen exposed to tropospheric ozone

Science.gov (United States)

M.D. Coleman; R.E. Dickson; J.G. Isebrands; D.F. Karnosky

1996-01-01

We studied root growth and respiration of potted plants and field-grown aspen trees (Populus tremuloides Michx.) exposed to ambient or twice-ambient ozone. Root dry weight of potted plants decreased up to 45% after 12 weeks of ozone treatment, and root system respiration decreased by 27%. The ozone-induced decrease in root system respiration of...

Community analysis of plant biomass-degrading microorganisms from Obsidian Pool, Yellowstone National Park.

Science.gov (United States)

Vishnivetskaya, Tatiana A; Hamilton-Brehm, Scott D; Podar, Mircea; Mosher, Jennifer J; Palumbo, Anthony V; Phelps, Tommy J; Keller, Martin; Elkins, James G

2015-02-01

The conversion of lignocellulosic biomass into biofuels can potentially be improved by employing robust microorganisms and enzymes that efficiently deconstruct plant polysaccharides at elevated temperatures. Many of the geothermal features of Yellowstone National Park (YNP) are surrounded by vegetation providing a source of allochthonic material to support heterotrophic microbial communities adapted to utilize plant biomass as a primary carbon and energy source. In this study, a well-known hot spring environment, Obsidian Pool (OBP), was examined for potential biomass-active microorganisms using cultivation-independent and enrichment techniques. Analysis of 33,684 archaeal and 43,784 bacterial quality-filtered 16S rRNA gene pyrosequences revealed that archaeal diversity in the main pool was higher than bacterial; however, in the vegetated area, overall bacterial diversity was significantly higher. Of notable interest was a flooded depression adjacent to OBP supporting a stand of Juncus tweedyi, a heat-tolerant rush commonly found growing near geothermal features in YNP. The microbial community from heated sediments surrounding the plants was enriched in members of the Firmicutes including potentially (hemi)cellulolytic bacteria from the genera Clostridium, Anaerobacter, Caloramator, Caldicellulosiruptor, and Thermoanaerobacter. Enrichment cultures containing model and real biomass substrates were established at a wide range of temperatures (55-85 °C). Microbial activity was observed up to 80 °C on all substrates including Avicel, xylan, switchgrass, and Populus sp. Independent of substrate, Caloramator was enriched at lower (65 °C) temperatures.

Energy dynamics in Populus deltoides G3 Marsh agroforestry systems in eastern India

International Nuclear Information System (INIS)

Chaturvedi, O.P.; Das, D.K.

2005-01-01

Energy efficiency of Populus deltoides G 3 Marsh agroforestry of a 3-year-old system with intercropping of maize-wheat in crop I and pigeonpea in crop II and of a 9-year-old system with turmeric, a shade loving crop was studied at Pusa, Bihar in eastern India. Energy fixation, storage, net allocation in agronomic yield and energy released and exit from the 9-year-old system was 1.53, 4.30, 0.43 and 3.37 times in crop I and 1.67, 4.60, 0.53 and 3.30 times in crop II of the 3-year-old agroforestry system. The energy conservation efficiency in the 9-year-old system was higher (1.91%) as compared to crop I (1.24%) and crop II (1.15%) of the 3-year-old agroforestry system. The energy accumulation ratio in the 9-year-old system was 2.82 and 2.77 times higher in crop I and crop II, respectively, of the 3-year-old agroforestry system. The 3-year-old agroforestry system showed lower energy accumulation ratio resulting from less energy accumulation in perennial turnover in the from of leaf of tree and agricultural crops. The crop II system of the 3-year-old poplar agroforestry was more efficient system of management due to higher quanta of energy and higher cash return but one has to opt for shade loving intercrop turmeric with increase in age of the poplar plantation and more canopy closure

Tandem duplications of a degenerated GTP-binding domain at the origin of GTPase receptors Toc159 and thylakoidal SRP

International Nuclear Information System (INIS)

