WorldWideScience

Sample records for plant insecticide l-canavanine

  1. Plant insecticide L-canavanine repels Drosophila via the insect orphan GPCR DmX.

    Directory of Open Access Journals (Sweden)

    Christian Mitri

    2009-06-01

    Full Text Available For all animals, the taste sense is crucial to detect and avoid ingesting toxic molecules. Many toxins are synthesized by plants as a defense mechanism against insect predation. One example of such a natural toxic molecule is L-canavanine, a nonprotein amino acid found in the seeds of many legumes. Whether and how insects are informed that some plants contain L-canavanine remains to be elucidated. In insects, the taste sense relies on gustatory receptors forming the gustatory receptor (Gr family. Gr proteins display highly divergent sequences, suggesting that they could cover the entire range of tastants. However, one cannot exclude the possibility of evolutionarily independent taste receptors. Here, we show that L-canavanine is not only toxic, but is also a repellent for Drosophila. Using a pharmacogenetic approach, we find that flies sense food containing this poison by the DmX receptor. DmXR is an insect orphan G-protein-coupled receptor that has partially diverged in its ligand binding pocket from the metabotropic glutamate receptor family. Blockade of DmXR function with an antagonist lowers the repulsive effect of L-canavanine. In addition, disruption of the DmXR encoding gene, called mangetout (mtt, suppresses the L-canavanine repellent effect. To avoid the ingestion of L-canavanine, DmXR expression is required in bitter-sensitive gustatory receptor neurons, where it triggers the premature retraction of the proboscis, thus leading to the end of food searching. These findings show that the DmX receptor, which does not belong to the Gr family, fulfills a gustatory function necessary to avoid eating a natural toxin.

  2. Lethal action of canavanine in Escherichia coli; Etude de l'action lethale de la canavanine sur Escherichia coli

    Energy Technology Data Exchange (ETDEWEB)

    Simonnet, Gerard Marc

    1972-01-04

    We studied the action of canavanine, analog of arginine, on the loss of bacteria viability; macromolecular synthesis (proteins, RNA and DNA) and DNA structure. We used bacteria because among different kinds of cells (ascitic tumor cells, erythrocytes, reticulocytes) they are the only ones which show the best capability of concentrating canavanine. This compound penetrates bacteria cells by active transportation uptake. Canavanine causes an irreversible inhibition of the cell division of bacteria. The loss of viability is connected to the incorporation in proteins of canavanine instead of arginine. Canavanine stimulates RNA synthesis in bacteria, strains RC{sup Str} arg{sup -}, starved of arginine, but it inhibits the incorporation of uracil, UMP and UDP in strains RC{sup str} arg{sup -}. Canavanine allows the completion of pre-initiated DNA chains; this result is similar to that observed of starved amino acid bacteria. The DNA of bacteria incubated with canavanine shows a lesion which results in the breaking of DNA. Part of the DNA does not sediment at 10 000 xg with the membranes. This DNA does not sediment either at 150 000 xg in alkaline sucrose gradient. Our results are consistent with the hypothesis that canavanine death is due to this breaking of the DNA. (author) [French] Dans le present travail, on a etudie l'action de la canavanine, analogue structural de l'arginine, sur la viabilite des bacteries, les syntheses macromoleculaires (proteines, ARN et ADN) et la structure de l'ADN. Les bacteries ont ete utilisees pour cette etude car des differents types de cellules testes (hepatomes ascitiques, reticulocytes et erythrocytes), ce sont elles qui presentent la meilleure permeabilite a la canavanine. Cette substance penetre dans les bacteries par un mecanisme de transport actif. La canavanine inhibe de facon irreversible la division cellulaire des bacteries. Cette perte de viabilite est liee a l'incorporation de la canavanine a la place de l'arginine dans les

  3. Metabolism of L-[guanidinooxy-14C]canavanine in the rat

    International Nuclear Information System (INIS)

    Thomas, D.A.; Rosenthal, G.A.

    1987-01-01

    The metabolism of L-canavanine, a nonprotein amino acid with significant antitumor effects, was investigated. L-Canavanine, provided at 2.0 g/kg, was supplemented with 5 microCi of L-[guanidinooxy- 14 C]canavanine (58 microCi/mumol) and administered iv, sc, or orally to female Sprague-Dawley rats weighing approximately 200 g. 14 C recovery in the urine at 24 hr was 83, 68, or 61%, respectively, of the administered dose. Another 5-8% of the 14 C was expired as 14 CO 2 . The gastrointestinal tract contained 21% of orally administered 14 C. Serum, feces, tissues, and de novo synthesized proteins only accounted for a few percent of the original dose by any administrative route. Analysis of the 14 C-containing urinary metabolites revealed that [ 14 C] urea accounted for 88% of the urinary radioactivity for an iv injection, 75% for sc administration, and 50% following an oral dose. By all routes of administration, [ 14 C]guanidine represented 5% of the radioactivity in the urine and [ 14 C]guanidinoacetic acid accounted for 2%. Serum and urine amino acid analysis showed a markedly elevated ornithine level. Basic amino acids such as histidine, lysine, and arginine were also higher in the urine. Plasma ammonia levels were determined following oral canavanine doses of 1.0, 2.0, and 4.0 g/kg. A rapid but transient elevation in plasma ammonia was observed only at the 4.0 g/kg dose. This indicates that elevated plasma ammonia is not a likely cause of canavanine toxicity at the drug concentrations used in this study

  4. Differences between strains of Rhizobium in sensitivity to canavanine

    Energy Technology Data Exchange (ETDEWEB)

    Weaks, T E [Marshall Univ., Huntingdon, West Virginia (USA). Dept. of Biological Sciences

    1977-11-01

    Four strains of rhizobia that nodulate canavanine-synthesizing legumes and four strains that nodulate noncanavanine-synthesizing legumes were tested for sensitivity to L-canavanine. The effect of canavanine on growth depends upon the strain of Rhizobium tested rather than the canavanine synthesizing capability of the host legume. In both groups of rhizobia, some strains were inhibited in growth by canavanine. Canavanine enhancement of growth was observed in rhizobia that nodulate noncanavanine-synthesizing legumes. Canavanine was found to enhance the incorporation of /sup 3/H-uridine and /sup 3/H-L-leucine into trichloroacetic acid insoluble fractions of starved cells of two strains of rhizobia tested. This demonstrated that under certain conditions, some rhizobia can detoxify canavanine and utilize it in synthetic processes.

  5. Lethal action of canavanine in Escherichia coli

    International Nuclear Information System (INIS)

    Simonnet, Gerard Marc

    1972-01-01

    We studied the action of canavanine, analog of arginine, on the loss of bacteria viability; macromolecular synthesis (proteins, RNA and DNA) and DNA structure. We used bacteria because among different kinds of cells (ascitic tumor cells, erythrocytes, reticulocytes) they are the only ones which show the best capability of concentrating canavanine. This compound penetrates bacteria cells by active transportation uptake. Canavanine causes an irreversible inhibition of the cell division of bacteria. The loss of viability is connected to the incorporation in proteins of canavanine instead of arginine. Canavanine stimulates RNA synthesis in bacteria, strains RC Str arg - , starved of arginine, but it inhibits the incorporation of uracil, UMP and UDP in strains RC str arg - . Canavanine allows the completion of pre-initiated DNA chains; this result is similar to that observed of starved amino acid bacteria. The DNA of bacteria incubated with canavanine shows a lesion which results in the breaking of DNA. Part of the DNA does not sediment at 10 000 xg with the membranes. This DNA does not sediment either at 150 000 xg in alkaline sucrose gradient. Our results are consistent with the hypothesis that canavanine death is due to this breaking of the DNA. (author) [fr

  6. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  7. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  8. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  9. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  10. Unraveling the effect of structurally different classes of insecticide on germination and early plant growth of soybean [Glycine max (L.) Merr].

    Science.gov (United States)

    Dhungana, Sanjeev Kumar; Kim, Il-Doo; Kwak, Hwa-Sook; Shin, Dong-Hyun

    2016-06-01

    Although a considerable number of studies about the effect of different insecticides on plant physiology and metabolism have been carried out, research work about the comparative action of structurally different classes of insecticide on physiological and biochemical properties of soybean seed germination and early growth has not been found. The objective of this study was to investigate the effect of different classes of insecticides on soybean seed germination and early plant growth. Soybean seeds of Bosuk cultivar were soaked for 24h in distilled water or recommended dose (2mLL(-1), 1mLL(-1), 0.5gL(-1), and 0.5gL(-1) water for insecticides Mepthion, Myungtaja, Actara, and Stonate, respectively) of pesticide solutions of four structurally different classes of insecticides - Mepthion (fenitrothion; organophosphate), Myungtaja (etofenprox; pyrethroid), Actara (thiamethoxam; neonicotinoid), and Stonate (lambda-cyhalothrin cum thiamethoxam; pyrethroid cum neonicotinoid) - which are used for controlling stink bugs in soybean crop. Insecticides containing thiamethoxam and lamda-cyhalothrin cum thiamethoxam showed positive effects on seedling biomass and content of polyphenol and flavonoid, however fenitrothion insecticide reduced the seed germination, seed and seedling vigor, and polyphenol and flavonoid contents in soybean. Results of this study reveal that different classes of insecticide have differential influence on physiologic and metabolic actions like germination, early growth, and antioxidant activities of soybean and this implies that yield and nutrient content also might be affected with the application of different types of insecticide. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Substances inertes et plantes à effet insecticide utilisées dans la ...

    African Journals Online (AJOL)

    Les insecticides naturels tels que les plantes à effet insecticide et les substances inertes (sable, cendre, terres à diatomées,…) méritent d'être valorisées afin de réduire l'utilisation des insecticides chimiques et protéger l'environnement. Ce travail basé sur une revue documentaire fouillée et actualisée vise à faire la genèse ...

  12. Impact of planting dates and insecticide strategies for managing crucifer flea beetles (Coleoptera: Chrysomelidae) in spring-planted canola.

    Science.gov (United States)

    Knodel, Janet J; Olson, Denise L; Hanson, Bryan K; Henson, Robert A

    2008-06-01

    Integration of cultural practices, such as planting date with insecticide-based strategies, was investigated to determine best management strategy for flea beetles (Phyllotreta spp.) (Coleoptera: Chrysomelidae) in canola (Brassica napus L.). We studied the effect of two spring planting dates of B. napus and different insecticide-based management strategies on the feeding injury caused by fleabeetles in North Dakota during 2002-2003. Adult beetle peak emergence usually coincided with the emergence of the early planted canola, and this resulted in greater feeding injury in the early planted canola than later planted canola. Use of late-planted canola may have limited potential for cultural control of flea beetle, because late-planted canola is at risk for yield loss due to heat stress during flowering. Flea beetle injury ratings declined when 1) the high rate of insecticide seed treatment plus a foliar insecticide applied 21 d after planting was used, 2) the high rate of insecticide seed treatment only was used, or 3) two foliar insecticide sprays were applied. These insecticide strategies provided better protection than the low rates of insecticide seed treatments or a single foliar spray, especially in areas with moderate-to-high flea beetle populations. The foliar spray on top of the seed treatment controlled later-emerging flea beetles as the seed treatment residual was diminishing and the crop became vulnerable to feeding injury. The best insecticide strategy for management of flea beetle was the high rate of insecticide seed treatment plus a foliar insecticide applied at 21 d after planting, regardless of planting date.

  13. Insecticidal Activity of Some Traditionally Used Ethiopian Medicinal Plants against Sheep Ked Melophagus ovinus

    OpenAIRE

    Gemeda, Negero; Mokonnen, Walelegn; Lemma, Hirut; Tadele, Ashenif; Urga, Kelbessa; Addis, Getachew; Debella, Asfaw; Getachew, Mesaye; Teka, Frehiwot; Yirsaw, Kidist; Mudie, Kissi; Gebre, Solomon

    2014-01-01

    Twelve medicinal plants and a commercially used drug Ivermectin were examined for insecticidal activity against Melophagus ovinus sheep ked at different time intervals using in vitro adult immersion test. The findings show that at 3.13 µL/mL, 6.25 µL/mL and 12.5 µL/mL concentration of Cymbopogon citratus, Foeniculum vulgare and Eucalyptus globulus essential oils respectively, recorded 100% mortalities against M. ovinus within 3 hour of exposure. Significantly higher insecticidal activity of e...

  14. Plant volatile aldehydes as natural insecticides against stored-product beetles.

    Science.gov (United States)

    Hubert, Jan; Münzbergová, Zuzana; Santino, Angelo

    2008-01-01

    Infestation by stored-product pests causes serious losses in food and feed commodities. Among possible strategies against these pests, which aim to reduce the use of synthetic insecticides, including fumigants, natural insecticides produced by plants represent one of the most promising approaches for their ecochemical control. Three six-carbon and nine-carbon aldehydes, natural plant volatiles produced by the plant lipoxygenase pathway, were tested for their insecticidal activity against five species of stored-product beetles in feeding, fumigation and combined bioassays. The compounds (2E,6Z)-nonadienal, (2E)-nonenal and (2E)-hexenal were incorporated into feeding discs in feeding bioassays or evaporated from filter paper in closed glass chambers in fumigation tests. Beetle sensitivity to aldehydes differed according to the different treatments. The highest activity was obtained by (2E)-hexenal in fumigation tests, with the LC(50) ranging from 4 to 26 mg L(-1), while (2E, 6Z)-nonadienal was the most effective in feeding tests, giving LD(50)s ranging from 0.44 to 2.76 mg g(-1) when applied to feeding discs. Fumigation tests in the presence of wheat grains confirmed that (2E)-hexenal was the most effective compound, with a calculated LC(99) ranging from 33 to 166 mg L(-1). The results of both feeding and fumigation tests indicated that natural plant aldehydes are potential candidates to control stored-product beetles.

  15. Plant Essential Oils Synergize and Antagonize Toxicity of Different Conventional Insecticides against Myzus persicae (Hemiptera: Aphididae)

    Science.gov (United States)

    Faraone, Nicoletta; Hillier, N. Kirk; Cutler, G. Christopher

    2015-01-01

    Plant-derived products can play an important role in pest management programs. Essential oils from Lavandula angustifolia (lavender) and Thymus vulgaris (thyme) and their main constituents, linalool and thymol, respectively, were evaluated for insecticidal activity and synergistic action in combination with insecticides against green peach aphid, Myzus persicae (Sulzer) (Hemiptera: Aphididae). The essential oils and their main constituents exerted similar insecticidal activity when aphids were exposed by direct sprays, but were non-toxic by exposure to treated leaf discs. In synergism experiments, the toxicity of imidacloprid was synergized 16- to 20-fold by L. angustifolia and T. vulgaris essential oils, but far less synergism occurred with linalool and thymol, indicating that secondary constituents of the oils were probably responsible for the observed synergism. In contrast to results with imidacloprid, the insecticidal activity of spirotetramat was antagonized by L. angustifolia and T. vulgaris essential oils, and linalool and thymol. Our results demonstrate the potential of plant essential oils as synergists of insecticides, but show that antagonistic action against certain insecticides may occur. PMID:26010088

  16. Behavioral and electroantennogram responses of plum curculio, Conotrachelus nenuphar, to selected noxious plant extracts and insecticides.

    Science.gov (United States)

    Gӧkçe, A; Stelinski, L L; Nortman, D R; Bryan, W W; Whalon, M E

    2014-01-01

    Behavioral and electroantennogram responses of plum curculio, Conotrachelus nenuphar (Herbst) (Coleoptera: Curculionidae), adults were tested for several methanolic plant extracts and organically approved insecticides. Plant extracts were evaluated for their potential as antifeedants or oviposition deterrents. These extract responses were also compared to those elicited by the non-neurotoxic, organic irritant-insecticide kaolin clay. Both sexes of plum curculio exhibited antennal response as measured by electroantennogram, which ranged from 0.2 to 1.1 mV, to plant extracts and the organic irritant/insecticide, with the greatest response to the extract of rough cocklebur, Xanthium strumarium L. (1.1 mV). No choice tests were conducted to compare feeding and oviposition by plum curculio on untreated apples or on apples treated with one of the extracts or the insecticide. The insecticide pyrethrum and extracts of X. strumarium and greater burdock, Arctium lappa L., significantly reduced feeding. Also, pyrethrum, A. lappa, Humulus lupulus L. (common hop), X. strumarium, and Verbascum songaricum Schrenk extracts completely inhibited egg deposition. In no-choice assays, the effects of kaolin clay with incorporated plant extracts on plum curculio feeding and oviposition were monitored as complementary tests. A. lappa-kaolin, H. lupulus-kaolin, and X. strumarium-kaolin mixtures significantly reduced the feeding of plum curculio compared to the control or kaolin clay alone. Each of the plant extract-kaolin mixtures evaluated, with the exception of Bifora radians Bieberstein (wild bishop), completely inhibited plum curculio oviposition as compared to controls. This is an open access paper. We use the Creative Commons Attribution 3.0 license that permits unrestricted use, provided that the paper is properly attributed.

  17. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Insecticidal Activity of Some Traditionally Used Ethiopian Medicinal Plants against Sheep Ked Melophagus ovinus

    Directory of Open Access Journals (Sweden)

    Negero Gemeda

    2014-01-01

    Full Text Available Twelve medicinal plants and a commercially used drug Ivermectin were examined for insecticidal activity against Melophagus ovinus sheep ked at different time intervals using in vitro adult immersion test. The findings show that at 3.13 µL/mL, 6.25 µL/mL and 12.5 µL/mL concentration of Cymbopogon citratus, Foeniculum vulgare and Eucalyptus globulus essential oils respectively, recorded 100% mortalities against M. ovinus within 3 hour of exposure. Significantly higher insecticidal activity of essential oils was recorded (P=0.00 when compared to 10 μg/mL Ivermectin after 3-hour exposure of M. ovinus at a concentration of ≥1.57 μL/mL, ≥3 μL/mL, and ≥12.7 μL/mL essential oils of C. citratus, F. vulgare, and E. globulus, respectively. Among essential oils, C. citratus has showed superior potency at a three-hour exposure of the parasite (P=0.00 at a concentration of ≥0.78 μL/mL. Strong antiparasitic activity was recorded by aqueous extract of Calpurnia aurea (80% mortality at a concentration of 200 mg/mL within 24 h among aqueous extracts of 9 medicinal plants. The results indicated all the four medicinal plants, particularly those tested essential oils, can be considered as potential candidates for biocontrol of M. ovinus sheep ked.

  19. Insecticidal Activity of Some Traditionally Used Ethiopian Medicinal Plants against Sheep Ked Melophagus ovinus.

    Science.gov (United States)

    Gemeda, Negero; Mokonnen, Walelegn; Lemma, Hirut; Tadele, Ashenif; Urga, Kelbessa; Addis, Getachew; Debella, Asfaw; Getachew, Mesaye; Teka, Frehiwot; Yirsaw, Kidist; Mudie, Kissi; Gebre, Solomon

    2014-01-01

    Twelve medicinal plants and a commercially used drug Ivermectin were examined for insecticidal activity against Melophagus ovinus sheep ked at different time intervals using in vitro adult immersion test. The findings show that at 3.13 µL/mL, 6.25 µL/mL and 12.5 µL/mL concentration of Cymbopogon citratus, Foeniculum vulgare and Eucalyptus globulus essential oils respectively, recorded 100% mortalities against M. ovinus within 3 hour of exposure. Significantly higher insecticidal activity of essential oils was recorded (P = 0.00) when compared to 10  μ g/mL Ivermectin after 3-hour exposure of M. ovinus at a concentration of ≥1.57  μ L/mL, ≥3  μ L/mL, and ≥12.7  μ L/mL essential oils of C. citratus, F. vulgare, and E. globulus, respectively. Among essential oils, C. citratus has showed superior potency at a three-hour exposure of the parasite (P = 0.00) at a concentration of ≥0.78  μ L/mL. Strong antiparasitic activity was recorded by aqueous extract of Calpurnia aurea (80% mortality) at a concentration of 200 mg/mL within 24 h among aqueous extracts of 9 medicinal plants. The results indicated all the four medicinal plants, particularly those tested essential oils, can be considered as potential candidates for biocontrol of M. ovinus sheep ked.

  20. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  1. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  2. Influence of insecticidal plant materials used during storage on sensory attributes and instrumental hardness of dry edible beans (Phaseolus vulgaris L.).

    Science.gov (United States)

    Dunkel, F V; Serugendo, A; Breene, W M; Sriharan, S

    1995-07-01

    Three plant products with known insecticidal properties, a dry extract of flowers of Chrysanthemum cinerariaefolium (Trevir.) Vis. produced in Rwanda, an ethanol extract of seeds of neem, Azadirachta indica A. Juss, and crushed leaves of Tetradenia riparia Hochst Codd, a traditional Rwandan medicine, were mixed with beans, Phaseolus vulgaris L., for storage protection. These plant-protected beans were compared with "off the shelf' beans that were being sold to consumers by the Rwandan National Agricultural Products Marketing Organization (OPROVIA). A trained sensory panel determined that beans treated with neem and C. cinerariaefolium were as acceptable after 8 months storage as those being sold throughout Rwanda by the marketing organization. Beans marketed by this organization were all treated with the standard insecticide application in Rwanda, 0.01% weight/weight pirimiphos methyl in a powder formulation. Instrumental hardness (% hard-to-cook/mean gram force) after 20 months of storage was acceptable for beans stored with neem or with C. cinerariaefolium or with the conventional government application of pirimiphos methyl. Use of either neem or C. cinerariaefolium for storage protection should not affect consumer acceptance of dry beans.