Hernandez Torres, Jorge; Maldonado, Monica Alexandra Arias; Chomilier, Jacques

2007-01-01

The evolutionary origin of some nuclear encoded proteins that translocate proteins across the chloroplast envelope remains unknown. Therefore, sequences of GTPase proteins constituting the Arabidopsis thaliana translocon at the outer membrane of chloroplast (atToc) complexes were analyzed by means of HCA. In particular, atToc159 and related proteins (atToc132, atToc120, and atToc90) do not have proven homologues of prokaryotic or eukaryotic ancestry. We established that the three domains commonly referred to as A, G, and M originate from the GTPase G domain, tandemly repeated, and probably evolving toward an unstructured conformation in the case of the A domain. It resulted from this study a putative common ancestor for these proteins and a new domain definition, in particular the splitting of A into three domains (A1, A2, and A3), has been proposed. The family of Toc159, previously containing A. thaliana and Pisum sativum, has been extended to Medicago truncatula and Populus trichocarpa and it has been revised for Oryza sativa. They have also been compared to GTPase subunits involved in the cpSRP system. A distant homology has been revealed among Toc and cpSRP GTP-hydrolyzing proteins of A. thaliana, and repetitions of a GTPase domain were also found in cpSRP protein receptors, by means of HCA analysis

Phytotoxicity of polycyclic aromatic hydrocarbons to willow trees

Energy Technology Data Exchange (ETDEWEB)

Thygesen, R.S.; Trapp, S. [Environment and Resources DTU, Technical Univ. of Denmark, Lyngby (Denmark)

2002-07-01

The toxicity of PAH to willow trees (Salix alba, S. viminalis, S. viminalis x schwerinii) was investigated. Willow cuttings were grown in PAH-saturated hydroponic solution (naphthalene NAP, phenanthrene PHEN and benzo(a)pyrene BaP). Toxicity was related to aqueous solubility and was highest for NAP. PHEN did not show significant effects, except in one case. Exposure of trees to BaP showed no effect in two cases, but increased transpiration and growth in two others. High dosages of NAP were fatal for the trees, the lowest dosage significantly stimulated growth. Soil samples were taken from several PAH contaminated sites, among them gas works sites and a former sludge basin. The PAH contents ranged from 1.76 mg/kg to 1451 mg/kg. None of the soils was lethally toxic to the trees, and difference between growth in control soils and growth in PAH contaminated soils was not apparent. Growth and water use efficiency were positively, but not significantly correlated to the PAH content of the soils. Outdoor growth of willows and poplars on the former sludge basin in Valby was monitored, with willows growing faster than poplars (Populus trichocarpa). Phytotoxic effects could be observed at some willows at the Valby sludge basin, but it is not sure whether these effects can be contributed to PAH. (orig.)

Differential transcriptome analysis between Populus and its synthesized allotriploids driven by second-division restitution.

Science.gov (United States)

Cheng, Shiping; Huang, Zhen; Li, Yun; Liao, Ting; Suo, Yujing; Zhang, Pingdong; Wang, Jun; Kang, Xiangyang

2015-12-01

In this report, we compared transcriptomic differences between a synthetic Populus section Tacamahaca triploid driven by second-division restitution and its parents using a high-throughput RNA-seq method. A total of 4,080 genes were differentially expressed between the high-growth vigor allotriploids (SDR-H) and their parents, and 719 genes were non-additively expressed in SDR-H. Differences in gene expression between the allotriploid and male parent were more significant than those between the allotriploid and female parent, which may be caused by maternal effects. We observed 3,559 differentially expressed genes (DEGs) between the SDR-H and male parent. Notably, the genes were mainly involved in metabolic process, cell proliferation, DNA methylation, cell division, and meristem and developmental growth. Among the 1,056 DEGs between SDR-H and female parent, many genes were associated with metabolic process and carbon utilization. In addition, 1,789 DEGs between high- and low-growth vigor allotriploid were mainly associated with metabolic process, auxin poplar transport, and regulation of meristem growth. Our results indicated that the higher poplar ploidy level can generate extensive transcriptomic diversity compared with its parents. Overall, these results increased our understanding of the driving force for phenotypic variation and adaptation in allopolyploids driven by second-division restitution. © 2015 Institute of Botany, Chinese Academy of Sciences.

Leaf water relations and sapflow in eastern cottonwood (Populus deltoides Bartr.) trees planted for phytoremediation of a groundwater pollutant

Science.gov (United States)

James M. Vose; Wayne T. Swank; Gregory J. Harvey; Barton D. Clinton; Christine Sobek

2000-01-01

Plants that remediate groundwater pollutants may offer a feasible alternative to the traditional and more expensive practices. Because its success depends on water use, this approach requires a complete understanding of species-specific transpiration patterns. The objectives of this study were (1) to quantify tree and stand-level transpiration in two age classes (whips...

The influence of liming on soil chemical properties and on the alleviation of manganese and copper toxicity in Juglans regia, Robinia pseudoacacia, Eucalyptus sp. and Populus sp. plantations.

Science.gov (United States)

Chatzistathis, T; Alifragis, D; Papaioannou, A

2015-03-01

Juglans regia, Robinia pseudoacacia, Eucalyptus sp. and Populus sp. plantations, suffering from Mn and Cu toxicity, were limed in order to reduce Cu and Mn solubility in soil. The purposes of the present work were: i) to study the changes in soil chemical properties after the addition of CaCO3, ii) to investigate the influence of liming on the reduction of Mn and Cu toxicity. After the addition of CaCO3 (three applications, during three successive years), pH and CaCO3 content were significantly increased, while organic C and N were significantly reduced. Exchangeable Ca concentrations have been slightly, or significantly, increased, while those of Mg have been decreased; in addition, ratios Ca/Mg and C/N have been significantly increased after liming. Impressive reductions of DTPA extractable Cu and Mn concentrations (more than 10 times in most cases) were recorded. It was also found that trees without Mn and Cu toxicity symptoms (healthy tress) before liming did not have, in many cases, significantly greater leaf Mn, Cu and Fe concentrations, than trees after soil liming (all the trees were healthy). This probably happened because excess Mn and Cu quantities had been accumulated into their root system. Finally, leaf Mn, Cu and Zn concentrations of trees suffering from toxicity were significantly decreased after soil liming, while leaf Fe concentrations, in all the plant species studied, were increased. Copyright © 2014 Elsevier Ltd. All rights reserved.

Modelling the growth of Populus species using Ecosystem Demography (ED) model

Science.gov (United States)

Wang, D.; Lebauer, D. S.; Feng, X.; Dietze, M. C.

2010-12-01

Hybrid poplar plantations are an important source being evaluated for biomass production. Effective management of such plantations requires adequate growth and yield models. The Ecosystem Demography model (ED) makes predictions about the large scales of interest in above- and belowground ecosystem structure and the fluxes of carbon and water from a description of the fine-scale physiological processes. In this study, we used a workflow management tool, the Predictive Ecophysiological Carbon flux Analyzer (PECAn), to integrate literature data, field measurement and the ED model to provide predictions of ecosystem functioning. Parameters for the ED ensemble runs were sampled from the posterior distribution of ecophysiological traits of Populus species compiled from the literature using a Bayesian meta-analysis approach. Sensitivity analysis was performed to identify the parameters which contribute the most to the uncertainties of the ED model output. Model emulation techniques were used to update parameter posterior distributions using field-observed data in northern Wisconsin hybrid poplar plantations. Model results were evaluated with 5-year field-observed data in a hybrid poplar plantation at New Franklin, MO. ED was then used to predict the spatial variability of poplar yield in the coterminous United States (United States minus Alaska and Hawaii). Sensitivity analysis showed that root respiration, dark respiration, growth respiration, stomatal slope and specific leaf area contribute the most to the uncertainty, which suggests that our field measurements and data collection should focus on these parameters. The ED model successfully captured the inter-annual and spatial variability of the yield of poplar. Analyses in progress with the ED model focus on evaluating the ecosystem services of short-rotation woody plantations, such as impacts on soil carbon storage, water use, and nutrient retention.

Effects of phytoextraction on heavy metal concentrations and pH of pore-water of biosolids determined using an in situ sampling technique

Energy Technology Data Exchange (ETDEWEB)

Huynh, T.T. [Applied Ecology Research Group, School of Botany, University of Melbourne, Parkville, VIC 3010 (Australia)], E-mail: t.huynh11@pgrad.unimelb.edu.au; Laidlaw, W.S. [Applied Ecology Research Group, School of Botany, University of Melbourne, Parkville, VIC 3010 (Australia); Singh, B. [Faculty of Agriculture, Food and Natural Resources, University of Sydney, Sydney, NSW 2006 (Australia); Gregory, D. [Research and Technology Division, Melbourne Water, Melbourne, VIC 3001 (Australia); Baker, A.J.M. [Applied Ecology Research Group, School of Botany, University of Melbourne, Parkville, VIC 3010 (Australia)