  3. Toxicity and poisoning symptoms of selected insecticides to honey bees (Apis mellifera mellifera L.

    Directory of Open Access Journals (Sweden)

    Pashte Vrushali Vijaykumar

    2018-01-01

    Full Text Available Bees are potential pollinators of wide variety of crops. The European dark bee, Apis mellifera mellifera (L. is widely used for crop pollination. However, pesticide usage in modern agriculture has threatened the plant-bee pollinator interaction. There is lack of data regarding lethal time, insecticide concentration and poisoning symptoms, especially for formulated insecticides that are widely used in insect management. This study shows that the intrinsic toxicity of insecticides (LC50 to A. mellifera mellifera (L. was in the following order: imidacloprid (0.0070 > fipronil (0.0125 > indoxacarb (0.0266> cypermethrin (0.0370 > dimethoate (0.0385. The lethal time (LT50 values (h in the ascending order of toxicity of insecticides were as follows: fipronil (6.56, cypermethrin (6.69, dimethoate (8.00, imidacloprid (9.85 and indoxacarb (13.45. Distinct poisoning symptoms observed in A. mellifera mellifera were extended proboscis, expanded wings, unhooked wings, extended legs and twisted bodies, defecation on cage covers, sting in release-out position and anus with excreta. All the tested pesticides are harmful to the honey bee except azadirachtin. The tested pesticides exhibited different poisoning symptoms in bees, which could be useful for beekeepers in identifying the cause of colony mortality. In conclusion, the pesticide toxicological research on bees is an important safety aspect for beneficial organisms. This study reveals a realistic acute toxicity in the field of commonly used insecticides. The information is important for insecticide selection in order to minimize direct killing of foraging honey bees while maintaining effective management of crop pests.

  4. Insecticidal activity of the essential oils from different plants against three stored-product insects.

    Science.gov (United States)

    Ayvaz, Abdurrahman; Sagdic, Osman; Karaborklu, Salih; Ozturk, Ismet

    2010-01-01

    This study was conducted to determine the insecticidal activity of essential oils from oregano, Origanum onites L. (Lamiales: Lamiaceae), savory, Satureja thymbra L. (Lamiales: Lamiaceae), and myrtle, Myrtus communis L. (Rosales: Myrtaceae) against three stored-product insects. Essential oils from three species of plants were obtained by Clevenger-type water distillation. The major compounds in these essential oils were identified using gas chromatography-mass spectrometry and their insecticidal activity was tested against adults of the Mediterranean flour moth Ephestia kuehniella Zeller (Lepidoptera: Pyralidae), the Indian meal moth Plodia interpunctella Hübner (Lepidoptera: Pyralidae) and the bean weevil Acanthoscelides obtectus Say (Coleoptera: Bruchidae). While the major compound found in oregano and savory was carvacrol, the main constituent of the myrtle was linalool. Among the tested insects, A. obtectus was the most tolerant species against the essential oils. However, the insecticidal activity of the myrtle oil was more pronounced than other oils tested against A. obtectus adults. The essential oils of oregano and savory were highly effective against P. interpunctella and E. kuehniella, with 100% mortality obtained after 24 h at 9 and 25 microl/l air for P. interpunctella and E. kuehniella, respectively. LC(50) and LC(99) values of each essential oil were estimated for each insect species.

  5. Tri-trophic insecticidal effects of African plants against cabbage pests.

    Directory of Open Access Journals (Sweden)

    Blankson W Amoabeng

    Full Text Available Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae, Siam weed, Chromolaena odorata (Asteraceae, Cinderella weed, Synedrella nodiflora (Asteraceae, chili pepper, Capsicum frutescens (Solanaceae, tobacco, Nicotiana tabacum (Solanaceae cassia, Cassia sophera (Leguminosae, physic nut, Jatropha curcas (Euphorbiaceae, castor oil plant, Ricinus communis (Euphorbiaceae and basil, Ocimum gratissimum (Lamiaceae. In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis, all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from

  6. Tri-trophic insecticidal effects of African plants against cabbage pests.

    Science.gov (United States)

    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C

    2013-01-01

    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  7. Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests

    Science.gov (United States)

    Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.

    2013-01-01

    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  8. Assessment of Adiantum incisum, Alternanthera pungens and Trichodesma indicum as bio-insecticides against stored grain pests

    International Nuclear Information System (INIS)

    Safdar, N.; Yasmin, A.

    2017-01-01

    This study investigated the insecticidal potential of Adiantum incisum Forssk (Pteridaceae), Alternanthera pungens Kunth (Amaranthaceae) and Trichodesma indicum L. (Boraginaceae). Aqueous, methanolic and n-hexane extracts of whole plants (roots, stem and leaves) were prepared using maceration technique. Insecticidal activities of aqueous, methanolic and n-hexane extracts of three plants (10, 20 and 30 mg/mL) were evaluated by impregnated filter paper insecticidal assay. Methanol and hexane extracts of Adiantum incisum gave effective LD 50 (15.3 mg/mL) against Callosobruchus chinensis and Sitophilus oryzae (LD5022 mg/mL) after 24 hours respectively. Present research elucidates the important phytochemicals (alkaloids, saponins and tannins) in three plants by FTIR and good insecticidal activity (LD50 < 25 mg/mL in 24 hours) against Callosobruchus chinensis and Sitophilus oryzae. Current study promotes further investigations for using these plant extracts as anti-feedants, repellents, fumigants and formulation of non-toxic bio-insecticides. (author)

  9. Neonicotinoid Insecticides Alter Induced Defenses and Increase Susceptibility to Spider Mites in Distantly Related Crop Plants

    Science.gov (United States)

    Szczepaniec, Adrianna; Raupp, Michael J.; Parker, Roy D.; Kerns, David; Eubanks, Micky D.

    2013-01-01

    Background Chemical suppression of arthropod herbivores is the most common approach to plant protection. Insecticides, however, can cause unintended, adverse consequences for non-target organisms. Previous studies focused on the effects of pesticides on target and non-target pests, predatory arthropods, and concomitant ecological disruptions. Little research, however, has focused on the direct effects of insecticides on plants. Here we demonstrate that applications of neonicotinoid insecticides, one of the most important insecticide classes worldwide, suppress expression of important plant defense genes, alter levels of phytohormones involved in plant defense, and decrease plant resistance to unsusceptible herbivores, spider mites Tetranychus urticae (Acari: Tetranychidae), in multiple, distantly related crop plants. Methodology/Principal Findings Using cotton (Gossypium hirsutum), corn (Zea mays) and tomato (Solanum lycopersicum) plants, we show that transcription of phenylalanine amonia lyase, coenzyme A ligase, trypsin protease inhibitor and chitinase are suppressed and concentrations of the phytohormone OPDA and salicylic acid were altered by neonicotinoid insecticides. Consequently, the population growth of spider mites increased from 30% to over 100% on neonicotinoid-treated plants in the greenhouse and by nearly 200% in the field experiment. Conclusions/Significance Our findings are important because applications of neonicotinoid insecticides have been associated with outbreaks of spider mites in several unrelated plant species. More importantly, this is the first study to document insecticide-mediated disruption of plant defenses and link it to increased population growth of a non-target herbivore. This study adds to growing evidence that bioactive agrochemicals can have unanticipated ecological effects and suggests that the direct effects of insecticides on plant defenses should be considered when the ecological costs of insecticides are evaluated. PMID

  10. Effects of irrigation levels on interactions among Lygus hesperus (Hemiptera: Miridae), insecticides, and predators in cotton.

    Science.gov (United States)

    Asiimwe, Peter; Naranjo, Steven E; Ellsworth, Peter C

    2014-04-01

    Variation in plant quality and natural enemy abundance plays an important role in insect population dynamics. In manipulative field studies, we evaluated the impact of varying irrigation levels and insecticide type on densities of Lygus hesperus Knight and the arthropod predator community in cotton. Three watering levels were established via irrigations timed according to three levels of percent soil water depletion (SWD): 20, 40, or 60, where 40% SWD is considered standard grower practice, 60% represents a deficit condition likely to impose plant productivity losses, and 20% represents surplus conditions with likely consequences on excessive vegetative plant production. The two key L. hesperus insecticides used were the broad-spectrum insecticide acephate and the selective insecticide flonicamid, along with an untreated check. We hypothesized that densities of L. hesperus and its associated predators would be elevated at higher irrigation levels and that insecticides would differentially impact L. hesperus and predator dynamics depending on their selectivity. L. hesperus were more abundant at the higher irrigation level (20% SWD) but the predator densities were unaffected by irrigation levels. Both L. hesperus and its predators were affected by the selectivity of the insecticide with highest L. hesperus densities and lowest predator abundance where the broad spectrum insecticide (acephate) was used. There were no direct interactions between irrigation level and insecticides, indicating that insecticide effects on L. hesperus and its predators were not influenced by the irrigation levels used here. The implications of these findings on the overall ecology of insect-plant dynamics and yield in cotton are discussed.

  11. Ethnobotany of plants used as insecticides, repellents and ...

    African Journals Online (AJOL)

    An ethnobotanical study on plants used for the prevention and treatment of malaria was conducted to document the indigenous knowledge particularly associated with the use and conservation of anti-malarial, insecticide and insect repellent medicinal plants. In this study, five sampling sites were selected based on the ...

  12. Antifeedant, insecticidal and growth inhibitory activities of selected plant oils on black cutworm, Agrotis ipsilon (Hufnagel (Lepidoptera: Noctuidae

    Directory of Open Access Journals (Sweden)

    Alagarmalai Jeyasankar

    2012-05-01

    Full Text Available Objective: To evaluate antifeedant, insecticidal and insect growth inhibitory activities of eucalyptus oil (Eucalyptus globules and gaultheria oil (Gaultheria procumbens L. against black cutworm, Agrotis ipsilon. Methods: Antifeedant, insecticidal and growth inhibitory activities of eucalyptus oil and gaultheria oil were tested against black cutworm, A. ipsilon. Results: Significant antifeedant activity was found in eucalyptus oil (96.24% where as the highest insecticidal activity was noticed in gaultheria oil (86.92%. Percentages of deformities were highest on gaultheria oil treated larvae and percentage of adult emergence was deteriorated also by gaultheria oil. Conclusions: These plants oil has potential to serve as an alternative eco-friendly control of insect pest.

  13. Insecticidal activity and fungitoxicity of plant extracts and components of horseradish (Armoracia rusticana) and garlic (Allium sativum).

    Science.gov (United States)

    Tedeschi, Paola; Leis, Marilena; Pezzi, Marco; Civolani, Stefano; Maietti, Annalisa; Brandolini, Vincenzo

    2011-01-01

    To avoid environmental pollution and health problems caused by the use of traditional synthetic pesticides, there is a trend to search for naturally occurring toxicants from plants. Among the compounds discussed for anti-fungal and insecticidal activity, the natural extracts from garlic and horseradish have attracted considerable attention. The objective of this study is to determine the insecticidal and anti-fungal activity of Armoracia rusticana and Allium sativum L. extracts against larvae of Aedes albopictus (Skuse) and some pathogenic fungi. For the insecticidal test, horseradish and garlic extracts were prepared from fresh plants (cultivated in Emilia Romagna region) in a solution of ethanol 80 % and the two different solutions were used at different concentrations (for the determination of the lethal dose) against the fourth instar mosquito's larvae. The fungicidal test was carried out by the agar plates technique using garlic and horseradish extracts in a 10 % ethanol solution against the following organisms: Sclerotium rolfsii Sacc., Trichoderma longibrachiatum, Botrytis cinerea Pers., Fusarium oxysporum Schlecht. and Fusarium culmorum (Wm. G. Sm.) Sacc. The first results demonstrated that the horseradish ethanol extracts present only a fungistatic activity against Sclerotium rolfsii Sacc., Fusarium oxysporum Schlecht. and F. culmorum (Wm.G. Sm) Sacc. while garlic extracts at the same concentration provided a good fungicidal activity above all against Botrytis cinerea Pers. and S. rolfsii. A. rusticana and A. sativum preparations showed also an interesting and significant insecticidal activity against larvae of A. albopictus, even if horseradish presented a higher efficacy (LC₅₀ value of 2.34 g/L), approximately two times higher than garlic one (LC₅₀ value of 4.48 g/L).

  14. Insecticide-mediated apparent displacement between two invasive species of leafminer fly.

    Directory of Open Access Journals (Sweden)

    Yulin Gao

    Full Text Available BACKGROUND: Closely related invasive species may often displace one another, but it is often difficult to determine mechanisms because of the historical nature of these events. The leafmining flies Liriomyza sativae and Liriomyza trifolii have become serious invasive agricultural pests throughout the world. Where both species have invaded the same region, one predominates over the other. Although L. sativae invaded Hainan Island of China first, it recently has been displaced by the newly invasive L. trifolii. We hypothesized that differential susceptibilities to insecticides could be causing this demographic shift. METHODOLOGY/PRINCIPAL FINDINGS: Avermectin and cyromazine are the most commonly used insecticides to manage leafminers, with laboratory bioassays demonstrating that L. trifolii is significantly less susceptible to these key insecticides than is L. sativae. In trials where similar numbers of larvae of both species infested plants, which subsequently were treated with the insecticides, the eclosing adults were predominately L. trifolii, yet similar numbers of adults of both species eclosed from control plants. The species composition was then surveyed in two regions where L. trifolii has just begun to invade and both species are still common. In field trials, both species occurred in similar proportions before insecticide treatments began. Following applications of avermectin and cyromazine, almost all eclosing adults were L. trifolii in those treatment plots. In control plots, similar numbers of adults of the two species eclosed, lending further credence to the hypothesis that differential insecticide susceptibilities could be driving the ongoing displacement of L. sativae by L. trifolii. CONCLUSIONS/SIGNIFICANCE: Our results show that differential insecticide susceptibility can lead to rapid shifts in the demographics of pest complexes. Thus, successful pest management requires the identification of pest species to understand the

  15. Ecotoxicity of natural insecticide based on tobacco plant extract and hematological effects on the Nile tilapia (Oreochromis niloticus. Ecotoxicity and hematological effects of a natural insecticide based on tobacco (Nicotiana tabacum extract on Nile tilapia (Oreochromis niloticus - doi: 10.4025/actascibiolsci.v35i2.14131

    Directory of Open Access Journals (Sweden)

    Marisa Narciso Fernandes

    2013-05-01

    Full Text Available Natural insecticides derived from plant extracts have been used as an alternative to synthetic products in order to reduce environmental contamination. The present study aimed to examine the effects of Fumydro®, a natural insecticide based in the tobacco plant Nicotiana tabacum, on the Nile tilapia (Oreochromis niloticus by determining the 48-h LC50 and evaluating their effects on hematological variables. Adult specimens of O. niloticus were exposed to four Fumydro® concentrations (200, 300, 400 and 500 μL L-1. The 48-h LC50 of Fumydro® was determined as 370 ± 50 μL L-1. Surviving fish showed increasing in the red blood cells, hemoglobin concentration, mean corpuscular hemoglobin and mean corpuscular hemoglobin concentration. The thrombocytes did not change but the percentage of neutrophils increased. These results indicated that the insecticide Fumydro® is toxic to Nile tilapia and the changes of the erythrocyte variables suggested hypoxemia induction with low effect on the immune system.Natural insecticides from plant extracts represent an alternative to the highly toxic synthetic products in order to reduce environmental contamination; however some might also be toxic for non-target organisms. The present study determined the 50% lethal concentration (48h; LC50 for adults Nile tilapia (Oreochromis niloticus exposed to the natural insecticide Fumydro®, based on the tobacco plant (Nicotiana tabacum, and evaluated its effect on hematological variables. After preliminary tests, adult specimens of O. niloticus were exposed to four Fumydro® concentrations (200, 300, 400 and 500 μL L-1. The 48h; LC50 of Fumydro® was determined at 370 ± 50 μL L-1. The surviving fish after exposure to Fumydro® showed an increase in the number of red blood cells, hemoglobin concentration, mean corpuscular hemoglobin and mean corpuscular hemoglobin concentration. The number of thrombocytes and leukocytes has not changed, unlike the differential leukocyte

  16. Plant compounds insecticide activity against Coleoptera pests of stored products Compostos de plantas com atividade inseticida a coleópteros-praga de produtos armazenados

    Directory of Open Access Journals (Sweden)

    Márcio Dionizio Moreira

    2007-07-01

    Full Text Available The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae, Rhyzopertha dominica F. (Bostrichidae and Sitophilus zeamais Mots. (Curculionidae. The plant species used were: basil (Ocimum selloi Benth., rue (Ruta graveolens L., lion's ear (Leonotis nepetifolia (L. R.Br., jimson weed (Datura stramonium L., baleeira herb (Cordia verbenacea L., mint (Mentha piperita L., wild balsam apple (Mormodica charantia L., and billy goat weed or mentrasto (Ageratum conyzoides L.. The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD50 from 2.72 to 39.71 mg g-1 a.i.. The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis.O objetivo deste trabalho foi selecionar plantas com atividade inseticida, para isolar, identificar e avaliar a bioatividade de compostos inseticidas presentes nessas plantas, contra as seguintes pragas de produtos armazenados da ordem Coleoptera: Sitophilus zeamais Mots. (Curculionidae, Rhyzopertha dominica F. (Bostrichidae e Oryzaephilus surinamensis L. (Silvanidae. As espécies de plantas usadas foram: anis (Ocimum selloi Benth, arruda (Ruta graveolens L., cordão-de-frade (Leonotis nepetifolia L., datura (Datura stramonium L., erva baleeira (Cordia verbenacea L., hortelã (Mentha piperita L., mel

  17. Plant Materials as an Appropriate Replacement for Reducing Environmental Risk of using Chemical Insecticides (Case Study: Colorado Potato Beetle

    Directory of Open Access Journals (Sweden)

    Akram taghizadeh sarokolaei

    2017-10-01

    Full Text Available Introduction Natural and human hazards arising from the use of chemical pesticides to reduce pest damage are significantly increased. In this way, tend to use alternatives with similar efficacy and less risk like plant to control pests has increased. Therefore, it seems that plant compounds can be used as alternatives to chemical insecticides to protect agricultural products in the future. These compounds have no harmful and negative effects on nature and are safer than chemical insecticides; they decompose rapidly, do not remain in soil and water and have no effect on non-target populations. One of the important agricultural products around the world is potato and a major pest of it around the world and in Iran that damage the product is Colorado potato beetle, Leptinotarsa decemlineata (Say. Nowadays chemical control is the most common method to control of this pest but causes resistance. According to the Colorado potato beetle resistant to conventional chemical pesticides for controlling them, in recent year tendency to use insecticide with plant origin become more for this pest.One of the most important plant compounds are essential oils. Due to the low risk of essential oils to humans and the environment and their insecticidal effect, we motivated to investigate the insecticidal effects of three important medicinal plants on Colorado potato beetle for reducing the environmental hazards arising from the use of chemical insecticides. Materials and methods Three insecticides thiamethoxam, diniteforane, imidacloprid were bought and three essential oils Satureja khuzistanica Jamzad, Ocimum basilicum L. and Mentha spicata L. were gathered in spring then dried in shade at room temperature and for later use in special plastic bags were stored at -24 ° C. With Clevenger essential oils were extracted. In the spring and summer 4th instars larvae of Leptinotarsa decemlineata Say from potato fields of Ardabil plain collected. Investigation against this

  18. Potentialisation de l'efficacite insecticide des poudres de feuilles ou ...

    African Journals Online (AJOL)

    Potentialisation de l'efficacite insecticide des poudres de feuilles ou amandes de neemier Azadirachta indica A . Juss par formulation avec la cendre de tiges de mil contre Sitophilus zeamais motsch. Et Sitophilus oryzae L. (Coleoptera : Curc.

  19. Dynamic plant uptake model applied for drip irrigation of an insecticide to pepper fruit plants.

    Science.gov (United States)

    Legind, Charlotte N; Kennedy, Coleen M; Rein, Arno; Snyder, Nathan; Trapp, Stefan

    2011-05-01

    Drip application of insecticides is an effective way to deliver the chemical to the plant that avoids off-site movement via spray drift and minimizes applicator exposure. The aim of this paper is to present a cascade model for the uptake of pesticide into plants following drip irrigation, its application for a soil-applied insecticide and a sensitivity analysis of the model parameters. The model predicted the measured increase and decline of residues following two soil applications of an insecticide to peppers, with an absolute error between model and measurement ranging from 0.002 to 0.034 mg kg fw(-1). Maximum measured concentrations in pepper fruit were approximately 0.22 mg kg fw(-1). Temperature was the most sensitive component for predicting the peak and final concentration in pepper fruit, through its influence on soil and plant degradation rates. Repeated simulations of pulse inputs with the cascade model adequately describe soil pesticide applications to an actual cropped system and reasonably mimic it. The model has the potential to be used for the optimization of practical features, such as application rates and waiting times between applications and before harvest, through the integrated accounting of soil, plant and environmental influences. Copyright © 2011 Society of Chemical Industry.

  20. Studies on the Growth Effects of the Canaline-Urea Cycle Amino Acids with Lemna minor L. 1

    Science.gov (United States)

    Rosenthal, Gerald A.; Gulati, Dushyant K.; Sabharwal, P. S.

    1975-01-01

    The aquatic microphyte, Lemna minor L., was utilized to assess the relative toxicity and general growth effects of canavanine, canaline, ureidohomoserine (UHS), and canavaninosuccinate (CSA). These amino acids are constituents of the canaline-urea cycle and structural analogues of the ornithine-urea cycle amino acids. Comparative growth studies with L. minor revealed that the canaline-urea cycle amino acids are potent antimetabolites. With the exception of CSA, they are extremely toxic at a concentration of 5 μm. Over a concentration range of 1 to 4 μm, canavanine is the most growth-inhibiting of the canaline-urea cycle amino acids. At or above 5 μm, canavanine and canaline possess comparable toxicity. UHS is less growth-inhibiting than canavanine or canaline, and CSA is the least toxic of the canaline-urea cycle intermediates. PMID:16659316

  1. Myrtaceae Plant Essential Oils and their β-Triketone Components as Insecticides against Drosophila suzukii

    Directory of Open Access Journals (Sweden)

    Chung Gyoo Park

    2017-06-01

    Full Text Available Spotted wing drosophila (SWD, Drosophila suzukii (Matsumura, Diptera: Drosophilidae is recognized as an economically important pest in North America and Europe as well as in Asia. Assessments were made for fumigant and contact toxicities of six Myrtaceae plant essential oils (EOs and their components to find new alternative types of insecticides active against SWD. Among the EOs tested, Leptospermum citratum EO, consisting mainly of geranial and neral, exhibited effective fumigant activity. Median lethal dose (LD50; mg/L values of L. citratum were 2.39 and 3.24 for males and females, respectively. All tested EOs except Kunzea ambigua EO exhibited effective contact toxicity. LD50 (µg/fly values for contact toxicity of manuka and kanuka were 0.60 and 0.71, respectively, for males and 1.10 and 1.23, respectively, for females. The LD50 values of the other 3 EOs-L. citratum, allspice and clove bud were 2.11–3.31 and 3.53–5.22 for males and females, respectively. The non-polar fraction of manuka and kanuka did not show significant contact toxicity, whereas the polar and triketone fractions, composed of flavesone, isoleptospermone and leptospermone, exhibited efficient activity with the LD50 values of 0.13–0.37 and 0.22–0.57 µg/fly for males and females, respectively. Our results indicate that Myrtaceae plant EOs and their triketone components can be used as alternatives to conventional insecticides.

  2. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  3. Plant Essential Oils from Apiaceae Family as Alternatives to Conventional Insecticides

    Directory of Open Access Journals (Sweden)

    Asgar Ebadollahi

    2013-06-01

    Full Text Available Main method to control insect pest is using synthetic insecticides, but the development of insect resistance to this products, the high operational cost, environmental pollution, toxicity to humans and harmful effect on non-target organisms have created the need for developing alternative approaches to control insect pest. Furthermore, the demand for organic crops, especially vegetables for the fresh market, has greatly increased worldwide. The ideal insecticide should control target pests adequately and should be target-specific, rapidly degradable, and low in toxicity to humans and other mammals. Plant essential oils could be an alternative source for insect pest control because they constitute a rich source of bioactive chemicals and are commonly used as flavoring agents in foods. These materials may be applied to food crops shortly before harvest without leaving excessive residues. Moreover, medically safe of these plant derivatives has emphasized also. For these reasons, much effort has been focused on plant essential oils or their constituents as potential sources of insect control agents. In this context, Apiaceae (Umbelliferae family would rank among the most important families of plants. In the last few years more and more studies on the insecticidal properties of essential oils from Apiaceae family have been published and it seemed worthwhile to compile them. The focus of this review lies on the lethal (ovicidal, larvicidal, pupicidal and adulticidal and sublethal (antifeedant, repellent, oviposition deterrent, Growth inhibitory and progeny production activities of plant essential oils and theirmain components from Apiaceae family. These features indicate that pesticides based on Apiaceae essential oils could be used in a variety of ways to control a large number of pests. It can be concluded that essential oils and phytochemicals isolated from Apiaceae family may be efficacious and safe replacements for conventional synthetic

  4. Antifeeding Activity of Several Plant Extracts Against Lymantria dispar L. (Lepidoptera: Lymantriidae Larvae

    Directory of Open Access Journals (Sweden)

    Sonja Gvozdenac

    2012-01-01

    Full Text Available Lymantria dispar L. is the most devastating polyphagous pest of deciduous forests, orchardsand urban greenery. To prevent damages that L. dispar larvae cause in forestry, agriculture andhorticulture, mechanical measures and the use of biological insecticides are the most frequentlyapplied practices. However, the use of conventional insecticides is inevitable in crop protectionand forest management on smaller areas, especially in gradation years. However, inadequateuse of these chemicals has led to disturbance of biocoenotic balance, outbreaks of somepreviously less harmful organisms and pesticide residues in soil and watercourses in someregions. To mitigate these consequences it is necessary to harmonize L. dispar control withintegrated management principles by applying selective and less toxic insecticides. Therefore,the potential of botanical insecticides and antifeeding substances is gaining in importance.The aim of this study was to assess the influence of ethanol extracts (1, 2 and 5% of Ambrosiaartemisiifolia L., Erigeron canadensis L., Daucus carota L., Morus alba L. and Aesculus hippocastanumL. on the feeding intensity of L. dispar larvae, i.e. to evaluate their antifeeding activity underthe conditions of “no-choice” test. Ten larvae per repetition were placed in Petri dishes andoffered oak leaf slices (2 x 9 cm2/repetition previously dipped in plant extract or ethanol (1, 2,and 5% for the control. Feeding intensity, expressed as a percentage of consumed leaf area (%,was measured after 48 h. For assessing the antifeeding activity of plant extracts AFI was calculatedand the extracts were classified according to scale: no antifeeding activity, slight antifeedingactivity, moderate antifeeding activity and strong antifeeding activity. Data were analyzedusing a two-way ANOVA and Duncan`s multiple range test. The results indicate that plantspecies, i.e. the origin of extracts, had a significant influence on the feeding intensity of L

  5. Comparative field evaluation of some newer versus conventional insecticides for the control of aphids (homoptera: aphididae) on oilseed rape (brassica napus l.)

    International Nuclear Information System (INIS)

    Sarwar, M.; Ahmad, N.; Bux, M.; Nasrullah, A.; Tofique, M.

    2011-01-01

    This study was designed to evaluate the effects of new insecticides like, Imidacloprid (Confidor 200 EC), Thiomethoxam (Actara 25 WG) and Acetamiprid (Megamos 20 SL) belonging to Nitroguanidine group along with conventional insecticides such as, Chlorpyrifos (Lorsban 40 EC) and Dimethoate (Systoate 40 EC) belonging to Organophosphate group against aphids' population on oilseed rape (Brassica napus L.). A perusal of data, based on the overall performance of the test compounds, reflected that newer insecticides were superior in reducing the population of aphids and yield enhancement as compared to conventional insecticides. The best results were achieved with the application of Imidacloprid by recording the lowest number of aphids (2.2 per plant) than obtained with Thiomethoxam and Acetamiprid (3.22 and 4.66, respectively). Other insecticides, viz., Chlorpyrifos and Dimethoate were also found to be effective in maintaining the aphids' population at lower levels per plant (16.2 and 17.5, respectively) over untreated control (227.7). Imidacloprid was responsible for increasing the grain yield to 3722.85 Kg per Hectare, approached by Thiomethoxam, Acetamiprid, Chlorpyrifos and Dimethoate as against unsprayed control (2980.0, 2542.85, 1542.85, 540.0 and 604.85 Kg per Hectare, respectively). Study indicated that selective use of newer insecticides would seem a reasonable strategy in aphids controlling and integration of such chemicals in insects' management package could help to reduce pest densities. (author)

  6. Control of sugar beet pests at early season by seed treatment with insecticides

    Directory of Open Access Journals (Sweden)

    Kereši Tatjana

    2006-01-01

    Full Text Available In the period 2001-2004, experiments were conducted in the region of Bačka (northern Serbia to assess the efficiency of insecticide treatment of sugar beet seeds in controlling soil pests (larvae of Elateridae family and reducing the damage caused by beet weevil (Bothynoderes punctiventris G e r m and flea beetle (Chaetocnema tibialis I l l i g. Several insecticides mostly systemic ones (carbofuran, thiamethoxam, fipronil, imidacloprid and clothianidin, and their combinations with pyrethroids in different doses were tested in field conditions. Stand density, percentages of plants damaged by B. punctiventris and C. tibialis, injury level and weight of juvenile plants served as parameters for evaluation of insecticide efficiency. Most of the insecticides applied to seeds provided a significantly better stand density compared with the untreated control. Because of their systemic action, imidacloprid, thiamethoxam and their mixtures with pyrethroids provided very good protection of juvenile plants from C. tibialis and in some cases from B. punctiventris.

  7. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  8. Reduced risk insecticides to control scale insects and protect natural enemies in the production and maintenance of urban landscape plants.

    Science.gov (United States)

    Frank, Steven D

    2012-04-01

    Armored scale insects are among the most difficult to manage and economically important arthropod pests in the production and maintenance of urban landscape plants. This is because of morphological traits that protect them from contact insecticides. I compared initial and season-long control of euonymus scale, Unaspis euonymi Comstock (Hemiptera: Diaspidae), by reduced-risk insecticides (insect growth regulators [IGRs], neonicotinoids, spirotetramat) to determine if they controlled scale as well as more toxic insecticides such as the organophosphate, acephate, and pyrethroid, bifenthrin. I also evaluated how these insecticides affected natural enemy abundance on experimental plants and survival when exposed to insecticide residue. All insecticides tested reduced first generation euonymus scale abundance. In 2009, reinfestation by second generation euonymus scale was highest on plants treated with acetamiprid and granular dinotefuran. In 2010, systemic neonicotinoids and spirotetramat prevented cottony cushion scale infestation 133 d after treatment whereas scale readily infested plants treated with bifenthrin and horticultural oil. Encarsia spp. and Cybocephalus spp. abundance was related to scale abundance. These natural enemies were generally less abundant than predicted by scale abundance on granular dinotefuran treated plants and more abundant on granular thiamethoxam treated plants. Bifenthrin residue killed 90-100% of O. insidiosus and E. citrina within 24 h. My results indicate that reduced risk insecticides can provide season-long scale control with less impact on natural enemies than conventional insecticides. This could have economic and environmental benefits by reducing the number of applications necessary to protect nursery and landscape plants from scale.

  9. Can Coffee Chemical Compounds and Insecticidal Plants Be Harnessed for Control of Major Coffee Pests?

    Science.gov (United States)

    Green, Paul W C; Davis, Aaron P; Cossé, Allard A; Vega, Fernando E

    2015-11-04

    Pests and pathogens threaten coffee production worldwide and are difficult to control using conventional methods, such as insecticides. We review the literature on the chemistry of coffee, concentrating on compounds most commonly reported from Coffea arabica and Coffea canephora. Differences in chemistry can distinguish coffee species and varieties, and plants grown under different biogeographic conditions exhibit different chemotypes. A number of chemical groups, such as alkaloids and caffeoylquinic acids, are known to be insecticidal, but most studies have investigated their effects on coffee quality and flavor. More research is required to bridge this gap in knowledge, so that coffee can be bred to be more resistant to pests. Furthermore, we report on some pesticidal plants that have been used for control of coffee pests. Locally sourced pesticidal plants have been underutilized and offer a sustainable alternative to conventional insecticides and could be used to augment breeding for resilience of coffee plants.

  10. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  11. Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.).

    Science.gov (United States)

    Xia, Xiaofeng; Sun, Botong; Gurr, Geoff M; Vasseur, Liette; Xue, Minqian; You, Minsheng

    2018-01-01

    The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L.), a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes), Enterobacter sp. (Proteobacteria), and Serratia sp. (Proteobacteria) from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella , while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

  12. Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.

    Directory of Open Access Journals (Sweden)

    Xiaofeng Xia

    2018-01-01

    Full Text Available The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L., a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes, Enterobacter sp. (Proteobacteria, and Serratia sp. (Proteobacteria from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella, while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

  13. Dynamic plant uptake model applied for drip irrigation of an insecticide to pepper fruit plants

    DEFF Research Database (Denmark)

    Legind, Charlotte Nielsen; Kennedy, C. M.; Rein, Arno

    2011-01-01

    irrigation, its application for a soil-applied insecticide and a sensitivity analysis of the model parameters. RESULTS: The model predicted the measured increase and decline of residues following two soil applications of an insecticide to peppers, with an absolute error between model and measurement ranging...... from 0.002 to 0.034 mg kg fw—1. Maximum measured concentrations in pepper fruit were approximately 0.22 mg kg fw—1. Temperature was the most sensitive component for predicting the peak and final concentration in pepper fruit, through its influence on soil and plant degradation rates...

  14. A Comparative Study of the Persistence, Movement and Metabolism of Six Insecticides in Soils and Plants

    International Nuclear Information System (INIS)

    Fuhremann, T.W.; Lichtenstein, E.P.

    1981-01-01

    Full text: Two soil types and oat plants grown in these soils were incubated under identical environmental conditions. The insecticides used in order to increase the water solubility were 14 C-DDT, 14 C-lindane, 14 C-fonofos, 14 C-parathion, 14 C-phorate and 14 C-carbofuran. Total amounts of 14 C-residues recovered from insecticide-treated loam soils plus oats grown in these soils were similar with DDT and oarbofuran. They were also higher than those observed with the other insecticides. While most of the 14 C-DDT residues remained in the soils, most of the 14 C-carbofuran residues were recovered from oat leaves in the form of carbofuran and 3-hydroxycarbofuran. 14 C-residues of all insecticides were more persistent in loam than in sandy soil and sand-grown oats took up more 14 C-insecticide residues than loamgrown oats. The more water-soluble insecticides, 14 C-phorate and Ccarbofuran were more mobile and were metabolized to a greater extent than insecticides of lower water solubilities. Unextractable (bound) 14 C-residues in loam soil ranged from 2.8% to 29.1% of the applied doses of 14 C-DDT and 14 C-parathion, respectively. Bound 14 C-residues were lower in the sandy soil than in the loam soil, however, plant-bound 14 C-residues were higher in oats grown in the sandy soil than in loam grown oats. Insecticide metabolites recovered from soils and plants were identified and quantitated whenever possible. The oxygen analog metabolites of the organophosphorus insecticides were most abundant in the sandy soil and in oats grown therein. Data illustrate the importance of chemical structure, water solubility and soil type in predicting the comparative environmental behaviour of pesticides. (author)

  15. Effect of insecticides and Plutella xylostella (Lepidoptera: Plutellidae) genotype on a predator and parasitoid and implications for the evolution of insecticide resistance.

    Science.gov (United States)

    Liu, Xiaoxia; Chen, Mao; Collins, Hilda L; Onstad, David; Roush, Rick; Zhang, Qingwen; Shelton, Anthony M

    2012-04-01

    In the laboratory and in cages in the greenhouse, we evaluated the toxicity of two insecticides (lambda-cyhalothrin and spinosad) on the parasitoid, Diadegma insulare (Cresson), and the predator, Coleomegilla maculate (DeGeer), both natural enemies of the diamondback moth, Plutella xylostella (L.). Lambda-cyhalothrin was very toxic to both natural enemies. Spinosad was less toxic to C. maculata adults and larvae, and slightly toxic to D. insulare. Both natural enemies suppressed P. xylostella populations in cages with 80% spinosad-treated and 20% nontreated plants; such suppression was not seen when lambda-cyhalothrin was used. Using broccoli, Brassica oleracea L. variety italica, a common host for P. xylostella, we also studied direct and indirect effects of both natural enemies in the presence and absence of the two insecticides and to different P. xylostella genotypes: resistant to the insecticide, susceptible, or heterozygous. Neither natural enemy could distinguish host genotype if P. xylostella were feeding on nontreated plants. They could also not distinguish between larvae feeding on spinosad-treated plants and nontreated plants, but D. insulare could distinguish between larvae feeding on lambda-cyhalothrin treated and nontreated plants. Our studies suggest that lambda-cyhalothrin has direct toxicity to these two natural enemies, can affect their host foraging and acceptance of P. xylostella and consequently would not be compatible in conserving these natural enemies in a program for suppression of P. xylostella. In contrast, our studies suggest that treatment with spinosad has much less effect on these natural enemies and would allow them to help suppress populations of P. xylostella. These findings are discussed in relation to the evolution of insecticide resistance and suppression of the pest populations.

  16. Multiple mitigation mechanisms: Effects of submerged plants on the toxicity of nine insecticides to aquatic animals.

    Science.gov (United States)

    Brogan, William R; Relyea, Rick A

    2017-01-01

    Understanding the processes that regulate contaminant impacts in nature is an increasingly important challenge. For insecticides in surface waters, the ability of aquatic plants to sorb, or bind, hydrophobic compounds has been identified as a primary mechanism by which toxicity can be mitigated (i.e. the sorption-based model). However, recent research shows that submerged plants can also rapidly mitigate the toxicity of the less hydrophobic insecticide malathion via alkaline hydrolysis (i.e. the hydrolysis-based model) driven by increased water pH resulting from photosynthesis. However, it is still unknown how generalizable these mitigation mechanisms are across the wide variety of insecticides applied today, and whether any general rules can be ascertained about which types of chemicals may be mitigated by each mechanism. We quantified the degree to which the submerged plant Elodea canadensis mitigated acute (48-h) toxicity to Daphnia magna using nine commonly applied insecticides spanning three chemical classes (carbamates: aldicarb, carbaryl, carbofuran; organophosphates: malathion, diazinon, chlorpyrifos; pyrethroids: permethrin, bifenthrin, lambda-cyhalothrin). We found that insecticides possessing either high octanol-water partition coefficients (log K ow ) values (i.e. pyrethroids) or high susceptibility to alkaline hydrolysis (i.e. carbamates and malathion) were all mitigated to some degree by E. canadensis, while the plant had no effect on insecticides possessing intermediate log K ow values and low susceptibility to hydrolysis (i.e. chlorpyrifos and diazinon). Our results provide the first general insights into which types of insecticides are likely to be mitigated by different mechanisms based on known chemical properties. We suggest that current models and mitigation strategies would be improved by the consideration of both mitigation models. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Insecticide resistance status of Aedes aegypti (L.) from Colombia.

    Science.gov (United States)

    Fonseca-González, Idalyd; Quiñones, Martha L; Lenhart, Audrey; Brogdon, William G

    2011-04-01

    To evaluate the insecticide susceptibility status of Aedes aegypti (L.) in Colombia, and as part of the National Network of Insecticide Resistance Surveillance, 12 mosquito populations were assessed for resistance to pyrethroids, organophosphates and DDT. Bioassays were performed using WHO and CDC methodologies. The underlying resistance mechanisms were investigated through biochemical assays and RT-PCR. All mosquito populations were susceptible to malathion, deltamethrin and cyfluthrin, and highly resistant to DDT and etofenprox. Resistance to lambda-cyhalothrin, permethrin and fenitrothion ranged from moderate to high in some populations from Chocó and Putumayo states. In Antioquia state, the Santa Fe population was resistant to fenitrothion. Biochemical assays showed high levels of both cytochrome P450 monooxygenases (CYP) and non-specific esterases (NSE) in some of the fenitrothion- and pyrethroid-resistant populations. All populations showed high levels of glutathione-S-transferase (GST) activity. GSTe2 gene was found overexpressed in DDT-resistant populations compared with Rockefeller susceptible strain. Differences in insecticide resistance status were observed between insecticides and localities. Although the biochemical assay results suggest that CYP and NSE could play an important role in the pyrethroid and fenitrothion resistance detected, other mechanisms remain to be investigated, including knockdown resistance. Resistance to DDT was high in all populations, and GST activity is probably the main enzymatic mechanism associated with this resistance. The results of this study provide baseline data on insecticide resistance in Colombian A. aegypti populations, and will allow comparison of changes in susceptibility status in this vector over time. Copyright © 2011 Society of Chemical Industry.

  18. Comparative susceptibilities of different life stages of the tarnished plant bug (Hemiptera: miridae) to three classes of insecticide

    Science.gov (United States)

    Insecticidal control of the tarnished plant bug, Lygus lineolaris (Palisot de Beauvois), is targeted at the adult and nymphal stages, but there is little information on relative susceptibilities of these insects to insecticides. Tarnished plant bug adults were collected from various locations in Mi...

  19. Insecticidal effect of furanocoumarins from fruits of Angelica archangelica L. against larvae Spodoptera littoralis Boisd

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Vrchotová, Naděžda

    2013-01-01

    Roč. 43, MAY 2013 (2013), s. 33-39 ISSN 0926-6690 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Keywords : Angelica archangelica * furanocoumarins * essential oils * plant extracts * spodoptera littoralis * botanical insecticides * insecticidal activity Subject RIV: EH - Ecology, Behaviour Impact factor: 3.208, year: 2013

  20. POSSIBILITIES TO USE NATURAL EXTRACTS FROM MEDICINAL AND AROMATIC PLANTS (MAP LIKE BOTANICAL REPELLENT OR INSECTICIDE COMPOUNDS AGAINST PEST INSECTS IN ECOLOGICAL CROPS (II

    Directory of Open Access Journals (Sweden)

    Irina IONESCU-MĂLĂNCUŞ

    2013-12-01

    Full Text Available Botanical insecticides have long been touted as attractive alternatives to synthetic chemical insecticides for pest management because botanicals reputedly pose little threat to the environment or to human health. The body of scientific literature documenting bioactivity of plant derivatives to arthropods pests continues to expand i.e. repellents based on essential oils extracted from Chenopodium ambrosioides, Eucalyptus saligna, Rosmarinus officinalis to mosquitoes, or cinnamon oil, sandalwood oil and turmeric oil are previously reported as insect repellents evaluatede in the laboratory conditions. With the constantly increasing problems of insecticide resistance and increasing public concerns regarding pesticide safety, new, safer active ingredients are becoming necessary to replace existing compounds on the market. The present study carried out in the period 2010-2012 comprises a review of two insect repellents, followed by some new research conducted in our laboratory on plant-derived insect repellents. The two alkaloids tested against the Colorado potato beetle, Leptinotarsa decemlineata Say in laboratory conditions was obtained by water and alchohol extraction from two vegetal species, Cichorium intybus L. (Asterales:Asteraceae and Delphinium consolida L. (Ranales:Ranunculaceae. The tests carried out in laboratory and field experimentally plots under cages permit to evaluate several other compounds for repellent activity of lacctucin alkaloids.