2008-12-15

Heavy metal concentrations and pH of pore-water in contaminated substrates are important factors in controlling metal uptake by plants. We investigated the effects of phytoextraction on these properties in the solution phase of biosolids and diluted biosolids in a 12-month phytoextraction column experiment. Phytoextraction using Salix and Populus spp. temporarily decreased pore-water pH of the substrates over the experimental period followed by a return to initial pH conditions. Salix x reichardtii and Populus balsamifera effectively extracted Ni, Zn and Cd and actively mobilized these metals from the solid to the solution phase. S. x reichardtii had the stronger effect on mobilization of metals due to its larger root system. Phytoextraction did not affect Cu in the solution phase of the biosolids. Heavy metals were leached down to lower depths of the columns during the phytoextraction process. - Salix x reichardtii and Populus balsamifera extracted Ni, Zn and Cd and mobilized these metals in biosolids during phytoextraction.

Effects of phytoextraction on heavy metal concentrations and pH of pore-water of biosolids determined using an in situ sampling technique

International Nuclear Information System (INIS)

Huynh, T.T.; Laidlaw, W.S.; Singh, B.; Gregory, D.; Baker, A.J.M.

2008-01-01

Heavy metal concentrations and pH of pore-water in contaminated substrates are important factors in controlling metal uptake by plants. We investigated the effects of phytoextraction on these properties in the solution phase of biosolids and diluted biosolids in a 12-month phytoextraction column experiment. Phytoextraction using Salix and Populus spp. temporarily decreased pore-water pH of the substrates over the experimental period followed by a return to initial pH conditions. Salix x reichardtii and Populus balsamifera effectively extracted Ni, Zn and Cd and actively mobilized these metals from the solid to the solution phase. S. x reichardtii had the stronger effect on mobilization of metals due to its larger root system. Phytoextraction did not affect Cu in the solution phase of the biosolids. Heavy metals were leached down to lower depths of the columns during the phytoextraction process. - Salix x reichardtii and Populus balsamifera extracted Ni, Zn and Cd and mobilized these metals in biosolids during phytoextraction

The Volatile Composition of Portuguese Propolis Towards its Origin Discrimination

Directory of Open Access Journals (Sweden)

Soraia I. Falcão

2016-03-01

Full Text Available The volatiles from thirty six propolis samples collected from six different geographical locations in Portugal (mainland, Azores archipelago and Madeira Island were evaluated. Populus x canadensis Moenchen leaf-buds and Cistus ladanifer L. branches essential oils were comparatively analysed. The essential oils were isolated by hydrodistillation and analysed by Gas Chromatography (GC and Gas Chromatography-Mass Spectrometry (GC-MS. Cluster analysis based on propolis samples volatiles chemical composition defined three main clusters, not related to sample site collection. Cluster I grouped 28 samples with high relative amounts of oxygen-containing sesquiterpenes (20-77%, while cluster II grouped 7 samples rich in oxygen-containing monoterpenes (9-65% and the only sample from cluster III was monoterpene hydrocarbons rich (26%. Although Populus x canadensis and Cistus ladanifer were associated as resin sources of Portuguese propolis, other Populus species as well as plants like Juniperus genus may contribute to the resin in specific geographical locations.

Ozone air pollution and foliar injury development on native plants of Switzerland

International Nuclear Information System (INIS)

Novak, Kristopher; Skelly, John M.; Schaub, Marcus; Kraeuchi, Norbert; Hug, Christian; Landolt, Werner; Bleuler, Peter

2003-01-01

Visible ozone-induced foliar injury on native forest species of Switzerland was identified and confirmed under ambient OTC-conditions and related to the current European AOT40 standard. - The objectives of this study were to examine the foliar sensitivity to ozone exposure of 12 tree, shrub, and herbaceous species native to southern Switzerland and determine the seasonal cumulative ozone exposures required to induce visible foliar injury. The study was conducted from the beginning of May through the end of August during 2000 and 2001 using an open-top chamber research facility located within the Lattecaldo Cantonal Forest Nursery in Canton Ticino, southern Switzerland (600 m asl). Plants were examined daily and dates of initial foliar injury were recorded in order to determine the cumulative AOT40 ppb h ozone exposure required to cause visible foliar injury. Plant responses to ozone varied significantly among species; 11 species exhibited visible symptoms typical of exposures to ambient ozone. The symptomatic species (from most to least sensitive) were Populus nigra, Viburnum lantana, Salix alba, Crataegus monogyna, Viburnum opulus, Tilia platyphyllos, Cornus alba, Prunus avium, Fraxinus excelsior, Ribes alpinum, and Tilia cordata; Clematis spp. did not show foliar symptoms. Of the 11 symptomatic species, five showed initial injury below the critical level AOT40 10 ppmh O 3 in the 2001 season

Testing a hydraulic trait based model of stomatal control: results from a controlled drought experiment on aspen (Populus tremuloides, Michx.) and ponderosa pine (Pinus ponderosa, Douglas)

Science.gov (United States)

Love, D. M.; Venturas, M.; Sperry, J.; Wang, Y.; Anderegg, W.

2017-12-01

Modeling approaches for tree stomatal control often rely on empirical fitting to provide accurate estimates of whole tree transpiration (E) and assimilation (A), which are limited in their predictive power by the data envelope used to calibrate model parameters. Optimization based models hold promise as a means to predict stomatal behavior under novel climate conditions. We designed an experiment to test a hydraulic trait based optimization model, which predicts stomatal conductance from a gain/risk approach. Optimal stomatal conductance is expected to maximize the potential carbon gain by photosynthesis, and minimize the risk to hydraulic transport imposed by cavitation. The modeled risk to the hydraulic network is assessed from cavitation vulnerability curves, a commonly measured physiological trait in woody plant species. Over a growing season garden grown plots of aspen (Populus tremuloides, Michx.) and ponderosa pine (Pinus ponderosa, Douglas) were subjected to three distinct drought treatments (moderate, severe, severe with rehydration) relative to a control plot to test model predictions. Model outputs of predicted E, A, and xylem pressure can be directly compared to both continuous data (whole tree sapflux, soil moisture) and point measurements (leaf level E, A, xylem pressure). The model also predicts levels of whole tree hydraulic impairment expected to increase mortality risk. This threshold is used to estimate survivorship in the drought treatment plots. The model can be run at two scales, either entirely from climate (meteorological inputs, irrigation) or using the physiological measurements as a starting point. These data will be used to study model performance and utility, and aid in developing the model for larger scale applications.

Cadmium phytoextraction potential of poplar clones (Populus spp.)

Energy Technology Data Exchange (ETDEWEB)

Pilipovic, A.; Orlovic, S.; Petrovic, N. [Faculty of Agriculture, Inst. of Lowland Forestry and Environment, Novi Sad (Czechoslovakia); Nikolic, N.; Krstic, B. [Faculty of Natural Sciences, Dept. of Biology and Ecology, Novi Sad (Czechoslovakia)

2005-04-01

Biomass production, leaf number and area, photosynthetic and dark respiration rates, leaf concentration of photosynthetic pigments, nitrate reductase activity, as well as cadmium concentrations in leaves, stem, and roots were measured in poplar clones PE 4/68, B-229, 665, and 45/51. Plants were grown hydroponically under controlled conditions and treated with two different cadmium (Cd) concentrations (10{sup -5} and 10{sup -7} M) in the same background solution (Hoagland's solution). The presence of Cd did not cause serious disturbance of growth and physiological parameters in the studied poplar clones. Cd concentrations in plant tissues reflected external concentrations. In treated plants, root contents increased from 38.57 to 511.51 ppm, leaf contents from 0.91 to 7.50, while stem contents ranged from 1.37 to 9.50 ppm. (orig.)

Tree species effect on the redistribution of soil metals

NARCIS (Netherlands)

Mertens, J.; Nevel, Van L.; Schrijver, De A.; Piesschaert, F.; Oosterbaan, A.; Tack, F.M.G.; Verheyen, K.

2007-01-01

Phytostabilization of metals using trees is often promoted although the influence of different tree species on the mobilization of metals is not yet clear. Soil and biomass were sampled 33 years after planting four tree species (Quercus robur, Fraxinus excelsior, Acer pseudoplatanus, Populus

Modeling phosphorus capture by plants growing in a multi-species riparian buffer

Science.gov (United States)

The NST 3.0 mechanistic nutrient uptake model was used to explore phosphorus (P) uptake to a depth of 120 cm over a 126-d growing season in simulated buffer communities composed of mixtures of cottonwood (Populus deltoids Bartr.), switchgrass (Panicum virgatum L.), and smooth brome (Bromis inermis L...

Manipulating beaver (Castor canadensis) feeding responses to invasive tamarisk (Tamarix spp.).