  1. Effectiveness of plant based insecticides as a sustainable means of ...

    African Journals Online (AJOL)

    Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...

  2. Neonicotinoid insecticides induce salicylate-associated plant defense responses

    Science.gov (United States)

    Ford, Kevin A.; Casida, John E.; Chandran, Divya; Gulevich, Alexander G.; Okrent, Rachel A.; Durkin, Kathleen A.; Sarpong, Richmond; Bunnelle, Eric M.; Wildermuth, Mary C.

    2010-01-01

    Neonicotinoid insecticides control crop pests based on their action as agonists at the insect nicotinic acetylcholine receptor, which accepts chloropyridinyl- and chlorothiazolyl-analogs almost equally well. In some cases, these compounds have also been reported to enhance plant vigor and (a)biotic stress tolerance, independent of their insecticidal function. However, this mode of action has not been defined. Using Arabidopsis thaliana, we show that the neonicotinoid compounds, imidacloprid (IMI) and clothianidin (CLO), via their 6-chloropyridinyl-3-carboxylic acid and 2-chlorothiazolyl-5-carboxylic acid metabolites, respectively, induce salicylic acid (SA)-associated plant responses. SA is a phytohormone best known for its role in plant defense against pathogens and as an inducer of systemic acquired resistance; however, it can also modulate abiotic stress responses. These neonicotinoids effect a similar global transcriptional response to that of SA, including genes involved in (a)biotic stress response. Furthermore, similar to SA, IMI and CLO induce systemic acquired resistance, resulting in reduced growth of a powdery mildew pathogen. The action of CLO induces the endogenous synthesis of SA via the SA biosynthetic enzyme ICS1, with ICS1 required for CLO-induced accumulation of SA, expression of the SA marker PR1, and fully enhanced resistance to powdery mildew. In contrast, the action of IMI does not induce endogenous synthesis of SA. Instead, IMI is further bioactivated to 6-chloro-2-hydroxypyridinyl-3-carboxylic acid, which is shown here to be a potent inducer of PR1 and inhibitor of SA-sensitive enzymes. Thus, via different mechanisms, these chloropyridinyl- and chlorothiazolyl-neonicotinoids induce SA responses associated with enhanced stress tolerance. PMID:20876120

  3. Insecticidal activity of the petroleum ether extract of Ageratum Conyzoides L

    International Nuclear Information System (INIS)

    Calle, Jairo; Rivera, Augusto

    1990-01-01

    We have determined the insecticidal activity of the petroleum ether (bp 40-60o C) extract of Ageratum Conyzoides L. Towards mosca domestica (diptera) third stage larvae and cynthia Carye (Lepidoptera) third, fourth and fifth stage larvae, being this extract also active against Acanthoscelides obtectus (Coleoptera) adults. We have isolated the known chromene precocene II from this extract, which is highly toxic to M. domestica third stage larvae under sunlight exposure, while no larvicidal effect was shown under U.V. irradiation or in dark. We have also identified two flavonoids: Eupalestin and lucidin dimethyl ether, which insecticidal role in this extract has not been determinate

  4. Insecticidal and Repellent Properties of Subtropical Plant Extracts Against Pulse Beetle, Callosobruchus chinensis

    Directory of Open Access Journals (Sweden)

    H.T. AI Lawati

    2002-01-01

    Full Text Available Extracts of eight plants local to Oman, namely Qarat (Acacia nilotica, Mustafal (Annona squamosa, Shereesh (Azadirachta indica, Luban (Boswellia sacra, Kheshkhash (Crotolaria juncea, Zebrot (Jatropha dhofarica Yas, (Myrtus communis and Suwwad (Suaeda aegyptiaca were prepared by steeping shaded dried leaf/ seed powder of each plant in water and solvent (methanol or ethanol. The extracts were tested for their insecticidal and repellent properties against the pulse beetles, Callosobruchus chinensis. The extracts from the seeds of A. squamosa recorded l00% mortality of beetles within twenty and four hours of their exposure to methanol and ethanol extracts, respectively. The other extracts that caused high mortality were from A. nilotica, C. juncea, M. communis and S. aegzptiaca in methanol and B. sacra, J. dhofarica, S. aegptiaca and commercial neem in ethanol. Extracts of M. communis in methanol were highly repellent to the beetles compared to other extracts. Legume seeds treated with extracts of A. squamosa were not repellent, rather the beetles were attracted to them.

  5. Determination of insecticidal activity of Heliopsis longipes A. Gray Blake, an endemic plant of Guanajuato state

    Directory of Open Access Journals (Sweden)

    Alejandro Hernández Morales

    2012-09-01

    Full Text Available Mosquitoes are involved in transmission of infectious diseases like malaria which affect human health, causing economic losses due to expensive treatments and job incapacity of patients. Strategies to minimize transmission of this disease are the employ of chemical insecticides that are excellent methods to reduce insect populations; however it causes deleterious effects on human health and environmental damage. Therefore is necessary to explore harmless alternatives, such as plant extracts which are potential source of natural insecticides. In this work we evaluated insecticidal properties of Heliopsis longipes A. Gray Blake against third instar larvae of Anopheles albimanus, malaria vector. Results showed that H.longipes A. Gray Blake has insecticide properties to control insect involved in malaria transmission.

  6. Effect of specific plant-growth-promoting rhizobacteria (PGPR) on growth and uptake of neonicotinoid insecticide thiamethoxam in corn (Zea mays L.) seedlings.

    Science.gov (United States)

    Myresiotis, Charalampos K; Vryzas, Zisis; Papadopoulou-Mourkidou, Euphemia

    2015-09-01

    Corn (Zea mays L.) is one of the most important cereal crops in the world and is used for food, feed and energy. Inoculation with plant-growth-promoting rhizobacteria (PGPR) would reduce the use of chemical fertilisers and pesticides and could be suggested as an alternative practice for sustainable production of corn in modern agricultural systems. In this study, the effect of two Bacillus PGPR formulated products, Companion (B. subtilis GB03) and FZB24 (B. subtilis FZB24), on corn growth and root uptake of insecticide thiamethoxam was investigated. All bacterial treatments enhanced root biomass production by 38-65% compared with the uninoculated control, with no stimulatory effect of PGPR on above-ground biomass of corn. The uptake results revealed that, in plants inoculated with the PGPR B. subtilis FZB24 and B. subtilis GB03, singly or in combination, the uptake and/or systemic translocation of thiamethoxam in the above-ground corn parts was significantly higher at the different growth ages compared with the control receiving no bacterial treatment. The findings suggest that the PGPR-elicited enhanced uptake of thiamethoxam could lead to improved efficiency of thiamethoxam using reduced rates of pesticides in combination with PGPR as an alternative crop protection technique. © 2014 Society of Chemical Industry.

  7. Selective insecticide-induced stimulation on fecundity and biochemical changes in Tryporyza incertulas (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Wang, Ai-Hua; Wu, Jin-Cai; Yu, Yue-Shu; Liu, Jing-Lan; Yue, Jiang-Fei; Wang, Mei-Yue

    2005-08-01

    The use of selective insecticides in rice, Oryza sativa L., fields often causes resurgence of nontarget pest insects. This study was conducted to investigate the effect of two selective insecticides, buprofezin and imidacloprid, on Tryporyza incertulas (Walker), a nontarget pest. After larval feeding on rice plants treated with each insecticide, fecundity, ovary protein content, and titer of juvenile hormone III (JHIII) in the resulting female moths were determined with 'Xiushui 63' rice susceptible to T. incertulas and 'Zhendao 2' moderately resistant to T. incertulas. The fecundity of females developed from larvae that fed on the insecticide-treated Xiushui 63 plants was stimulated compared with that of moths from larvae that fed on rice plants that were not treated with either insecticide. There was no stimulating effect in females from larvae that fed on insecticide-treated Zhendao 2 plants. The weight of fourth instars (final instars) that fed on the insecticide-treated Xiushui 63 rice plants was significantly greater than that of control, increasing by 50.3 and 46.7% for 60 and 112.5 g (AI) ha(-1) buprofezin, and by 23.7 and 19.5% for 15 and 37.5 g (AI) ha(-1) imidacloprid treatments, respectively. Ovary protein content in adult females developed from larvae that fed on the rice treated with the high dose of buprofezin was significantly higher than that in control. For the high and low doses of imidacloprid during the second instar, and the low dose of imidacloprid during the fourth instar, JHIII titers in female adults were also significantly higher than that in control, increasing by 152.81, 90.52, and 114.19%, respectively.

  8. The Experiment of Carbofuran Controlled Release Formulation Insecticide Application on Rice Plants

    International Nuclear Information System (INIS)

    Sulistyati, M.; Ulfa TS; Sofnie M Ch; Kuswadi AN

    2004-01-01

    Field test of carbofuran insecticide (2,3-dihydro-2,2-dimethyl-7-benzofuranyl-N-methylcarbamate) controlled release formulation on rice plants of IR-64 variety was carried out in Pusakanegara, West Java. This insecticide formulation was made by using the mixture of activated charcoal, tapioca, kaolin, Na-alginate as a filler matrix. Insecticide formulation was applied one week after transplanting. The observations were conducted on the number of tillers, damage level caused by Orseolia oryzae (Wood/Mason), Chilo suppressalis (Walker), and Cnaphalocrosis medinalis (Guen) on new young plants. The observation were carried out on three weeks after application of carbofuran insecticide formulation then every two weeks until harvest. The number of tillers were occurred at the treatments of controlled release formulation of 20kg/ha, 30kg/ha, and 40kg/ha dose rate on the third weeks, it was showed significant difference compared with commercial carbofuran, and the following weeks were no significant difference between the treatments. The attack of Orseolia oryzae was occurred at the treatments of controlled release formulation with dose rate of 30 kg/ha and 40 kg/ha on the seventh weeks, ninth weeks, and eleventh weeks, those attacks were significantly difference found compared with commercial carbofuran. The attack of Chilo suppressalis was occurred at the treatments of controlled release formulation of 40kg/ha dose rate on the fifth weeks, it was showed significant difference which was compared to untreated carbofuran. The attack of Cnaphalocrosis medinalis was occurred on the ninth weeks, three dose rate of controlled released formulation were showed significant differences which compared with commercial carbofuran and were showed 50% less than commercial carbofuran, while the grains dry weight were no significant difference between the treatments. (author)

  9. Insecticidal effects of essential oils extracted from aromatic plants on Ceratitis capitata (Wied.) in Lebanon

    Energy Technology Data Exchange (ETDEWEB)

    Abi Chahine, M [Lebanese Agricultural Research Institute, Jdeidet el-Metn (Lebanon); Khoury, N; Webeh, E [Lebanese Agricultural Research Institute, Jdeidet el-Metn (Lebanon)

    2005-07-01

    Full text: The excessive use of chemical pesticides to control agricultural pests is becoming alarming. The objective of this study is to search for biopesticides of plant origin that could be used to control one of the major pest of fruit production; the Mediterranean fruit fly (Ceratitis capitata Wied.). A colony of the Lebanese wild strain of this insect was reared under laboratory condition to provide biological material. The insecticidal activity of the essential oils extracted from aromatic plants in Lebanon was assessed. The tested plants are: Foeniculum vulgare, Thymbra spicata, Artemisia herba alba, Origanum syriacum, Ruta chalepensis, Lavandula stoechas, Salvia fruticosa, Mentha microphylla, Juniperus oxycedrus, Rosmarinus officinalis, Myrtus communis, Laurus nobilis and Ocimum gratissimum. Results show that essential oils isolated from F. vulgare, T. spicata, A. herba alba, O. syriacum and R. chalepensis have promising insecticidal potential. (author)

  10. Evaluation of the effectiveness of insecticide trunk injections for control of Latoia lepida (Cramer) in the sweet olive tree Osmanthus fragrans

    Science.gov (United States)

    Li, Yan; Shi, Xiao-Hua

    2016-01-01

    The screening of suitable insecticides is a key factor in successfully applying trunk injection technology to ornamental plants. In this study, six chemical pesticides were selected and injected into the trunks of Osmanthus fragrans to control the nettle caterpillar, Latoia lepida (Lepidoptera: Limacodidae), using a no-pressure injection system. The absorption rate of the insecticides, the leaf loss due to insect damage, and the mortality and frass amount of L. lepida larvae were evaluated after 77 and 429 days. The results showed that 4% imidacloprid + carbosulfan and 21% abamectin + imidacloprid + omethoate had the fastest conductivity and were completely absorbed into the trunkswithin14 days; however, the efficiencies of these insecticides in controlling L. lepidawere extremely low. Additionally, the treatment 10% emamectin benzoate + clothianidin and 2.5% emamectin benzoate was almost completely absorbed within 30 days and exhibited a longer duration of insecticide efficiency (>80% mortality) in the upper and lower leaves of the canopy. Treatment with these insecticides also resulted in significantly lower leaf loss and frass amounts. We conclude that emamectin benzoate and emamectin benzoate + clothianidin have a rapid uptake into O. fragrans, and are effective as insecticides over long durations. Hence, they may be a suitable control option for L. lepida in O. fragrans plants. PMID:27688974

  11. Evaluation of the effectiveness of insecticide trunk injections for control of Latoia lepida (Cramer in the sweet olive tree Osmanthus fragrans

    Directory of Open Access Journals (Sweden)

    Jun Huang

    2016-09-01

    Full Text Available The screening of suitable insecticides is a key factor in successfully applying trunk injection technology to ornamental plants. In this study, six chemical pesticides were selected and injected into the trunks of Osmanthus fragrans to control the nettle caterpillar, Latoia lepida (Lepidoptera: Limacodidae, using a no-pressure injection system. The absorption rate of the insecticides, the leaf loss due to insect damage, and the mortality and frass amount of L. lepida larvae were evaluated after 77 and 429 days. The results showed that 4% imidacloprid + carbosulfan and 21% abamectin + imidacloprid + omethoate had the fastest conductivity and were completely absorbed into the trunkswithin14 days; however, the efficiencies of these insecticides in controlling L. lepidawere extremely low. Additionally, the treatment 10% emamectin benzoate + clothianidin and 2.5% emamectin benzoate was almost completely absorbed within 30 days and exhibited a longer duration of insecticide efficiency (>80% mortality in the upper and lower leaves of the canopy. Treatment with these insecticides also resulted in significantly lower leaf loss and frass amounts. We conclude that emamectin benzoate and emamectin benzoate + clothianidin have a rapid uptake into O. fragrans, and are effective as insecticides over long durations. Hence, they may be a suitable control option for L. lepida in O. fragrans plants.

  12. Evaluation of the effectiveness of insecticide trunk injections for control of Latoia lepida (Cramer) in the sweet olive tree Osmanthus fragrans.

    Science.gov (United States)

    Huang, Jun; Zhang, Juan; Li, Yan; Li, Jun; Shi, Xiao-Hua

    2016-01-01

    The screening of suitable insecticides is a key factor in successfully applying trunk injection technology to ornamental plants. In this study, six chemical pesticides were selected and injected into the trunks of Osmanthus fragrans to control the nettle caterpillar, Latoia lepida (Lepidoptera: Limacodidae), using a no-pressure injection system. The absorption rate of the insecticides, the leaf loss due to insect damage, and the mortality and frass amount of L. lepida larvae were evaluated after 77 and 429 days. The results showed that 4% imidacloprid + carbosulfan and 21% abamectin + imidacloprid + omethoate had the fastest conductivity and were completely absorbed into the trunkswithin14 days; however, the efficiencies of these insecticides in controlling L. lepidawere extremely low. Additionally, the treatment 10% emamectin benzoate + clothianidin and 2.5% emamectin benzoate was almost completely absorbed within 30 days and exhibited a longer duration of insecticide efficiency (>80% mortality) in the upper and lower leaves of the canopy. Treatment with these insecticides also resulted in significantly lower leaf loss and frass amounts. We conclude that emamectin benzoate and emamectin benzoate + clothianidin have a rapid uptake into O. fragrans, and are effective as insecticides over long durations. Hence, they may be a suitable control option for L. lepida in O. fragrans plants.

  13. Thionation of Essential Oils from Algerian Artemisia Herba-alba L. and Ruta Montana L.: Impact on their Antimicrobial and Insecticidal Activities

    Directory of Open Access Journals (Sweden)

    Nassiba Fekhar

    2017-12-01

    Full Text Available Essential oils were extracted from Artemisia herba-alba L. and Ruta montana L. by means of steam distillation and thionated with a reagent combination of phosphorus pentasulfide and sodium bicarbonate. Both parent essential oils and their modified ones were screened for their biological and insecticidal activities. The results showed that essential oils were composed mainly of ketones; essential oils from Artemisia herba-alba L. and those from Ruta montana L. consisted of bicyclic monoterpenes and acyclic aliphatic ketones (thujone, camphor and 2-undecanone, respectively. The antimicrobial activity of essential oils was substantially improved upon thionation (from 10 to 34 mm and from 11 to 32 mm. The insecticidal effect of the thionated essential oil from Ruta montana L. was observed to be very significant, but that of the essential oil from Artemisia herba-alba L. was observed to decrease (from 100% to 70% after 24 hrs. The extracted essential oils as well as their thionated forms were characterized by GC-MS, FT-IR, and UV-visible.

  14. Insecticide dissipation from soil and plant surfaces in tropical horticulture of southern Benin, West Africa.

    Science.gov (United States)

    Rosendahl, Ingrid; Laabs, Volker; Atcha-Ahowé, Cyrien; James, Braima; Amelung, Wulf

    2009-06-01

    In Sub-Saharan Africa, horticulture provides livelihood opportunities for millions of people, especially in urban and peri-urban areas. Although the vegetable agroecosystems are often characterized by intensive pesticide use, risks resulting therefrom are largely unknown under tropical horticultural conditions. The objective of this study therefore was to study the fate of pesticides in two representative horticultural soils (Acrisol and Arenosol) and plants (Solanum macrocarpon L.) after field application and thus to gain first insight on environmental persistence and dispersion of typical insecticides used in vegetable horticulture in Benin, West Africa. On plant surfaces, dissipation was rapid with half lives ranging from 2 to 87 h (alpha-endosulfan < beta-endosulfan < deltamethrin). Soil dissipation was considerably slower than dissipation from plant surfaces with half-lives ranging from 3 (diazinon) to 74 d (total endosulfan), but persistence of pesticides in soil was still reduced compared to temperate climates. Nevertheless, for deltamethrin and endosulfan, a tendency for mid-term accumulation in soil upon repeated applications was observed. The soil and plant surface concentrations of the metabolite endosulfan sulfate increased during the entire trial period, indicating that this compound is a potential long-term pollutant even in tropical environments.

  15. Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV): Natural occurrence and efficacy as a biological insecticide on young banana plants in greenhouse and open-field conditions on the Canary Islands.

    Science.gov (United States)

    Fuentes, Ernesto Gabriel; Hernández-Suárez, Estrella; Simón, Oihane; Williams, Trevor; Caballero, Primitivo

    2017-01-01

    Chrysodeixis chalcites, an important pest of banana crops on the Canary Islands, is usually controlled by chemical insecticides. The present study aimed to evaluate the efficacy of the most prevalent isolate of the Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV, Baculoviridae) as a biological insecticide. Overall the prevalence of ChchNPV infection in C. chalcites populations was 2.3% (103 infected larvae out of 4,438 sampled), but varied from 0-4.8% on Tenerife and was usually low (0-2%) on the other islands. On Tenerife, infected larvae were present at 11 out of 17 plantations sampled. The prevalence of infection in larvae on bananas grown under greenhouse structures was significantly higher (3%) than in open-field sites (1.4%). The ChchNPV-TF1 isolate was the most abundant and widespread of four genetic variants of the virus. Application of 1.0x109 viral occlusion bodies (OBs)/l of ChchNPV-TF1 significantly reduced C. chalcites foliar damage in young banana plants as did commonly used pesticides, both in greenhouse and open-field sites. The insecticidal efficacy of ChchNPV-TF1 was similar to that of indoxacarb and a Bacillus thuringiensis (Bt)-based insecticide in one year of trials and similar to Bt in the following year of trails in greenhouse and field crops. However, larvae collected at different time intervals following virus treatments and reared in the laboratory experienced 2-7 fold more mortality than insects from conventional insecticide treatments. This suggests that the acquisition of lethal dose occurred over an extended period (up to 7 days) compared to a brief peak in larvae on plants treated with conventional insecticides. These results should prove useful for the registration of a ChchNPV-based insecticide for integrated management of this pest in banana crops on the Canary Islands.

  16. Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV: Natural occurrence and efficacy as a biological insecticide on young banana plants in greenhouse and open-field conditions on the Canary Islands.