Science.gov (United States)

Kimball, Bruce A; Perry, Kelly R

2008-08-01

To evaluate methods for promoting consumption of tamarisk plants by beavers (Castor canadensis), we determined the feeding responses by captive beavers to diets that contained tannins and sodium chloride (hereafter referred to as tamarisk diet). In two-choice tests, beavers consumed equivalent quantities of tamarisk diet and control diet. Treatment with polyethylene glycol and fructose did not increase beaver preferences for the tamarisk diet. When offered the choice of control diet and casein hydrolysate-treated control diet, beavers strongly avoided the latter, showing feeding deterring activity of casein hydrolysate. However, when tamarisk diet was the alternative to the deterrent treatment, beavers consumed similar quantities of the two diets. Finally, beaver foraging preferences for actual plant cuttings were assessed. Casein hydrolysate application to cuttings of black poplar (Populus nigra) and Scouler's willow (Salix scouleriana) reduced browsing of these highly preferred species and promoted a marked increase in browsing of tamarisk (Tamarix ramosissima). These results suggest that casein hydrolysate treatment of desirable riparian plant species such as Salix and Populus may promote beaver foraging of invasive tamarisk.

Flavan-3-ols Are an Effective Chemical Defense against Rust Infection.

Science.gov (United States)

Ullah, Chhana; Unsicker, Sybille B; Fellenberg, Christin; Constabel, C Peter; Schmidt, Axel; Gershenzon, Jonathan; Hammerbacher, Almuth

2017-12-01

Phenolic secondary metabolites are often thought to protect plants against attack by microbes, but their role in defense against pathogen infection in woody plants has not been investigated comprehensively. We studied the biosynthesis, occurrence, and antifungal activity of flavan-3-ols in black poplar ( Populus nigra ), which include both monomers, such as catechin, and oligomers, known as proanthocyanidins (PAs). We identified and biochemically characterized three leucoanthocyanidin reductases and two anthocyanidin reductases from P. nigra involved in catalyzing the last steps of flavan-3-ol biosynthesis, leading to the formation of catechin [2,3-trans-(+)-flavan-3-ol] and epicatechin [2,3-cis-(-)-flavan-3-ol], respectively. Poplar trees that were inoculated with the biotrophic rust fungus ( Melampsora larici-populina ) accumulated higher amounts of catechin and PAs than uninfected trees. The de novo-synthesized catechin and PAs in the rust-infected poplar leaves accumulated significantly at the site of fungal infection in the lower epidermis. In planta concentrations of these compounds strongly inhibited rust spore germination and reduced hyphal growth. Poplar genotypes with constitutively higher levels of catechin and PAs as well as hybrid aspen ( Populus tremula × Populus alba ) overexpressing the MYB134 transcription factor were more resistant to rust infection. Silencing PnMYB134 , on the other hand, decreased flavan-3-ol biosynthesis and increased susceptibility to rust infection. Taken together, our data indicate that catechin and PAs are effective antifungal defenses in poplar against foliar rust infection. © 2017 American Society of Plant Biologists. All Rights Reserved.

Environmental and Water Quality Operational Studies. Reservoir Shoreline Revegetation Guidelines.

Science.gov (United States)

1986-11-01

24. Taller trees such as green ash, cottonwood (Populus spp.), red maple (Acer rubrum), and persimmon (Diospyros virginiana ) should be planted in...be left aboveground to prevent moisture loss due to wicking. Any excess should be pruned off. Gray and Leiser (1982) provide the following... pruning , staking woody stems, and installing fencing around individual plants or the entire site to provide protection from animals or humans. Additional

Noninvasive Measurement of Vulnerability to Drought-Induced Embolism by X-Ray Microtomography.

Science.gov (United States)

Choat, Brendan; Badel, Eric; Burlett, Regis; Delzon, Sylvain; Cochard, Herve; Jansen, Steven

2016-01-01

Hydraulic failure induced by xylem embolism is one of the primary mechanisms of plant dieback during drought. However, many of the methods used to evaluate the vulnerability of different species to drought-induced embolism are indirect and invasive, increasing the possibility that measurement artifacts may occur. Here, we utilize x-ray computed microtomography (microCT) to directly visualize embolism formation in the xylem of living, intact plants with contrasting wood anatomy (Quercus robur, Populus tremula × Populus alba, and Pinus pinaster). These observations were compared with widely used centrifuge techniques that require destructive sampling. MicroCT imaging provided detailed spatial information regarding the dimensions and functional status of xylem conduits during dehydration. Vulnerability curves based on microCT observations of intact plants closely matched curves based on the centrifuge technique for species with short vessels (P. tremula × P. alba) or tracheids (P. pinaster). For ring porous Q. robur, the centrifuge technique significantly overestimated vulnerability to embolism, indicating that caution should be used when applying this technique to species with long vessels. These findings confirm that microCT can be used to assess the vulnerability to embolism on intact plants by direct visualization. © 2016 American Society of Plant Biologists. All Rights Reserved.

Role of Osmotic Adjustment in Plant Productivity

Energy Technology Data Exchange (ETDEWEB)

Gebre, G.M.

2001-01-11

Successful implementation of short rotation woody crops requires that the selected species and clones be productive, drought tolerant, and pest resistant. Since water is one of the major limiting factors in poplar (Populus sp.) growth, there is little debate for the need of drought tolerant clones, except on the wettest of sites (e.g., lower Columbia River delta). Whether drought tolerance is compatible with productivity remains a debatable issue. Among the many mechanisms of drought tolerance, dehydration postponement involves the maintenance of high leaf water potential due to, for example, an adequate root system. This trait is compatible with productivity, but requires available soil moisture. When the plant leaf water potential and soil water content decline, the plant must be able to survive drought through dehydration tolerance mechanisms, such as low osmotic potential or osmotic adjustment. Osmotic adjustment and low osmotic potential are considered compatible with growth and yield because they aid in the maintenance of leaf turgor. However, it has been shown that turgor alone does not regulate cell expansion or stomatal conductance and, therefore, the role of osmotic adjustment is debated. Despite this finding, osmotic adjustment has been correlated with grain yield in agronomic crop species, and gene markers responsible for osmotic adjustment are being investigated to improve drought tolerance in productive progenies. Although osmotic adjustment and low osmotic potentials have been investigated in several forest tree species, few studies have investigated the relationship between osmotic adjustment and growth. Most of these studies have been limited to greenhouse or container-grown plants. Osmotic adjustment and rapid growth have been specifically associated in Populus and black spruce (Picea mariuna (Mill.) B.S.P.) progenies. We tested whether these relationships held under field conditions using several poplar clones. In a study of two hybrid poplar

Metal uptake by young trees from dredged brackish sediment : Limitations and possibilities for phytoextraction and phytostabilisation

NARCIS (Netherlands)

Mertens, Jan; Vervaeke, Pieter; de Schrijver, A.; Luyssaert, Sebastiaan

2004-01-01

Five tree species (Acer pseudoplatanus L., Alnus glutinosa L. Gaertn., Fraxinus excelsior L., Populus alba L. and Robinia pseudoacacia L.) were planted on a mound constructed of dredged sediment. The sediment originated from a brackish river mouth and was slightly polluted with heavy metals. This

Screening of drought oxidative stress tolerance in Serbian ...

African Journals Online (AJOL)

This study was designed to examine and compare antioxidant and free-radical scavenging activities of leaves of six different melliferous plant species (Populus alba, Robinia pseudoacacia, Sophora japonica, Euodia hupehensis, Tilia sp., Fraxinus sp.) from Serbia in order to evaluate their drought oxidative stress tolerance.

Rooting ability of native cottonwoods depends on the clone used

Science.gov (United States)

Frank E. Cunningham

1953-01-01

Vegetative propagation of eastern cottonwood (Populus deltoides) from dormant cuttings has generally been considered rather easy. Yet test plantings of unrooted cuttings of this species on the Hopkins Memorial Experimental Forest at Williamstown, Mass., showed considerable variation in rooting ability of the clones used.

Wood properties of Populus and Betula in long-term exposure to elevated CO₂ and O₃.

Science.gov (United States)

Kostiainen, Katri; Saranpää, Pekka; Lundqvist, Sven-Olof; Kubiske, Mark E; Vapaavuori, Elina

2014-06-01

We studied the interactive effects of elevated concentrations of CO2 and O3 on radial growth and wood properties of four trembling aspen (Populus tremuloides Michx.) clones and paper birch (Betula papyrifera Marsh.) saplings. The material for the study was collected from the Aspen FACE (free-air CO2 enrichment) experiment in Rhinelander (WI, USA). Trees had been exposed to four treatments [control, elevated CO2 (560 ppm), elevated O3 (1.5 times ambient) and combined CO2 + O3 ] during growing seasons 1998-2008. Most treatment responses were observed in the early phase of experiment. Our results show that the CO2- and O3-exposed aspen trees displayed a differential balance between efficiency and safety of water transport. Under elevated CO2, radial growth was enhanced and the trees had fewer but hydraulically more efficient larger diameter vessels. In contrast, elevated O3 decreased radial growth and the diameters of vessels and fibres. Clone-specific decrease in wood density and cell wall thickness was observed under elevated CO2 . In birch, the treatments had no major impacts on wood anatomy or wood density. Our study indicates that short-term impact studies conducted with young seedlings may not give a realistic view of long-term ecosystem responses. © 2013 John Wiley & Sons Ltd.