    Directory of Open Access Journals (Sweden)

    Ernesto Gabriel Fuentes

    Full Text Available Chrysodeixis chalcites, an important pest of banana crops on the Canary Islands, is usually controlled by chemical insecticides. The present study aimed to evaluate the efficacy of the most prevalent isolate of the Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV, Baculoviridae as a biological insecticide. Overall the prevalence of ChchNPV infection in C. chalcites populations was 2.3% (103 infected larvae out of 4,438 sampled, but varied from 0-4.8% on Tenerife and was usually low (0-2% on the other islands. On Tenerife, infected larvae were present at 11 out of 17 plantations sampled. The prevalence of infection in larvae on bananas grown under greenhouse structures was significantly higher (3% than in open-field sites (1.4%. The ChchNPV-TF1 isolate was the most abundant and widespread of four genetic variants of the virus. Application of 1.0x109 viral occlusion bodies (OBs/l of ChchNPV-TF1 significantly reduced C. chalcites foliar damage in young banana plants as did commonly used pesticides, both in greenhouse and open-field sites. The insecticidal efficacy of ChchNPV-TF1 was similar to that of indoxacarb and a Bacillus thuringiensis (Bt-based insecticide in one year of trials and similar to Bt in the following year of trails in greenhouse and field crops. However, larvae collected at different time intervals following virus treatments and reared in the laboratory experienced 2-7 fold more mortality than insects from conventional insecticide treatments. This suggests that the acquisition of lethal dose occurred over an extended period (up to 7 days compared to a brief peak in larvae on plants treated with conventional insecticides. These results should prove useful for the registration of a ChchNPV-based insecticide for integrated management of this pest in banana crops on the Canary Islands.

  17. Chemical characterization and insecticidal activity of Calotropis gigantea L. flower extract against Tribolium castaneum (Herbst

    Directory of Open Access Journals (Sweden)

    Muhammad Rowshanul Habib

    2016-12-01

    Full Text Available Objective: To test the insecticidal activity of ethyl acetate extract of Calotropis gigantea L. flower (designated as EECF against stored grain pest Tribolium castaneum (Herbst of different larval and adult stages. Methods: Residual film method was used here to study the toxicity of EECF against Tribolium castaneum and gas chromatography-mass spectrometer analysis was also performed to characterize the chemicals of EECF. Results: In residual film bioassay, EECF showed lowest LD50 (0.134 mg/cm2 against 1st instar larvae of Tribolium castaneum and this finding ultimately revealed that the insect of initial stage was more susceptible than other stages. From the results of this study, it was found that with the increasing of age, Tribolium castaneum showed some extent of resistance against the toxicity of EECF. Moreover, chemical profiles of EECF identified by gas chromatography-mass spectrometer analysis were also found to consistent with its insecticidal activity. Conclusions: So, the overall results suggested that extracts of Calotropis gigantea L. flower have potential insecticidal effect which might be used in pest control.

  18. Reduction of neonicotinoid insecticide residues in Prairie wetlands by common wetland plants.

    Science.gov (United States)

    Main, Anson R; Fehr, Jessica; Liber, Karsten; Headley, John V; Peru, Kerry M; Morrissey, Christy A

    2017-02-01

    Neonicotinoid insecticides are frequently detected in wetlands during the early to mid-growing period of the Canadian Prairie cropping season. These detections also overlap with the growth of macrophytes that commonly surround agricultural wetlands which we hypothesized may reduce neonicotinoid transport and retention in wetlands. We sampled 20 agricultural wetlands and 11 macrophyte species in central Saskatchewan, Canada, over eight weeks to investigate whether macrophytes were capable of reducing movement of neonicotinoids from cultivated fields and/or reducing concentrations in surface water by accumulating insecticide residues into their tissues. Study wetlands were surrounded by clothianidin-treated canola and selected based on the presence (n=10) or absence (n=10) of a zonal plant community. Neonicotinoids were positively detected in 43% of wetland plants, and quantified in 8% of all plant tissues sampled. Three plant species showed high rates of detection: 78% Equisetum arvense (clothianidin, range: wetlands had higher detection frequency and water concentrations of clothianidin (β±S.E.: -0.77±0.26, P=0.003) and thiamethoxam (β±S.E.: -0.69±0.35, P=0.049) than vegetated wetlands. We assessed the importance of wetland characteristics (e.g. vegetative zone width, emergent plant height, water depth) on neonicotinoid concentrations in Prairie wetlands over time using linear mixed-effects models. Clothianidin concentrations were significantly lower in wetlands surrounded by taller plants (β±S.E.: -0.57±0.12, P≤0.001). The results of this study suggest that macrophytes can play an important role in mitigating water contamination by accumulating neonicotinoids and possibly slowing transport to wetlands during the growing season. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

    Directory of Open Access Journals (Sweden)

    Binh Cao Quan Nguyen

    2015-09-01

    Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  20. Insecticidal activities and phytochemical screening of crude extracts and its derived fractions from three medicinal plants Nepeta leavigata, Nepeta kurramensis and Rhynchosia reniformis

    International Nuclear Information System (INIS)

    Ahmad, N.; Shinwari, Z.K.

    2016-01-01

    The extracts and its derived fractions from three medicinal plants species Nepeta leavigata, Nepeta kurramensis and Rhynchosia reniformis were tested for insecticidal activities and preliminary phytochemical evaluation with the intention of standardization and proper manage of bioactive principles in such heterogonous botanicals and to encourage drug finding work with plants. The crude extracts and fractions from Nepeta plants showed moderate to strong insecticidal activity. Among the fractions from Nepeta kurramensis the n-butanol fraction showed strongest insecticidal activity with 89% mortality rate against Tribolium castaneum followed by methanol extract with 88% mortality ratio and in case of Nepeta leavigata the potential activity was showed by methanol extracts with 93% mortality rate against the tested insect. Surprisingly none of the extract / fractions obtained from Rhynchosia reniformis plant exhibited any insecticidal activity. The phytochemicals screening results revealed that both species of Nepeta showed similar phytochemicals profile. The group of chemicals terpenes, flavonoids and glycosides were observed in all the extracts/fractions of Nepeta plants. While phenolic compounds, acidic compounds and alkaloids were found in methanolic extracts, chloroform fraction and ethyl acetate fraction. The Rhynchosia reniformis was observed to be a good source of phenolic compounds, flavonoids, terpenes, alkaloids and fats. (author)

  1. Mapping insecticide resistance in Anopheles gambiae (s.l.) from Côte d'Ivoire.

    Science.gov (United States)

    Camara, Soromane; Koffi, Alphonsine A; Ahoua Alou, Ludovic P; Koffi, Kouakou; Kabran, Jean-Paul K; Koné, Aboubacar; Koffi, Mathieu F; N'Guessan, Raphaël; Pennetier, Cédric

    2018-01-08

    Insecticide resistance in malaria vectors is an increasing threat to vector control tools currently deployed in endemic countries. Resistance management must be an integral part of National Malaria Control Programmes' (NMCPs) next strategic plans to alleviate the risk of control failure. This obviously will require a clear database on insecticide resistance to support the development of such a plan. The present work gathers original data on insecticide resistance between 2009 and 2015 across Côte d'Ivoire in West Africa. Two approaches were adopted to build or update the resistance data in the country. Resistance monitoring was conducted between 2013 and 2015 in 35 sentinel sites across the country using the WHO standard procedure of susceptibility test on adult mosquitoes. Four insecticide families (pyrethroids, organochlorides, carbamates and organophosphates) were tested. In addition to this survey, we also reviewed the literature to assemble existing data on resistance between 2009 and 2015. High resistance levels to pyrethroids, organochlorides and carbamates were widespread in all study sites whereas some Anopheles populations remained susceptible to organophosphates. Three resistance mechanisms were identified, involving high allelic frequencies of kdr L1014F mutation (range = 0.46-1), relatively low frequencies of ace-1 R (below 0.5) and elevated activity of insecticide detoxifying enzymes, mainly mixed function oxidases (MFO), esterase and glutathione S-transferase (GST) in almost all study sites. This detailed map of resistance highlights the urgent need to develop new vector control tools to complement current long-lasting insecticidal nets (LLINs) although it is yet unclear whether these resistance mechanisms will impact malaria transmission control. Researchers, industry, WHO and stakeholders must urgently join forces to develop alternative tools. By then, NMCPs must strive to develop effective tactics or plans to manage resistance keeping in mind

  2. Alleloppathic effects and insecticidal activity of the aqueous extract of Satureja montana L.

    Directory of Open Access Journals (Sweden)

    Šućur Jovana

    2015-01-01

    Full Text Available Extensive use of synthetic insecticides, herbicides and other pesticides has negative effects on the environment and on human and animal health. Therefore scientists are turning towards natural pesticides such as active components of plant extracts. Effect of two concentrations (0.1% and 0.2% of Satureja montana L. aqueous extract on lipid peroxidation process, as well as the activity of the antioxidant enzymes (SOD, GPX, PPX and CAT in leaves and roots of pepper and black nightshade seedlings were examined 24, 72 and 120h after the treatment. Our results showed that higher concentration of S. montana aqueous extract induced lipid peroxidation in black nightshade roots. Furthermore, significant increases of pyrogallol and guaiacol peroxidase were detected in black nightshade leaves treated with 0.2% S. montana aqueous extract. The second aim was to evaluate effectiveness of aqueous extract as contact toxicant against whitefly. It was observed that aqueous extract with concentration of 0.2% showed toxic effect with 68.33% mortality after 96h.

  3. A review of plant protection against the olive fly (Bactrocera oleae (Rossi, 1790 Gmelin and molecular methods to monitor the insecticide resistance alleles

    Directory of Open Access Journals (Sweden)

    Matjaž Hladnik

    2017-01-01

    Full Text Available Olive fly (Bactrocera oleae (Rossi, 1790 Gmelin is one of the most important olive pests worldwide. Most plant protection measures are based on insecticides, especially organophosphates, pyrethroids, and recently a spinosad. Insecticides are used as cover sprays or in more environmentally friendly methods in which insecticides are used in combination with attractants and pheromones as bait sprays or for mass trapping. However, due to negative impacts of insecticides to environment, new plant protection methods are constantly developing with the aim to lower the consumption of insecticides or even to eliminate them by biological control with entomopathogenic organisms, sterile insect technique (SIT, or transgenic method RIDL (release of insects carrying a dominant lethal. However, these methods need to be improved in order to guarantee adequate protection. Alternative methods than those traditionally used are required due to long term usage causing the development of resistance to the insecticides, ultimately lowering their effectiveness. Molecular methods for monitoring the frequencies of resistant alleles and the current status of resistance alleles in olive growing countries are reviewed here.

  4. Comparison of the Insecticidal Characteristics of Commercially Available Plant Essential Oils Against Aedes aegypti and Anopheles gambiae (Diptera: Culicidae).

    Science.gov (United States)

    Norris, Edmund J; Gross, Aaron D; Dunphy, Brendan M; Bessette, Steven; Bartholomay, Lyric; Coats, Joel R

    2015-09-01

    Aedes aegypti and Anopheles gambiae are two mosquito species that represent significant threats to global public health as vectors of Dengue virus and malaria parasites, respectively. Although mosquito populations have been effectively controlled through the use of synthetic insecticides, the emergence of widespread insecticide-resistance in wild mosquito populations is a strong motivation to explore new insecticidal chemistries. For these studies, Ae. aegypti and An. gambiae were treated with commercially available plant essential oils via topical application. The relative toxicity of each essential oil was determined, as measured by the 24-h LD(50) and percentage knockdown at 1 h, as compared with a variety of synthetic pyrethroids. For Ae. aegypti, the most toxic essential oil (patchouli oil) was ∼1,700-times less toxic than the least toxic synthetic pyrethroid, bifenthrin. For An. gambiae, the most toxic essential oil (patchouli oil) was ∼685-times less toxic than the least toxic synthetic pyrethroid. A wide variety of toxicities were observed among the essential oils screened. Also, plant essential oils were analyzed via gas chromatography/mass spectrometry (GC/MS) to identify the major components in each of the samples screened in this study. While the toxicities of these plant essential oils were demonstrated to be lower than those of the synthetic pyrethroids tested, the large amount of GC/MS data and bioactivity data for each essential oil presented in this study will serve as a valuable resource for future studies exploring the insecticidal quality of plant essential oils. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Effects of spermine on the detection of induced forward mutation at the CAN1 locus in yeast: evidence for selection against canavanine-resistant mutants

    Energy Technology Data Exchange (ETDEWEB)

    McDougall, K.J.; Lemontt, J.F.

    1979-01-01

    The effect of exogenous spermine tetrahydrochloride (0.5 mg/ml) on hydrazine- and nitrous acid-induced forward mutation to canavanine resistance (CAN1 ..-->.. can1, normal to defective arginine permease) was examined in stationary-phase haploid Saccharomyces cerevisiae. Post-treatment cell division (specifically DNA replication) is required for hydrazine mutagenesis at this locus, whereas nitrous acid mutagenesis exhibits, in addition, a significant post-treatment-independent component.

  6. Biological alterations and self-reported symptoms among insecticides-exposed workers in Burkina Faso.

    Science.gov (United States)

    Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I

    2012-03-01

    Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.

  7. EVALUATION OF INSECTICIDES FOR PEST CONTROL IN MANGO (Mangifera indica L. IN TIERRA CALIENTE, GUERRERO, MEXICO

    Directory of Open Access Journals (Sweden)

    Yuridia Duran

    2017-12-01

    Full Text Available The mango crop is attacked by various pests, in Arcelia, Tierra Caliente, Guerrero, Mexico. Scale insects (Hemiptera and thrips (Thysanoptera were identified, the pesticides imidacloprid, spinosad, sulfur and mineral oil were tested against them, as well as their effect on fruit quality, using pest action thresholds. The thrips Frankliniella invasor appeared in the highest populations, but F. difficilis, F. occidentalis, F. fortissima, F. cephalica, Leptothrips macconnelli, L. bifurcatus and L. theobromae were also found. It was observed that mineral oil maintained the lowest populations and least damage in fruit; thrips species did not cause significant damage because they were seasonal pests that only occur when soft tissue is available in plants and once this tissue becomes unavailable populations diminish without the need of insecticides.  The mite Cisaberoptus kenyae was identified, which in high populations can cause crop damage; for its control sulfur yielded better results. The scale Milviscutulus mangiferae was present in very low populations. Treatment with mineral oil resulted in the highest quality fruits.

  8. Multiple insecticide resistance mechanisms in Anopheles gambiae s.l. populations from Cameroon, Central Africa.

    Science.gov (United States)

    Nwane, Philippe; Etang, Josiane; Chouaїbou, Mouhamadou; Toto, Jean Claude; Koffi, Alphonsine; Mimpfoundi, Rémy; Simard, Frédéric

    2013-02-22

    Increasing incidence of DDT and pyrethroid resistance in Anopheles mosquitoes is seen as a limiting factor for malaria vector control. The current study aimed at an in-depth characterization of An. gambiae s.l. resistance to insecticides in Cameroon, in order to guide malaria vector control interventions. Anopheles gambiae s.l. mosquitoes were collected as larvae and pupae from six localities spread throughout the four main biogeographical domains of Cameroon and reared to adults in insectaries. Standard WHO insecticide susceptibility tests were carried out with 4% DDT, 0.75% permethrin and 0.05% deltamethrin. Mortality rates and knockdown times (kdt50 and kdt95) were determined and the effect of pre-exposure to the synergists DEF, DEM and PBO was assessed. Tested mosquitoes were identified to species and molecular forms (M or S) using PCR-RFLP. The hot ligation method was used to depict kdr mutations and biochemical assays were conducted to assess detoxifying enzyme activities. The An. arabiensis population from Pitoa was fully susceptible to DDT and permethrin (mortality rates>98%) and showed reduced susceptibility to deltamethrin. Resistance to DDT was widespread in An. gambiae s.s. populations and heterogeneous levels of susceptibility to permethrin and deltamethrin were observed. In many cases, prior exposure to synergists partially restored insecticide knockdown effect and increased mortality rates, suggesting a role of detoxifying enzymes in increasing mosquito survival upon challenge by pyrethroids and, to a lower extent DDT. The distribution of kdr alleles suggested a major role of kdr-based resistance in the S form of An. gambiae. In biochemical tests, all but one mosquito population overexpressed P450 activity, whereas baseline GST activity was low and similar in all field mosquito populations and in the control. In Cameroon, multiple resistance mechanisms segregate in the S form of An. gambiae resulting in heterogeneous resistance profiles, whereas in

  9. Comparative analysis of mosqito (Diptera: Culicidae: Aedes aegypti Liston) responses to the insecticide Temephos and plant derived essential oil derived from Piper betle

    Science.gov (United States)

    Insecticide resistance development is a problem where insecticides are heavily used. Evaluation of a plant extracted oil compound as a 'green pesticide' was compared to treatments with Temephos. Evaluations on two insect populations either Wild strain (WS), or a susceptible laboratory strain (LS),...

  10. Characterization of UDP-glucuronosyltransferase genes and their possible roles in multi-insecticide resistance in Plutella xylostella (L.).

    Science.gov (United States)

    Li, Xiuxia; Shi, Haiyan; Gao, Xiwu; Liang, Pei

    2018-03-01

    Uridine diphosphate-glucuronosyltransferases (UGTs), as multifunctional detoxification enzymes, play important roles in the biotransformation of various compounds. However, their roles in insecticide resistance are still unclear. This study presents a genome-wide identification of the UGTs in diamondback moth, Plutella xylostella (L.), a notorious insect pest of cruciferous crops worldwide. The possible roles of these UGTs in insecticide resistance were evaluated. A total of 21 putative UGTs in P. xylostella were identified. Quantitative real-time polymerase chain reaction (PCR)-based analyses showed that all the UGT genes were expressed in all tested developmental stages and tissues. Bioassay results indicated that a field-collected population (BL) was resistant to 9 of 10 commonly used insecticides, and 10 of 21 UGT mRNAs were upregulated in the BL population. Exposure to the LC 50 of each insecticide affected the expression of most UGT genes. Among these, the expression levels of UGT40V1, UGT45B1 and UGT33AA4 were induced by more than five insecticides, whereas indoxacarb and metaflumizone significantly repressed the expression of most UGT genes. UGTs may play important roles in the metabolism of commonly used insecticides in P. xylostella. These findings provide valuable information for further research on the physiological and toxicological functions of specific UGT genes in P. xylostella. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  11. Insecticide resistance may enhance the response to a host-plant volatile kairomone for the codling moth, Cydia pomonella (L.)

    Science.gov (United States)

    Sauphanor, Benoît; Franck, Pierre; Lasnier, Thérèse; Toubon, Jean-François; Beslay, Dominique; Boivin, Thomas; Bouvier, Jean-Charles; Renou, Michel

    2007-06-01

    The behavioral and electroantennographic responses of Cydia pomonella (L.) to the ripe pear volatile ethyl (2 E,4 Z)-2,4-decadienoate (Et- E, Z-DD), were compared in insecticide-susceptible and -resistant populations originating from southern France. A dose-response relationship to this kairomonal attractant was established for antennal activity and did not reveal differences between susceptible and resistant strains. Conversely, males of the laboratory strains expressing metabolic [cytochrome P450-dependent mixed-function oxidases (mfo)] or physiological (kdr-type mutation of the sodium-channel gene) resistance mechanisms exhibited a significantly higher response to Et- E, Z-DD than those of the susceptible strain in a wind tunnel experiment. No response of the females to this kairomone could be obtained in our wind-tunnel conditions. In apple orchards, mfo-resistant male moths were captured at significantly higher rates in kairomone-baited traps than in traps baited with the sex pheromone of C. pomonella. Such a differential phenomenon was not verified for the kdr-resistant insects, which exhibited a similar response to both the sex pheromone and the kairomonal attractant in apple orchards. Considering the widespread distribution of metabolic resistance in European populations of C. pomonella and the enhanced behavioral response to Et- E, Z-DD in resistant moths, the development of control measures based on this kairomonal compound would be of great interest for the management of insecticide resistance in this species.

  12. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  13. Repellent Effect and Insecticidal Activities of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis Leaves Powders and Extracts against Dinoderus porcellus in Infested Dried Yam Chips

    Directory of Open Access Journals (Sweden)

    Laura Yêyinou Loko

    2017-01-01

    Full Text Available Dinoderus porcellus is considered as the most important pest of stored yam chips and compounds extracted from plants can be used for its control. The present study aimed to test the insecticidal and repellent activities of powders and extracts of leaves of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis against D. porcellus. The efficacy of plant powders was compared with the synthetic pesticide Antouka (Permethrin 3 g/kg + pirimiphos 16 g/kg. The results of the experiment revealed that all plant powders were effective as repellents. Antouka was more effective as insecticidal than the plant powders and minimal weight loss was observed with B. sapida at 2%. Among treatments, propanol extract of K. senegalensis at 5% was found to elicit the highest repellent effect on D. porcellus. The LC50 results revealed that the acetone extract of K. senegalensis is the most toxic (0.29 μL/insect to the pest, while the propanol extract of B. ferruginea at 5% exhibited strong fumigant toxicity against D. porcellus, with 88.89% of pest mortality at 160 μL/L air. The findings from the current work proved that plant powders and extracts of the three plants are sources of botanical insecticides which may be used in the integrated management of D. porcellus.

  14. Insecticide susceptibility of the green plant bug, Apolygus lucorum Meyer-Dür (Homoptera: Miridae and two predatory arthropods

    Directory of Open Access Journals (Sweden)

    Zhang Zhengqun

    2015-12-01

    Full Text Available The green plant bug (Apolygus lucorum Meyer-Dür is a key pest of Bt cotton in China. Along with biological control, chemical control is one of the most important strategies in A. lucorum Integrated Pest Management (IPM. The goal of this study was to evaluate the toxicity of eight conventional insecticides to A. lucorum and to assess the susceptibility of two generalist predators Chrysopa sinica (Jieder and Propylaea japonica (Thunbery to insecticides that are commonly used in A. lucorum management. Via glass-vial and leaf-dip bioassay, toxicity tests with selected insecticides at two different life-stages of A. lucorum indicated significant differences between the LD50 or LC50 values for these compounds within different insecticidal classes. Phenylpyrazole fipronil had the highest toxicity to 4th-instar nymphs and adults of A. lucorum, whereas neonicotinoid imidacloprid had the lowest toxicity among the insecticides. Females were more tolerant to insecticides than were males, as shown by the higher LD50 values for females. Furthermore, laboratory tests showed that endosulfan had the highest selectivity to C. sinica and P. japonica: the selective toxicity ratios (STRs were superior to other tested insecticides, particularly imidacloprid, and were 5.396 and 4.749-fold higher than baseline STRs, respectively. From this study, we conclude that fipronil can potentially be used to efficiently control A. lucorum. An alternative control agent worth consideration is endosulfan, owing to its relative safety to non-targeted natural enemies.