Growth and physiological responses of isohydric and anisohydric poplars to drought

Science.gov (United States)

Ziv Attia; Jean-Christophe Domec; Ram Oren; Danielle A. Way; Menachem Moshelion

2015-01-01

Understanding how different plants prioritize carbon gain and drought vulnerability under a variable water supply is important for predicting which trees will maximize woody biomass production under different environmental conditions. Here, Populus balsamifera (BS, isohydric genotype), P. simonii (SI, previously uncharacterized stomatal behaviour), and their cross, P....

The Impact of Nitrogen Limitation and Mycorrhizal Symbiosis on Aspen Tree Growth and Development

Energy Technology Data Exchange (ETDEWEB)

Tran, Bich Thi Ngoc [Univ. of Alabama, Huntsville, AL (United States)

2014-08-18

Nitrogen deficiency is the most common and widespread nutritional deficiency affecting plants worldwide. Ectromycorrhizal symbiosis involves the beneficial interaction of plants with soil fungi and plays a critical role in nutrient cycling, including the uptake of nitrogen from the environment. The main goal of this study is to understand how limiting nitrogen in the presence or absence of an ectomycorrhizal fungi, Laccaria bicolor, affects the health of aspen trees, Populus temuloides.

Isoprene emission by poplar is not important for the feeding behaviour of poplar leaf beetles

OpenAIRE

M?ller, Anna; Kaling, Moritz; Faubert, Patrick; Gort, Gerrit; Smid, Hans M; Van Loon, Joop JA; Dicke, Marcel; Kanawati, Basem; Schmitt-Kopplin, Philippe; Polle, Andrea; Schnitzler, J?rg-Peter; Rosenkranz, Maaria

2015-01-01

Background Chrysomela populi (poplar leaf beetle) is a common herbivore in poplar plantations whose infestation causes major economic losses. Because plant volatiles act as infochemicals, we tested whether isoprene, the main volatile organic compound (VOC) produced by poplars (Populus x canescens), affects the performance of C. populi employing isoprene emitting (IE) and transgenic isoprene non-emitting (NE) plants. Our hypothesis was that isoprene is sensed and affects beetle orientation or ...

Untangling the effects of root age and tissue nitrogen on root respiration in Populus tremuloides at different nitrogen supply.

Science.gov (United States)

Ceccon, Christian; Tagliavini, Massimo; Schmitt, Armin Otto; Eissenstat, David M

2016-05-01

Root respiration is a major contributor to terrestrial carbon flux. Many studies have shown root respiration to increase with an increase in root tissue nitrogen (N) concentration across species and study sites. Studies have also shown that both root respiration and root N concentration typically decrease with root age. The effects of added N may directly increase respiration of existing roots or may affect respiration by shifting the age structure of a root population by stimulating growth. To the best of our knowledge, no study has ever examined the effect of added N as a function of root age on root respiration. In this study, root respiration of 13-year-old Populus tremuloides Michx. trees grown in the field and 1-year-old P. tremuloides seedlings grown in containers was analyzed for the relative influence of root age and root N concentration independent of root age on root respiration. Field roots were first tracked using root windows and then sampled at known age. Nitrogen was either applied or not to small patches beneath the windows. In a pot experiment, each plant was grown with its root system split between two separate pots and N was applied at three different levels, either at the same or at different rates between pots. Root N concentration ranged between 1.4 and 1.7% in the field experiment and 1.8 and 2.6% in the seedling experiment. We found that addition of N increased root N concentration of only older roots in the field but of roots of all ages in the potted seedlings. In both experiments, the age-dependent decline in root respiration was largely consistent, and could be explained by a negative power function. Respiration decreased ∼50% by 3 weeks of age. Although root age was the dominant factor affecting respiration in both experiments, in the field experiment, root N also contributed to root respiration independent of root age. These results add further insight into respiratory responses of roots to N addition and mechanisms underlying the