  15. Evaluation of a single application of Neonicotnoid and multi-application contact insecticides for flatheaded borer management in field grown Acer rubrum L. cultivars

    Science.gov (United States)

    Two trials evaluated insecticides for flatheaded borer (Chrysobothris femorata [Olivier]) control and red maple (Acer rubrum L.) cultivar growth over a 4-year period. Soil-applied systemic insecticides (acephate, imidacloprid, clothianidin, dinotefuran, and thiamethoxam) and trunk-applied contact i...

  16. Evaluation of antimalarial, free-radical-scavenging and insecticidal activities of Artemisia scoparia and A. Spicigera, Asteraceae

    Directory of Open Access Journals (Sweden)

    Fariba H. Afshar

    2011-12-01

    Full Text Available Artemisia species (Asteraceae, widespread throughout the world, are a group of important medicinal plants. The extracts of two medicinal plants of this genus, Artemisia scoparia Waldst. & Kit. and A. spicigera C. Koch, were evaluated for potential antimalarial, free-radical-scavenging and insecticidal properties, using the heme biocrystallisation and inhibition assay, the DPPH assay and the contact toxicity bioassay using the pest Tribolium castaneum, respectively. The methanol extracts of both species showed strong free-radical-scavenging activity and the RC50 values were 0.0317 and 0.0458 mg/mL, respectively, for A. scoparia and A. spicigera. The dichloromethane extracts of both species displayed a moderate level of potential antimalarial activity providing IC50 at 0.778 and 0.999 mg/mL for A. scoparia and A. spicigera, respectively. Both species of Artemisia showed insecticidal properties. However, A. spicigera was more effective than A. scoparia.

  17. Determination of insecticides malathion and lambda-cyhalothrin residues in zucchini by gas chromatography

    Directory of Open Access Journals (Sweden)

    Hayam M. Lofty

    2013-12-01

    Full Text Available A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticides. The method was applied to determine residues and the rate of disappearance of malathion and λ-cyhalothrin from fruits of zucchini (open field treatment, 50 cc of Malason/Cormandel 57% EC (emulsifiable concentrate for 100 L of water, 20 cc of LAMBDA SUPER FOG 5% liquid for 100 L of water. The insecticide incorporated into the plants decreased rapidly with a half-life time around 0.77 day (18.5h for malathion and 4 days for λ-cyhalothrin. It is not recommended to use zucchini before 12 h of malathion application. For λ-cyhalothrin, the preharvest interval is 5 days. Four market samples were chosen from different regions from A.R.E. and all of them showed no residues of malathion or λ-cyhalothrin.

  18. Establishment of the Processes of Absorption and Diffusion of Systemic Insecticides in Populus Euramericana Dode Guinier ''Robusta''; L'etablissement des processus d'absorption et diffusion des insecticides systemiques au Populus x Euramericana Dode Guinier ''Robista; Opredelenie protsessov pogloshcheniya i diffuzii somaticheskikh insektitsidov u Populus x Euramerican a Dode Guinier ''Robusta''; Determinacion de los procesos de absorcion y difusion de los insecticidas sistemicos en el Populus x Euramericana Dope Guinier ''Robusta''

    Energy Technology Data Exchange (ETDEWEB)

    Catrina, I.; Popa, A.; Constantinesco, V.; Constantinesco, O.; Constantinesco, El.; Hulula, C. [Institut de Recherches Forestieres de Bucarest, Bucharest (Romania)

    1963-09-15

    solution at the rate of 9.3% of the amount applied to the oil, as compared with 1.35% in laboratory experiments. Application of solution to the leaves by spraying yields a low insecticide absorption ate owing both to the difficult process of uptake through the leaves and to the removal of the insecticide by ain, dew and mist. Much insecticide was found on the ground and the authors therefore concluded that the method of administering systemic insecticide solutions through the soil should be adopted as a priority measure in the campaign against tree-species pests. (author) [French] Les insecticides organophosphoriques a proprietes systemiques, par leur faculte de penetrer dans le courant de seve des plantes, ont une action sur les insectes qui menent une partie de leur vie soit dans la zone cambiale entre le bois et l'ecorce, soit dans le bois. Jusqu'a l'apparition de ces nouveaux insecticides, la lutte chimique contre les insectes xylophages de la tige des arbres etait presque impossible. Pour etudier le mecanisme d'absorption, de diffusion et de localisation des insecticides systemiques en ce qui concerne les peupliers et les saules, especes frequemment attaquees par les insectes xylophages, on a fait des recherches en employant le ''Dipterex'' marque sur le peuplier Robusta R20. Le marquage de l'insecticide a ete fait dans un reacteur, en utilisant comme cible le Dipterex en poudre (1,5 g), avec un flux {Phi}= 10{sup 11} n/cm{sup 2} s et a une temperature de 30 a 40{sup o}C. L'irradiation a ete effectuee jusqu'a l'obtention d'une activite absolue de la cible {approx} 1 mc.. L'administration de l'insecticide a ete faite par verse des solutions dans le sol, sauf dans un cas ou l'on a pulverise l'insecticide sur l'appareil foliace. Une serie d'experiences a ete faite en laboratoire, en utilisant des plants cultives en pots; une autre serie a ete faite, en pepiniere, avec des plants de un et deux ans. En un laps de temps de un a deux mois apres l'administration des solutions

  19. Efficacy of Essential Oils from Edible Plants as Insecticides Against the House Fly, Musca Domestica L.

    Directory of Open Access Journals (Sweden)

    Sara M. Palacios

    2009-05-01

    Full Text Available The compositions of 12 essential oils (EOs obtained by hydrodistillation of edible fruits and herbs were analyzed by gas chromatography/mass spectroscopy (GC/MS. The insecticidal activity of each oil against the house fly Musca domestica was evaluated by placing flies in a glass jar with a screw cap that held a piece of EO-treated cotton yarn. The dose necessary to kill 50% of flies (LC50 in 30 min was determined at 26 ± 1°C. Twelve EOs and 17 individual terpenes were assayed against M. domestica, showing LC50 values ranging from 3.9 to 85.2 and from 3.3 to >100 mg/dm3, respectively. EO from Citrus sinensis was the most potent insecticide (LC50 = 3.9 mg/dm3, followed by EOs from C. aurantium (LC50 = 4.8 mg/dm3 and Eucalyptus cinerea (LC50 = 5.5 mg/dm3. According to GC/MS analysis, limonene (92.47%, linalool (1.43%, and b-myrcene (0.88% were the principal components of C. sinensis EO. Limonene was also the principal constituent (94.07% of C. aurantium, while 1,8-cineole (56.86% was the major constituent of E. cinerea EO. 1,8-Cineole was most active against M. domestica (LC50 = 3.3 mg/dm3, while (4R(+-limonene, was moderately active (LC50 = 6.2 mg/dm3. Dimethyl 2,2-dichlorovinyl phosphate (DDVP selected as a positive control, showed an LC50 of 0.5 mg/dm3. EOs from C. sinensis, C. aurantium, and E. cinerea show promise as natural insecticides against houseflies.

  20. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-06-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city.Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO.Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides.Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  1. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  2. Managing fall armyworm, Spodoptera frugiperda (Lepidoptera: Noctuidae), with Bt maize and insecticides in southern Brazil.

    Science.gov (United States)

    Burtet, Leonardo M; Bernardi, Oderlei; Melo, Adriano A; Pes, Maiquel P; Strahl, Thiago T; Guedes, Jerson Vc

    2017-12-01

    Maize plants expressing insecticidal proteins of Bacillus thuringiensis are valuable options for managing fall armyworm (FAW), Spodoptera frugiperda, in Brazil. However, control failures were reported, and therefore insecticides have been used to control this species. Based on these, we evaluated the use of Bt maize and its integration with insecticides against FAW in southern Brazil. Early-planted Agrisure TL, Herculex, Optimum Intrasect and non-Bt maize plants were severely damaged by FAW and required up to three insecticidal sprays. In contrast, YieldGard VT Pro, YieldGard VT Pro 3, PowerCore, Agrisure Viptera and Agrisure Viptera 3 showed little damage and did not require insecticides. Late-planted Bt maize plants showed significant damage by FAW and required up to four sprays, with the exceptions of Agrisure Viptera and Agrisure Viptera 3. Exalt (first and second sprays); Lannate + Premio (first spray) and Avatar (second spray); and Karate + Match (first spray) and Ampligo (second spray) were the most effective insecticides against FAW larvae in Bt and non-Bt maize. Maize plants expressing Cry proteins exhibited FAW control failures in southern Brazil, necessitating insecticidal sprays. In contrast, Bt maize containing the Vip3Aa20 protein remained effective against FAW. However, regardless of the insecticide used against FAW surviving on Bt maize, grain yields were similar. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  3. Compatibility of the entomopathogenic fungus Lecanicillium muscarium and insecticides for eradication of sweetpotato whitefly, Bemisia tabaci.

    Science.gov (United States)

    Cuthbertson, Andrew G S; Walters, Keith F A; Deppe, Carola

    2005-08-01

    The compatibility of the entomopathogenic fungus Lecanicillium muscarium and chemical insecticides used to control the second instar stages of the sweetpotato whitefly, Bemisia tabaci, was investigated. The effect on spore germination of direct exposure for 24 h to the insecticides imidacloprid, buprofezin, teflubenzuron and nicotine was determined. Only exposure to buprofezin was followed by acceptable spore germination. However, all chemicals significantly reduced spore germination when compared to a water control. Infectivity of L. muscarium in the presence of dry residues of buprofezin, teflubenzuron and nicotine (imidacloprid is a systemic pesticide) on foliage were also investigated. No significant detrimental effects on the level of control of B. tabaci was recorded when compared with fungi applied to residue free foliage on either tomato or verbena plants. Fungi in combination with imidacloprid gave higher B. tabaci mortality on verbena foliage compared to either teflubenzuron or nicotine and fungi combinations. Use of these chemical insecticides with L. muscarium in integrated control programmes for B. tabaci is discussed.

  4. The impact of insecticides to local honey bee colony Apis cerana indica in laboratory condition

    Science.gov (United States)

    Putra, Ramadhani E.; Permana, Agus D.; Nuriyah, Syayidah

    2014-03-01

    Heavy use of insecticides considered as one of common practice at local farming systems. Even though many Indonesian researchers had stated the possible detrimental effect of insecticide on agriculture environment and biodiversity, researches on this subject had been neglected. Therefore, our purpose in this research is observing the impact of insecticides usage by farmer to non target organisme like local honey bee (Apis cerana indica), which commonly kept in area near agriculture system. This research consisted of field observations out at Ciburial, Dago Pakar, Bandung and laboratory tests at School of Life Sciences and Technology, Institut Teknologi Bandung. The field observations recorded visited agriculture corps and types of pollen carried by bees to the nest while laboratory test recorderd the effect of common insecticide to mortality and behavior of honey bees. Three types of insecticides used in this research were insecticides A with active agent Chlorantraniliprol 50 g/l, insecticide B with active agent Profenofos 500 g/l, and insecticides C with active agent Chlorantraniliprol 100 g/l and λ-cyhalotrin 50g/l. The results show that during one week visit, wild flower, Wedelia montana, visited by most honey bees with average visit 60 honey bees followed by corn, Zea mays, with 21 honey bees. The most pollen carried by foragers was Wedelia montana, Calliandra callothyrsus, and Zea mays. Preference test show that honeybees tend move to flowers without insecticides as the preference to insecticides A was 12.5%, insecticides B was 0%, and insecticides was C 4.2%. Mortality test showed that insecticides A has LD50 value 0.01 μg/μl, insecticide B 0.31 μg/μl, and insecticides C 0.09 μg/μl which much lower than suggested dosage recommended by insecticides producer. This research conclude that the use of insecticide could lower the pollination service provide by honey bee due to low visitation rate to flowers and mortality of foraging bees.

  5. A Novel Insecticidal Peptide SLP1 Produced by Streptomyces laindensis H008 against Lipaphis erysimi

    Directory of Open Access Journals (Sweden)

    Lijian Xu

    2016-08-01

    Full Text Available Aphids are major insect pests for crops, causing damage by direct feeding and transmission of plant diseases. This paper was completed to discover and characterize a novel insecticidal metabolite against aphids from soil actinobacteria. An insecticidal activity assay was used to screen 180 bacterial strains from soil samples against mustard aphid, Lipaphis erysimi. The bacterial strain H008 showed the strongest activity, and it was identified by the phylogenetic analysis of the 16S rRNA gene and physiological traits as a novel species of genus Streptomyces (named S. laindensis H008. With the bioassay-guided method, the insecticidal extract from S. laindensis H008 was subjected to chromatographic separations. Finally, a novel insecticidal peptide was purified from Streptomyces laindensis H008 against L. erysimi, and it was determined to be S-E-P-A-Q-I-V-I-V-D-G-V-D-Y-W by TOF-MS and amino acid analysis.

  6. Evolutionary patchwork of an insecticidal toxin shared between plant-associated pseudomonads and the insect pathogens Photorhabdus and Xenorhabdus.

    Science.gov (United States)

    Ruffner, Beat; Péchy-Tarr, Maria; Höfte, Monica; Bloemberg, Guido; Grunder, Jürg; Keel, Christoph; Maurhofer, Monika

    2015-08-16

    Root-colonizing fluorescent pseudomonads are known for their excellent abilities to protect plants against soil-borne fungal pathogens. Some of these bacteria produce an insecticidal toxin (Fit) suggesting that they may exploit insect hosts as a secondary niche. However, the ecological relevance of insect toxicity and the mechanisms driving the evolution of toxin production remain puzzling. Screening a large collection of plant-associated pseudomonads for insecticidal activity and presence of the Fit toxin revealed that Fit is highly indicative of insecticidal activity and predicts that Pseudomonas protegens and P. chlororaphis are exclusive Fit producers. A comparative evolutionary analysis of Fit toxin-producing Pseudomonas including the insect-pathogenic bacteria Photorhabdus and Xenorhadus, which produce the Fit related Mcf toxin, showed that fit genes are part of a dynamic genomic region with substantial presence/absence polymorphism and local variation in GC base composition. The patchy distribution and phylogenetic incongruence of fit genes indicate that the Fit cluster evolved via horizontal transfer, followed by functional integration of vertically transmitted genes, generating a unique Pseudomonas-specific insect toxin cluster. Our findings suggest that multiple independent evolutionary events led to formation of at least three versions of the Mcf/Fit toxin highlighting the dynamic nature of insect toxin evolution.

  7. Evaluation of the effectiveness of insecticide trunk injections for control of Latoia lepida (Cramer) in the sweet olive tree Osmanthus fragrans

    OpenAIRE

    Jun Huang; Juan Zhang; Yan Li; Jun Li; Xiao-Hua Shi

    2016-01-01

    The screening of suitable insecticides is a key factor in successfully applying trunk injection technology to ornamental plants. In this study, six chemical pesticides were selected and injected into the trunks of Osmanthus fragrans to control the nettle caterpillar, Latoia lepida (Lepidoptera: Limacodidae), using a no-pressure injection system. The absorption rate of the insecticides, the leaf loss due to insect damage, and the mortality and frass amount of L. lepida larvae were evaluated af...

  8. Insecticidal and repellant activities of plants oil against stored grain pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of five plants oil for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Method: Five plants oil Citrus autantium, Cinnamomum zeylanicum, Gaultheria fragrantissima, Lavandula officinalis, and Ocimum sanctum were evaluated for their insecticidal and repellent activities against T. castaneum by adapting the standard protocol in vitro. Results: In Tulsi oil showed powerful repellent against T. castaneum beetles at both the concentration and this property can be clearly seen from the values at 5毺 1 (-0.60 and -0.73 in 1h and 6hr respectively and 10毺 1 (-0.56 and -0.81 in 1h and 6h respectively. Tulsi oil had more repelling property than other oil tested here against T. castaneum. Maximum percentage of mortality (76 and 92% at 48h and 72 hours after treatment respectively in Tulsi oil. Wintergreen oil showed 86% mortality at 72 hours after treatment. Conclusions: The present work for botanical products to control the insect pest of stored grain T. castaneum .These results suggest the presence of actives principles in the plant oils. Further exploration of active principles and their structural elucidations are underway.

  9. Is there a relationship between insect metabolic rate and mortality of mealworms Tenebrio molitor L. after insecticide exposure?

    Directory of Open Access Journals (Sweden)

    Justyna MALISZEWSKA

    2016-09-01

    Full Text Available Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxication with insecticides was also determined. The highest CO2 production and mortality rate was observed after mealworms exposition to neonicotinoid insecticide. The results suggest that high CO2 release after intoxication is adequate to the intensity of the non-specific action of the xenobiotic (e.g. hyperactivity of neuromuscular system, rather than the intensity of detoxification processes, and it is correlated with mealworms mortality.

  10. Insecticide resistance in Plutella xylostella (L.) (Lepidoptera: Yponomeutidae) in the Federal District, Brazil

    OpenAIRE

    Castelo Branco, Marina; Gatehouse, Alexander G.

    1997-01-01

    The levels of resistance to the insecticides cartap, deltamethrin and metamidophos were evaluated for three populations of the Diamondback Moth Plutella xylostella (L.) from the Federal District, Brazil in laboratory bioassays. The larvae of DBM showed levels of resistance to deltamethrin between 4 and 47 fold relative to a susceptible laboratory strain. The level of resistance to metamidophos was 2-9 fold greater than that of the susceptible strain. No resistance to cartap was detected. O...

  11. Impact of neonicotinoid insecticides on natural enemies in greenhouse and interiorscape environments.

    Science.gov (United States)

    Cloyd, Raymond A; Bethke, James A

    2011-01-01

    The neonicotinoid insecticides imidacloprid, acetamiprid, dinotefuran, thiamethoxam and clothianidin are commonly used in greenhouses and/or interiorscapes (plant interiorscapes and conservatories) to manage a wide range of plant-feeding insects such as aphids, mealybugs and whiteflies. However, these systemic insecticides may also be harmful to natural enemies, including predators and parasitoids. Predatory insects and mites may be adversely affected by neonicotinoid systemic insecticides when they: (1) feed on pollen, nectar or plant tissue contaminated with the active ingredient; (2) consume the active ingredient of neonicotinoid insecticides while ingesting plant fluids; (3) feed on hosts (prey) that have consumed leaves contaminated with the active ingredient. Parasitoids may be affected negatively by neonicotinoid insecticides because foliar, drench or granular applications may decrease host population levels so that there are not enough hosts to attack and thus sustain parasitoid populations. Furthermore, host quality may be unacceptable for egg laying by parasitoid females. In addition, female parasitoids that host feed may inadvertently ingest a lethal concentration of the active ingredient or a sublethal dose that inhibits foraging or egg laying. There are, however, issues that require further consideration, such as: the types of plant and flower that accumulate active ingredients, and the concentrations in which they are accumulated; the influence of flower age on the level of exposure of natural enemies to the active ingredient; the effect of neonicotinoid metabolites produced within the plant. As such, the application of neonicotinoid insecticides in conjunction with natural enemies in protected culture and interiorscape environments needs further investigation. Copyright © 2010 Society of Chemical Industry.

  12. Identification of Repellent and Insecticidal Constituents of the Essential Oil of Artemisia rupestris L. Aerial Parts against Liposcelis bostrychophila Badonnel

    OpenAIRE

    Liu, Xin; Li, Yin; Li, He; Deng, Zhi; Zhou, Ligang; Liu, Zhi; Du, Shu

    2013-01-01

    The aim of this research was to determine the chemical composition and insecticidal and repellent activity of the essential oil of Artemisia rupestris L. aerial parts against the booklice Liposcelis bostrychophila Badonnel and isolation of insecticidal and repellent constituents from the essential oil. The essential oil of A. rupestris was obtained by hydrodistillation and analyzed by GC-MS. A total of 30 components of the essential oil of A. rupestris was identified and the principal compoun...

  13. Combining the essential oil of Piper aduncum L. with commercial insecticides

    Directory of Open Access Journals (Sweden)

    Murilo Fazolin

    2016-12-01

    Full Text Available The use of synergists is important to minimize the amount of chemical insecticide required for insect control. Their use may contribute to reducing environmental contamination and preserving beneficial insects. The aim of this study was to evaluate the synergy and uniformity of the response of Spodoptera frugiperda (Noctuidae larvae to doses of an essential oil of an Amazon chemotype, Piper aduncum (Piperaceae, when combinationed with the following commercial insecticides: cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate, compared to piperonyl butoxide (PBO. Through the relationship between CL50 and DL50 of insecticides taken separately and their synergistic combinations with the essential oil and PBO, synergism factors (SF were obtained for comparison with each other. With residual contact, there was a significant enhancement of commercial insecticides formulated with cypermethrin (SF = 73.03, zeta-cypermethrin (SF = 16.51 and permethrin (SF = 8.46-17.22, when combined with the P. aduncum essential oil; in turn, with topical application, there was only an observed significant enhancement for zeta-cypermethrin (SF = 0.40-4.26, permethrin (SF = 2.10-4.79 and esfenvarelate (SF = 3.80 insecticides when combined with the essential oil. With the exception of esfenvarelate, the other synergistic combinations showed homogeneous responses for topical application and residual contact for at least one synergistic combination with P. aduncum essential oil. The significance of the SF values from combining P. aduncum essential oil with cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate insecticides may indicate that this essential oil is an alternative option to PBO.

  14. GC×GC-TOFMS Analysis of Essential Oils Composition from Leaves, Twigs and Seeds of Cinnamomum camphora L. Presl and Their Insecticidal and Repellent Activities.

    Science.gov (United States)

    Jiang, Hao; Wang, Jin; Song, Li; Cao, Xianshuang; Yao, Xi; Tang, Feng; Yue, Yongde

    2016-03-28

    Interest in essential oils with pesticidal activity against insects and pests is growing. In this study, essential oils from different parts (leaves, twigs and seeds) of Cinnamomum camphora L. Presl were investigated for their chemical composition, and insecticidal and repellent activities against the cotton aphid. The essential oils, obtained by hydrodistillation, were analyzed by GC×GC-TOFMS. A total of 96 components were identified in the essential oils and the main constituents found in the leaves and twigs were camphor, eucalyptol, linalool and 3,7-dimethyl-1,3,7-octatriene. The major components found in the seeds were eucalyptol (20.90%), methyleugenol (19.98%), linalool (14.66%) and camphor (5.5%). In the contact toxicity assay, the three essential oils of leaves, twigs and seeds exhibited a strong insecticidal activity against cotton aphids with LC50 values of 245.79, 274.99 and 146.78 mg/L (after 48 h of treatment), respectively. In the repellent assay, the highest repellent rate (89.86%) was found in the seed essential oil at the concentration of 20 μL/mL after 24 h of treatment. Linalool was found to be a significant contributor to the insecticidal and repellent activities. The results indicate that the essential oils of C. camphora might have the potential to be developed into a natural insecticide or repellent for controlling cotton aphids.

  15. PENGUJIAN BEBERAPA JENIS INSEKTISIDA NABATI TERHADAP KUTU BERAS (Sitophilus oryzae L

    Directory of Open Access Journals (Sweden)

    Muhammad Isnaini

    2015-08-01

    Full Text Available The purpose of this study first to determine whether or not capable of  natural insecticides to kill Sitophilus oryzae L and to determine effective of  natural insecticides to kill Sitophilus oryzae L. This type of research is an experimental research with quantitative descriptive and The data collection techniques used is the observation and documentation. The data analyzed with ANOVA analysis techniques followed by BJND test. Based on the comparison of the calculated F value contained in the ANOVA analysis is greater than the F table , either at the significant level of 5 % and the 1% significance level (79.57 > 2.67 / 4:43. Thus stated that H1 accepted and rejected H0. The results showed that the first, the natural insecticide able to kill Sitophilus oryzae L and mortality rate highest in Cymbopogon citratus treatment that is equal to 13.2 with the total percentage of mortality of 66%, both effective plant-based insecticides to kill Sitophilus oryzae L that leaves just Cymbopogon citratus (66% and Morinda citrifolia L (60%.The conclusions obtained from this study: First, some kind of  natural insecticide able to kill Sitophilus oryzae L,  second based on the results of the ANOVA analysis of all types of insecticides to kill Sitophilus oryzae L effectively, but if effectiveness was seen by the number of mortality up to 50 % or more, then just Cymbopogon citratus and Morinda citrifolia L.

  16. Fumigant activity of plant essential oils and components from horseradish (Armoracia rusticana), anise (Pimpinella anisum) and garlic (Allium sativum) oils against Lycoriella ingenua (Diptera: Sciaridae).

    Science.gov (United States)

    Park, Ii-Kwon; Choi, Kwang-Sik; Kim, Do-Hyung; Choi, In-Ho; Kim, Lee-Sun; Bak, Won-Chull; Choi, Joon-Weon; Shin, Sang-Chul

    2006-08-01

    Plant essential oils from 40 plant species were tested for their insecticidal activities against larvae of Lycoriella ingénue (Dufour) using a fumigation bioassay. Good insecticidal activity against larvae of L. ingenua was achieved with essential oils of Chenopodium ambrosioides L., Eucalyptus globulus Labill, Eucalyptus smithii RT Baker, horseradish, anise and garlic at 10 and 5 microL L(-1) air. Horseradish, anise and garlic oils showed the most potent insecticidal activities among the plant essential oils. At 1.25 microL L(-1), horseradish, anise and garlic oils caused 100, 93.3 and 13.3% mortality, but at 0.625 microL L(-1) air this decreased to 3.3, 0 and 0% respectively. Analysis by gas chromatography-mass spectrometry led to the identification of one major compound from horseradish, and three each from anise and garlic oils. These seven compounds and m-anisaldehyde and o-anisaldehyde, two positional isomers of p-anisaldehyde, were tested individually for their insecticidal activities against larvae of L. ingenua. Allyl isothiocyanate was the most toxic, followed by trans-anethole, diallyl disulfide and p-anisaldehyde with LC(50) values of 0.15, 0.20, 0.87 and 1.47 microL L(-1) respectively.

  17. Insecticidal effect of plant extracts on Phlebotomus argentipes (Diptera: Psychodidae) in Bihar, India.

    Science.gov (United States)

    Dinesh, Diwakar Singh; Kumari, Seema; Pandit, Vibhishan; Kumar, Jainendra; Kumari, Nisha; Kumar, Prahlad; Hassan, Faizan; Kumar, Vijay; Das, Pradeep

    2015-12-01

    Phlebotomus argentipes (Diptera: Psychodidae), the established vector for kala-azar is presently being controlled by indoor residual spray of DDT in kala-azar endemic areas in India. Search for non-hazardous and non-toxic biodegradable active molecules from botanicals may provide cost-effective and eco-friendly alternatives to synthetic insecticides. The present study was aimed at evaluating various plant extracts from endemic and non-endemic areas of Bihar for their insecticidal activity against sandfly to identify the most effective plant extract. Bio-assay test was conducted with larvae and adult of P. argentipes with different plant extracts collected in distilled water, hexane, ethyl acetate, acetone and methanol. Thin layer chromatography (TLC), column chromatography and high performance liquid chromatography (HPLC) were conducted for detection of active molecules. Adults and larvae of sandflies exposed to the aqueous extract of Nicotiana tabacum resulted in 100 per cent mortality. The hexane extract of Clerodendrum infortunatum was found to kill 77 per cent adults but was ineffective against larvae. Bio-assay test of the ninth fraction (hexane extract-methanol phase) separated by column chromatography was found to be 63 per cent effective. The purple spot on the TLC of this fraction indicated the presence of a diterpenoid. HPLC of this fraction detected nine compounds with two peaks covering 20.44 and 56.52 per cent areas with retention time of 2.439 and 5.182 min, respectively supporting the TLC results. The column separated 9 [th] fraction of C. infortunatum extract was found to be effective in killing 63 per cent of adult P. argentipes. Compounds of this fraction need to be evaluated further for identification and characterization of the active molecule by conducting individual bio-assay tests followed by further fractionation and HPLC. Once the structure of the active molecule is identified and validated, it may be synthesized and formulated as a product.

  18. The control and protection of cotton plants using natural insecticides against the colonization by Aphis gossypii Glover (Hemiptera: Aphididae - doi: 10.4025/actasciagron.v35i2.15764

    Directory of Open Access Journals (Sweden)

    Ezio Santos Pinto

    2012-12-01

    Full Text Available The cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae, is a key pest of cotton, irrespective of the use of conventional or organic management. In organic systems, however, the use of synthetic insecticides is not allowed, increasing the difficulty of controlling this pest. This work evaluated aphid control and the ability of products to prevent aphid infestation using natural insecticides compared to a standard synthetic insecticide. The control trial was conducted with four products [Beauveria bassiana (Boveril®, neem oil (Neemseto®, and cotton seed oil compared to thiamethoxam (Actara®], and untreated plants served as the control group. The trial testing the efficacy of these products in preventing aphid infestation was conducted using the same products, excluding Boveril®. The evaluations were conducted 72 and 120h post-treatment for the efficacy and the protection against colonization trials, respectively. The aphid control by cotton seed oil, Neemseto®, and thiamethoxam was similar, with 100% control being achieved on the thiamethoxam-treated plants. Regarding the plant protection against aphid colonization, the insecticide thiamethoxam exhibited a better performance compared to the other tested products with steady results over the evaluation period. The natural products exhibited variable results with low protection against plant colonization throughout the evaluation period.

  19. Mechanisms of insecticide resistance in field populations of Aedes aegypti (L.) from Quintana Roo, Southern Mexico.

    Science.gov (United States)

    Flores, Adriana E; Grajales, Jaime Salomon; Salas, Ildefonso Fernandez; Garcia, Gustavo Ponce; Becerra, Ma Haydee Loaiza; Lozano, Saul; Brogdon, William G; Black, William C; Beaty, Barry

    2006-12-01

    Potential insecticide-resistance mechanisms were studied with the use of biochemical assays in Aedes aegypti (L.) collected from 5 municipalities representing the north part of Quintana Roo: Benito Juarez, Cozumel, Isla Mujeres, Lazaro Cardenas, and Solidaridad. The activities of alpha and beta esterases, mixed-function oxidases (MFO), glutathione-S-transferase (GST), acethylcholinesterase (AChE), and insensitive acethylcholinesterase (iAChE) were assayed in microplates. Three replicates were performed for each enzyme and 60 males and 60 females were analyzed in each population. The New Orleans (NO) susceptible strain of Ae. aegypti was used as a susceptible reference and the threshold criteria for each enzyme were the highest NO absorbance values. In none of the 6 tests were absorbance values correlated in males and females. alpha esterases were elevated in Benito Juarez, Cozumel females and in Lazaro Cardenas males and females. beta esterases were elevated in Benito Juarez, Cozumel females and in Cozumel and Lazaro Cardenas males. Elevated esterases suggest potential insecticide-resistance mechanisms against organophosphate, carbamate, and some pyrethroid insecticides. Slightly elevated levels of MFOs appeared in Lazaro Cardenas females and in Cozumel, Isla Mujeres, and Solidaridad males. Mechanisms involving iAChE or GST were not apparent.

  20. The evolution of insecticide resistance in the brown planthopper (Nilaparvata lugens Stål) of China in the period 2012-2016.

    Science.gov (United States)

    Wu, Shun-Fan; Zeng, Bin; Zheng, Chen; Mu, Xi-Chao; Zhang, Yong; Hu, Jun; Zhang, Shuai; Gao, Cong-Fen; Shen, Jin-Liang

    2018-03-15

    The brown planthopper, Nilaparvata lugens, is an economically important pest on rice in Asia. Chemical control is still the most efficient primary way for rice planthopper control. However, due to the intensive use of insecticides to control this pest over many years, resistance to most of the classes of chemical insecticides has been reported. In this article, we report on the status of eight insecticides resistance in Nilaparvata lugens (Stål) collected from China over the period 2012-2016. All of the field populations collected in 2016 had developed extremely high resistance to imidacloprid, thiamethoxam, and buprofezin. Synergism tests showed that piperonyl butoxide (PBO) produced a high synergism of imidacloprid, thiamethoxam, and buprofezin effects in the three field populations, YA2016, HX2016, and YC2016. Functional studies using both double-strand RNA (dsRNA)-mediated knockdown in the expression of CYP6ER1 and transgenic expression of CYP6ER1 in Drosophila melanogaster showed that CYP6ER1 confers imidacloprid, thiamethoxam and buprofezin resistance. These results will be beneficial for effective insecticide resistance management strategies to prevent or delay the development of insecticide resistance in brown planthopper populations.

  1. The quantitative structure-insecticidal activity relationships from plant derived compounds against chikungunya and zika Aedes aegypti (Diptera:Culicidae) vector.

    Science.gov (United States)

    Saavedra, Laura M; Romanelli, Gustavo P; Rozo, Ciro E; Duchowicz, Pablo R

    2018-01-01

    The insecticidal activity of a series of 62 plant derived molecules against the chikungunya, dengue and zika vector, the Aedes aegypti (Diptera:Culicidae) mosquito, is subjected to a Quantitative Structure-Activity Relationships (QSAR) analysis. The Replacement Method (RM) variable subset selection technique based on Multivariable Linear Regression (MLR) proves to be successful for exploring 4885 molecular descriptors calculated with Dragon 6. The predictive capability of the obtained models is confirmed through an external test set of compounds, Leave-One-Out (LOO) cross-validation and Y-Randomization. The present study constitutes a first necessary computational step for designing less toxic insecticides. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Identification of Repellent and Insecticidal Constituents of the Essential Oil of Artemisia rupestris L. Aerial Parts against Liposcelis bostrychophila Badonnel

    Directory of Open Access Journals (Sweden)

    Zhi Long Liu

    2013-09-01

    Full Text Available The aim of this research was to determine the chemical composition and insecticidal and repellent activity of the essential oil of Artemisia rupestris L. aerial parts against the booklice Liposcelis bostrychophila Badonnel and isolation of insecticidal and repellent constituents from the essential oil. The essential oil of A. rupestris was obtained by hydrodistillation and analyzed by GC-MS. A total of 30 components of the essential oil of A. rupestris was identified and the principal compounds in the essential oil were α-terpinyl acetate (37.18%, spathulenol (10.65%, α-terpineol (10.09%, and linalool (7.56%, followed by 4-terpineol (3.92% and patchoulol (3.05%. Based on bioactivity-guided fractionation, the four active constituents were isolated from the essential oil and identified as α-terpineol, α-terpinyl acetate, 4-terpineol and linalool. The essential oil of A. rupestris exhibited contact toxicity against L. bostrychophila with LD50 value of 414.48 µg/cm2. α-Terpinyl acetate (LD50 = 92.59 µg/cm2 exhibited stronger contact toxicity against booklice than α-terpineol (LD50 = 140.30 µg/cm2, 4-terpineol (LD50 = 211.35 µg/cm2, and linalool (LD50 = 393.16 µg/cm2. The essential oil of A. rupestris (LC50 = 6.67 mg/L air also possessed fumigant toxicity against L. bostrychophila while the four constituents, 4-terpineol, α-terpineol, α-terpinyl acetate and linalool had LC50 values of 0.34, 1.12, 1.26 and 1.96 mg/L air, respectively. α-Terpinol and α-terpinyl acetate showed strong repellency against L. bostrychophila, while linalool and 4-terpinol exhibited weak repellency. The results indicate that the essential oil of A. rupestris aerial parts and its constituent compounds have potential for development into natural insecticides or fumigants as well as repellents for control of insects in stored grains.

  3. Insecticidal Constituents of Essential Oil Derived from Zanthoxylum armatum against Two Stored-Product Insects.

    Science.gov (United States)

    Wang, Cheng-Fang; Zhang, Wen-Juan; You, Chun-Xue; Guo, Shan-Shan; Geng, Zhu-Feng; Fan, Li; Du, Shu-Shan; Deng, Zhi-Wei; Wang, Yong-Yan

    2015-01-01

    In the course of our search for natural bioactive chemicals and investigations on their insecticidal activities from some medicinal plants growing in China, the essential oil derived from the twigs of Zanthoxylum armatum (Rutaceae) was found to possess strong insecticidal activities against two stored-product insects, Lasioderma serricorne and Tribolium castaneum. A total of 32 constituents of the essential oil were identified by GC and GC-MS analysis, and it revealed (E)-anethole (20.5%), 1,8-cineole (14.0%), 2-tridecanone (12.5%), limonene (9.0%) and piperitone (8.0%) as major components, followed by β-phellandrene (6.3%), β-pinene (5.1%) and 4-terpineol (4.4%). From the essential oil, five compounds were isolated and identified as (E)-anethole, 1,8-cineole, 2-tridecanone, limonene and piperitone. The results of insecticidal bioassays showed that the essential oil of Z. armatum exhibited strong fumigant toxicity towards L. serricorne and T. castaneum with LC50 values of 13.83 and 4.28 mg/L air, respectively, and also possessed contact toxicity against two insect species with LD50 values of 18.74 and 32.16 μg/adult, respectively. Among the active compounds, piperitone performed the strongest fumigant toxicity against L. serricorne (LC50 = 1.21 mg/L air) and contact toxicity against T. castaneum (LD50 = 3.16 μg/adult). 1,8-Cineole, limonene and piperitone showed similar fumigant toxicity against T. castaneum with LC50 values of 5.47, 6.21 and 7.12 mg/L air, respectively. Meanwhile, L. serricorne was the most sensitive to 2-tridecanone (LD50 = 5.74 μg/adult) in the progress of contact toxicity assay.

  4. Efficacy of insecticides in fruit borer control and residues on sugar apple fruit

    Directory of Open Access Journals (Sweden)

    Alessandro da Silva Oliveira

    Full Text Available ABSTRACT Bahia is the Brazilian state with the largest production of sugar apple fruits (Annona squamosa L., and fruit borer (Cerconota anonella, Sepp. 1830 is a key crop pest. Insecticides are the main strategy for pest control even though there are no pesticides registered for this crop. This study aimed to assess the efficacy of insecticides to control fruit borer and determine the levels of insecticide residues in sugar apple fruits aiming at requesting the extension of authorization to use insecticide products in this crop. The experiment was conducted in an eight-year-old irrigated orchard (2 × 4 m located in Anagé, Bahia, Brazil. The experimental design was a randomized block design with 10 treatments (three insecticides with three doses and a control with water and 5 replications. Each plot was composed of four plants but only the two central ones were assessed. Insecticides and doses (g a.i. 100 L−1 water were Bacillus thuringiensis: 0.8, 1.7, and 2.5; triflumuron: 2.4, 3.6, and 4.8; and imidacloprid: 4.0, 10.0, and 16.0. Nine sprayings were carried out at fortnightly intervals with a costal sprayer with constant pressure, JA-2 nozzle, and with jet directed to the fruits. Ten assessments were performed in order to observe fruit borer presence in 30 previously marked fruits per plot. Imidacloprid, at the highest studied dose, was the only effective treatment. Analyses of imidacloprid residues, at 21 and 30 days after the highest dose application, indicated levels higher than the maximum limit allowed. Insecticides under the conditions tested do not meet the norms for requesting the extension of authorization to use insecticides for citrus in sugar apple fruits.

  5. Design, Synthesis and Antifungal/Insecticidal Evaluation of Novel Cinnamide Derivatives

    Directory of Open Access Journals (Sweden)

    Yanjun Xu

    2011-10-01

    Full Text Available Twenty novel cinnamamide derivatives were designed and synthesized using as lead compound pyrimorph, whose morpholine moiety was replaced by β-phenylethylamine. All the compounds were characterized by their spectroscopic data. The fungicidal and insecticidal activities were also evaluated. The preliminary results showed that all the title compounds had certain fungicidal activities against seven plant pathogens at a concentration of 50 μg/mL, and compounds 11a and 11l showed inhibition ratios of up to 90% against R. solani. Most of the title compounds exhibited moderate nematicidal activities. In general, the morpholine ring may be replaced by other amines and a chlorine atom in the pyridine ring is helpful to fungicidal activity.

  6. Toxicity and residual control of Plutella xylostella L. (Lepidoptera: Plutellidae with Bacillus thuringiensis Berliner and insecticides Toxicidade e controle residual de Plutella xylostella L. (Lepidoptera: Plutellidae com Bacillus thuringiensis Berliner e inseticidas

    Directory of Open Access Journals (Sweden)

    Carla Pedroso de Moraes

    2012-08-01

    Full Text Available Plutella xylostella L. is the most important worldwide pest of cruciferous plants and indiscriminate use of insecticides has led to the resistance of the species to different groups. This research was conducted to compare the toxicity and persistence of two strains of Bacillus thuringiensis to P. xylostella larvae. Concentrations between 125 and 500g 100L-1 of water of the commercial products were evaluated and compared to the insect growth inhibitor diflubenzuron and to the neurotoxic pyrethroid deltamethrin. The efficacy of the insecticides was compared between treated plants kept indoor greenhouse and outdoor. Third instar larvae were more susceptible to B. thuringiensis than first instar ones. Agree and Dipel showed similar control rates of third instars until 10 days after treatment, but on the 15th day, Agree was significantly more efficient than Dipel. Both B. thuringiensis formulations showed a reduction in mortality after 10 days when the treated plants were exposed to natural weather conditions in comparison to the same treatments kept inside greenhouse. Dimilin (100g 100L-1 of water and deltamethrin (30ml of commercial product 100L-1 of water were not efficient to control third instar larvae of P. xylostella. This inefficiency cannot be attributed to a resistant population of P. xylostella since the larval population used in the experiments was not subjected to insecticide pressure, once the crop was organically cultivated all year round. The results showed that both formulations of B. thuringiensis are sound alternatives for the control of the diamondback moth in organically conducted cruciferous crops, considering the high residual control provided under subtropical weather conditions.Larvas de Plutella xylostella L. são as principais pragas de crucíferas cultivadas e o uso excessivo e indiscriminado de inseticidas tem levado a resistência da espécie para diferentes grupos de inseticidas. Este trabalho foi conduzido para

  7. Insecticidal Activity of Isolated Bacteria from Hyphantria cunea (Drury (Lepidoptera: Arctiidae

    Directory of Open Access Journals (Sweden)

    Nurcan Albayrak İskender

    2017-04-01

    Full Text Available The fall webworm (Hyphantria cunea is a polyphagous pest with numerous host plants. In the present study, the bacterial flora of H.cunea was investigated to identify new organisms that can be used as microbial control agent against the pest. Six bacteria were isolated and cultured from H. cunea. Some morphological, biochemical and other phenotypic characteristics (with API 20E, API 50 CH, API Staph and API Coryne kits of bacterial isolates were determined. In addition, 16S rRNA gene region was sequenced. As a result of the studies conducted, bacterial isolates were identified as Lysinibacillus sphaericus (Abk1, Bacillus amyloliquefaciens (Abk2, Staphylococcus sciuri (Abk4, Kocuria palustris (Abk6, Arthrobacter arilaitensis (Abk7 and Microbacterium oxydans (Abk8. All bacterial isolates were tested for 12 days against third-fourth instar larvae of H. cunea. The highest insecticidal activity was obtained from L. sphaericus (Abk1 with 30% after application (p<0.05. These results indicate that L. sphaericus (Abk1 can be taken into account in the microbial pest control of H. cunea. In the future, further studies will be conducted by using pathogenicity enrichment strategies of L. sphaericus (Abk1 (ex. combining with other entomopathogens or insecticides in order to increase the effectiveness on H. cunea.

  8. Proof of concept for a novel insecticide bioassay based on sugar feeding by adult Aedes aegypti (Stegomyia aegypti).

    Science.gov (United States)

    Stell, F M; Roe, R M; Arellano, C; Kennedy, L; Thornton, H; Saavedra-Rodriguez, K; Wesson, D M; Black, W C; Apperson, C S

    2013-09-01

    Aedes aegypti L. (Stegomyia aegypti) (Diptera: Culicidae) is the principal vector of dengue and yellow fever viruses in tropical and subtropical regions of the world. Disease management is largely based on mosquito control achieved by insecticides applied to interior resting surfaces and through space sprays. Population monitoring to detect insecticide resistance is a significant component of integrated disease management programmes. We developed a bioassay method for assessing insecticide susceptibility based on the feeding activity of mosquitoes on plant sugars. Our prototype sugar-insecticide feeding bioassay system was composed of inexpensive, disposable components, contained minimal volumes of insecticide, and was compact and highly transportable. Individual mosquitoes were assayed in a plastic cup that contained a sucrose-permethrin solution. Trypan blue dye was added to create a visual marker in the mosquito's abdomen for ingested sucrose-permethrin solution. Blue faecal spots provided further evidence of solution ingestion. With the sugar-insecticide feeding bioassay, the permethrin susceptibility of Ae. aegypti females from two field-collected strains was characterized by probit analysis of dosage-response data. The field strains were also tested by forced contact of females with permethrin residues on filter paper. Dosage-response patterns were similar, indicating that the sugar-insecticide feeding bioassay had appropriately characterized the permethrin susceptibility of the two strains. © 2012 The Royal Entomological Society.

  9. The use of insecticides to control insect pests

    OpenAIRE

    M Wojciechowska; P Stepnowski; M Gołębiowski

    2016-01-01

    Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...

  10. Efficacy of insecticide residues on adult Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) mortality and injury in apple and peach orchards.

    Science.gov (United States)

    Leskey, Tracy C; Short, Brent D; Lee, Doo-Hyung

    2014-07-01

    The primary threat from Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) originates from populations continuously dispersing from and among wild and cultivated hosts, so many individuals may not be directly sprayed with insecticides. Limited information exists regarding field-based residual activity of insecticides for management of H. halys in tree fruit. Thus, we conducted field-based bioassays in apple and peach orchards to evaluate residual activity of insecticides commonly applied against H. halys. Adults used in these trials were collected from wild and cultivated hosts less than one week prior to testing to more accurately reflect the susceptibility of wild H. halys populations in the field throughout the season. Significantly higher mortality rates of Halyomorpha halys were observed early in the growing season, when overwintered adults were prevalent, compared with populations present later in the growing season that included new generation adults. Significantly higher mortality was recorded for adults exposed to fresh insecticide applications compared with three- and seven-day old residues. Typically, the addition of an adjuvant did not enhance efficacy or residual activity of insecticides. Significantly fewer injury sites were recorded on apples treated with dinotefuran and fenpropathrin compared with the untreated apples for all residue ages. Overwintered Halyomorpha halys populations are easier to kill with insecticide applications than the first and second generation which are present in the field during the mid- to late-season. Residual activity of nearly all insecticides decreased significantly three days after application and adjuvants generally did not increase residual activity. These factors should be considered in developing season-long programs for management of this invasive species in tree fruit. © 2013 Society of Chemical Industry.

  11. Effects of Different Systemic Insecticides in Carotenoid Content, Antibacterial Activity and Morphological Characteristics of Tomato (Solanum lycopersicum var Diamante

    Directory of Open Access Journals (Sweden)

    LEXTER R. NATIVIDAD

    2014-02-01

    Full Text Available This study aimed to determine the effects of different systemic insecticides in tomato (Lycopersicon esculentum var. Diamante. The study also assessed different systemic insecticides used in other plants in their effectiveness and suitability to tomato by evaluating the carotenoid content and antibacterial activity of each insecticide. Morphological characteristics such as the weight, the number and the circumference of tomato fruits and the height of the plant were also observed. Moreover, the cost effectiveness was computed. Treatments were designated as follows: Treatment 1- plants sprayed with active ingredient (a.i. cartap hydrochloride; Treatment 2 - plants sprayed with a.i. indoxacarb; Treatment 3- plants sprayed with a.i. chlorantraniliprole and thiamethoxam; Treatment 4 - plants sprayed with a.i. dinotefuran (positive control; and Treatment 5 - no insecticide applied. The experimental design used was Randomized Complete Block Design (RCBD with three replications. The first three systemic insecticides with such active ingredient were not yet registered for tomato plant. Statistical analyses show that there were no significant differences among the weight, the number and the circumference of tomato fruits and the height of the plant for each treatment. Results showed that treatments 1, 2, 3, 4 and 5 extracts have 49.74, 44.16, 48.19, 52.57 and 50.60 μg/g of total carotenoids (TC, respectively. Statistical analysis shows that there no significant differences in the TC content of each treatment. The antibacterial activity of each plant sample showed no significant differences among treatments. Thin layer chromatographic analysis revealed that there were equal numbers of spots for all the plant samples.The study concluded that systemic insecticide with a.i. cartap hydrochloride be introduced to the farmers as insecticide for tomato plant since it shows comparable effect with the registered insecticide (T4 based on the morphological

  12. Synergistic Combinations of a Pyrethroid Insecticide and an Emulsifiable Oil Formulation of Beauveria bassiana to Overcome Insecticide Resistance in Listronotus maculicollis (Coleoptera: Curculionidae).

    Science.gov (United States)

    Wu, Shaohui; Kostromytska, Olga S; Koppenhöfer, Albrecht M

    2017-08-01

    The annual bluegrass weevil, Listronotus maculicollis (Kirby), is a major pest of golf course turf in eastern North America and has become particularly problematic owing to widespread development of insecticide resistance. As an alternative option to manage resistant adult L. maculicollis, we explored combinations of the pyrethroid insecticide bifenthrin with an emulsifiable oil formulation of the entomopathogenic fungus Beauveria bassiana strain GHA (Bb ES). Combinations synergistically enhanced mortality in both insecticide-susceptible and insecticide-resistant L. maculicollis adults in the laboratory when bifenthrin was used at LC50s for each population. To determine the component behind the synergism, technical spores of B. bassiana GHA and the emulsifiable oil carrier in the fungal formulation were tested separately or in combination with bifenthrin. In both separate and combined applications, the emulsifiable oil carrier was responsible for high mortality within 3 d after treatment and interacted synergistically with bifenthrin, whereas fungus-induced mortality started later. Strong synergism was also observed in three field experiments with a relatively resistant L. maculicollis population. Combinations of Bb ES and bifenthrin hold promise as an effective L. maculicollis management tool, particularly of pyrethroid-resistant populations. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Insecticide resistance status of three malaria vectors, Anopheles gambiae (s.l.), An. funestus and An. mascarensis, from the south, central and east coasts of Madagascar.

    Science.gov (United States)

    Rakotoson, Jean-Desire; Fornadel, Christen M; Belemvire, Allison; Norris, Laura C; George, Kristen; Caranci, Angela; Lucas, Bradford; Dengela, Dereje

    2017-08-23

    Insecticide-based vector control, which comprises use of insecticide-treated bed nets (ITNs) and indoor residual spraying (IRS), is the key method to malaria control in Madagascar. However, its effectiveness is threatened as vectors become resistant to insecticides. This study investigated the resistance status of malaria vectors in Madagascar to various insecticides recommended for use in ITNs and/or IRS. WHO tube and CDC bottle bioassays were performed on populations of Anopheles gambiae (s.l.), An. funestus and An. mascarensis. Adult female An. gambiae (s.l.) mosquitoes reared from field-collected larvae and pupae were tested for their resistance to DDT, permethrin, deltamethrin, alpha-cypermethrin, lambda-cyhalothrin, bendiocarb and pirimiphos-methyl. Resting An. funestus and An. mascarensis female mosquitoes collected from unsprayed surfaces were tested against permethrin, deltamethrin and pirimiphos-methyl. The effect on insecticide resistance of pre-exposure to the synergists piperonyl-butoxide (PBO) and S,S,S-tributyl phosphorotrithioate (DEF) also was assessed. Molecular analyses were done to identify species and determine the presence of knock-down resistance (kdr) and acetylcholinesterase resistance (ace-1 R ) gene mutations. Anopheles funestus and An. mascarensis were fully susceptible to permethrin, deltamethrin and pirimiphos-methyl. Anopheles gambiae (s.l.) was fully susceptible to bendiocarb and pirimiphos-methyl. Among the 17 An. gambiae (s.l.) populations tested for deltamethrin, no confirmed resistance was recorded, but suspected resistance was observed in two sites. Anopheles gambiae (s.l.) was resistant to permethrin in four out of 18 sites (mortality 68-89%) and to alpha-cypermethrin (89% mortality) and lambda-cyhalothrin (80% and 85%) in one of 17 sites, using one or both assay methods. Pre-exposure to PBO restored full susceptibility to all pyrethroids tested except in one site where only partial restoration to permethrin was observed. DEF

  14. The evolution of insecticide resistance in the peach potato aphid, Myzus persicae.

    Science.gov (United States)

    Bass, Chris; Puinean, Alin M; Zimmer, Christoph T; Denholm, Ian; Field, Linda M; Foster, Stephen P; Gutbrod, Oliver; Nauen, Ralf; Slater, Russell; Williamson, Martin S

    2014-08-01

    The peach potato aphid, Myzus persicae is a globally distributed crop pest with a host range of over 400 species including many economically important crop plants. The intensive use of insecticides to control this species over many years has led to populations that are now resistant to several classes of insecticide. Work spanning over 40 years has shown that M. persicae has a remarkable ability to evolve mechanisms that avoid or overcome the toxic effect of insecticides with at least seven independent mechanisms of resistance described in this species to date. The array of novel resistance mechanisms, including several 'first examples', that have evolved in this species represents an important case study for the evolution of insecticide resistance and also rapid adaptive change in insects more generally. In this review we summarise the biochemical and molecular mechanisms underlying resistance in M. persicae and the insights study of this topic has provided on how resistance evolves, the selectivity of insecticides, and the link between resistance and host plant adaptation. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. Populations of predators and parasitoids of Bemisia tabaci (Hemiptera: Aleyrodidae) after the application of eight biorational insecticides in vegetable crops.

    Science.gov (United States)

    Simmons, Alvin M; Shaaban, Abd-Rabou

    2011-08-01

    The sweetpotato whitefly, Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae), is an important pest of vegetables and many other crops worldwide. Eight biorational insecticides (based on oil, plant derivatives, insect growth regulator and fungus) were evaluated in the field for their influence on populations of six natural enemies of B. tabaci. Natural populations of two predators [Chrysoperla carnea Stephen (Neuroptera: Chrysopidae) and Orius spp. (Hemiptera: Anthocoridae)] and two genera of parasitoids [Encarsia spp. and Eretmocerus spp. (Hymenoptera: Aphelinidae)] were evaluated in eggplant (Solanum melongena L.). Also, augmented field populations of three predators [C. carnea, Coccinella undecimpunctata L. (Coleoptera: Coccinellidae) and Macrolophus caliginosus (Wagner) (Hemiptera: Miridae)] were evaluated in cabbage (Brassica oleracea var. capitata L.), cucumber (Cucumis sativus L.) and squash (Cucurbita pepo L.). Regardless of natural enemy or crop, jojoba oil, Biovar and Neemix had the least effect on abundance of the natural enemies in comparison with the other insecticides during a 14 day evaluation period. Conversely, Admiral, KZ oil, Mesrona oil, Mesrona oil + sulfur and natural oil had a high detrimental effect on abundance of the natural enemies. These results demonstrate the differential effects of biorational insecticides for whitefly control on predators and parasitoids in the field. This article is a US Government work and is in the public domain in the USA. Published 2011 by John Wiley & Sons, Ltd.

  16. Toxicity of Pandanus amaryllifolius L. chloroform extract against diamondback moth, Plutella xylostella (Lepidoptera: Plutellidae)

    Science.gov (United States)

    Imtithal I., J.; Mustapha, Wan Aida Wan; Idris A., B.

    2018-04-01

    The potential of using plant and plant-derived products as deterrent against pest of crops in the field and during postharvest period, is gaining increasing attention, due to rapid development of resistance to the synthetic insecticides and couple with the fact that natural insecticides constitute a rich source of bioactive compounds that are safe and biodegradable into non-toxic products. The aim of the present study was to evaluate the insecticidal effects of chloroform extract of Pandanus amaryllifolius L. leaves against diamondback moth, Plutella xylostella under laboratory conditions. The medicinal plants were collected around Kampong Sungai Siput, Lubok China, Malacca, Malaysia. The leaf disc immersion method was used to assess the insecticidal effects of Pandanus amaryllifolius L. leaves extract on the larvae as well as duration of the larval phase following feeding of the second instar larvae of diamondback on the treated leaf discs for 24 h at various concentrations (0.5, 1, 2, 4 and 8 mg/ml). Larval mortality was evaluated every 24 hours for a period of three days. Highest larval percent was observed at 72hrs post exposure with 86.67 % mortality at 8mg/ml concentration LC50 and LC90 value was calculated against different concentrations. It was recorded that lowest LC50 and LC90 values were observed after 72 h of exposure followed by 48 h at 2.84 mg/ml and 17.59 mg/ml respectively and 3.36 mg/ml and 28.59 mg/ml respectively at 48 h of exposure time. Both larvae mortality and duration of exposure were found to be directly related to the concentration of Pandan amaryllifolius L. leaves extract and inversely related to fecundity. The present study indicates that phytochemicals derived from Pandanus amaryllifolius L. leaf extracts are effective DBM control agent and the plant extracts may be useful for further IPM program.

  17. Time of planting and choice of maize hybrids in controlling WCR (Diabrotica virgifera virgifera Le Conte) in Serbia and Montenegro.

    Science.gov (United States)

    Baca, F; Videnovic, Z; Erski, P; Stankovic, R; Dobrikovic, Danica

    2003-01-01

    Effects of the length of growing season of maize hybrids (FAO maturity groups 400, 500, 600 and 700) and planting dates on the maize crop, as an attractive supplemental feeding for western corn rootworm (WCR) beetles and larval survival, were observed in two locations of South Banat, during a three-year (1997-1999) and a two-year period (2001 and 2002). The feeding attraction of the maize crop for WCR beetles and survival of larvae were evaluated in dependency of the variable "plant lodging". The following results were obtained: First location: A. Plant lodging over time of planting and applied insecticides. 1. Early planting: 44.2%, 77.6%, and 76.7% for FAO 400, 500 and 600, respectively. 2. Late planting: 4.7%, 14.9%, and 7.9% for FAO 400, 500 and 600, respectively. B. Plant lodging over time of planting and cropping practices: 1. Early planting without insecticide application 72.2%, and with insecticide application 7.3%. The efficacy of application of insecticide carbofurane (Furadan 350 FS, dosage 4.0 liter/ha) in larval control was 89.9%. 2. Late planting without insecticide application, plant lodging was 47.7%, and with insecticide application 8.1%. The efficacy of application of insecticide carbofurane (Furadan 350 FS, dosage 4.0 l/ha-1) in larval control was 83.0%. Early planting resulted in greater survival of larvae; hence plant lodging was 10 times greater in early than in late planting. The percentage of lodged plants indicates that the maize crop in late planting was more attractive to imagoes. Therefore, more lodged plants were observed in the treatment where late planting preceded. Second location: Plant lodging as dependent on "treatments" 1. Regular plantings: 90.7% in untreated control and 76.2% in insecticide treated variant. The efficacy of insecticide application in control of high larval population was 16.0%. 2. Replanting date: 12.2% in untreated and 4.4% in treated variant. The efficacy of insecticide in control of low larval population

  18. Lethal and Sub-lethal Effects of Four Insecticides on the Aphidophagous Coccinellid Adalia bipunctata (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Depalo, Laura; Lanzoni, Alberto; Masetti, Antonio; Pasqualini, Edison; Burgio, Giovanni

    2017-12-05

    Conventional insecticide assays, which measure the effects of insecticide exposure on short-term mortality, overlook important traits, including persistence of toxicity or sub-lethal effects. Therefore, such approaches are especially inadequate for prediction of the overall impact of insecticides on beneficial arthropods. In this study, the side effects of four modern insecticides (chlorantraniliprole, emamectin benzoate, spinosad, and spirotetramat) on Adalia bipunctata (L.) (Coleoptera: Coccinellidae) were evaluated under laboratory conditions by exposition on treated potted plants. In addition to investigation of acute toxicity and persistence of harmful activity in both larvae and adults of A. bipunctata, demographic parameters were evaluated, to provide a comprehensive picture of the nontarget effects of these products. Field doses of the four insecticides caused detrimental effects to A. bipunctata; but in different ways. Overall, spinosad showed the best toxicological profile among the products tested. Emamectin benzoate could be considered a low-risk insecticide, but had high persistence. Chlorantraniliprole exhibited lethal effects on early instar larvae and adults, along with a long-lasting activity, instead spirotetramat showed a low impact on larval and adult mortality and can be considered a short-lived insecticide. However, demographic analysis demonstrated that chlorantraniliprole and spirotetramat caused sub-lethal effects. Our findings highlight that sole assessment of mortality can lead to underestimation of the full impact of pesticides on nontarget insects. Demographic analysis was demonstrated to be a sensitive method for detection of the sub-lethal effects of insecticides on A. bipunctata, and this approach should be considered for evaluation of insecticide selectivity. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  19. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  20. Studies onthe behaviour of the insecticide 14C-Pirimiphos-Methyl in aquatic species: tilapia nilotica and potamogeton crispus plant

    International Nuclear Information System (INIS)

    Afifi, L.M.; Kamel, H.A.; Aly, M.A.S.

    2003-01-01

    The bioaccumulation and depletion of 1 4C-labelled pirimiphos-methyl (O-2- diethyl amino-6-methyl pyrimidine-4-gamma l O,O-dimethyl phosphorothioa) were monitored for 6 days following a single application at 7.5 ppm to 2 aquatic species: Bolti fish (Tilapia nilotica) and a rapid growing plant (Potamogeton crispus). The bioconcentration factor (BCF) for fish was relatively low with a maximum reached at 24 hours 122 and 55 in the absence and presence of the weed respectively. Depuration of the insecticide and/or its metabolites in clear water was readily fast. Feeding the treated dried fish to rat, the substance residues were found to be bioavailable where, 75.7% of the given amount was excreted in the urine and 15.3% in the feces. TLC analysis of the urine revealed the presence of 4 metabolites: Desethyl pirimiphos-methyl, 2-diethyl amino-4-hydroxy-6-methylpyrimidine, 2-ethyl amino-4-hydroxy-6-methyl-pyrimidine and 2-amino -4-hydroxy-6- methyl- pyrimidine

  1. Application of nanotechnology for the encapsulation of botanical insecticides for sustainable agriculture: prospects and promises.

    Science.gov (United States)

    de Oliveira, Jhones Luiz; Campos, Estefânia Vangelie Ramos; Bakshi, Mansi; Abhilash, P C; Fraceto, Leonardo Fernandes

    2014-12-01

    This review article discusses the use of nanotechnology in combination with botanical insecticides in order to develop systems for pest control in agriculture. The main types of botanical insecticides are described, together with different carrier systems and their potential uses. The botanical insecticides include those based on active principles isolated from plant extracts, as well as essential oils derived from certain plants. The advantages offered by the systems are highlighted, together with the main technological challenges that must be resolved prior to future implementation of the systems for agricultural pest control. The use of botanical insecticides associated with nanotechnology offers considerable potential for increasing agricultural productivity, while at the same time reducing impacts on the environment and human health.

  2. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  3. Insecticidal effects of Ocimum sanctum var. cubensis essential oil on the diseases vector Chrysomya putoria

    Directory of Open Access Journals (Sweden)

    Idelsy Chil-Núñez

    2018-05-01

    Full Text Available Context: The blowfly Chrysomya putoria is widely distributed throughout the Neotropical region and, besides transmitting pathogens; they could cause secondary myiasis. Botanical insecticides provide an alternative to synthetic pesticides because the excessive use of synthetic insecticides resulted in a progressive resistance of the pests to these chemicals, diminishing their effectiveness and generating consequences with negative environmental impact. The essential oil extracted from Ocimum sanctum (basil has showed insecticidal activity against some insects but has no reported studies on the activity of this plant against flies. Aims: To evaluate the insecticidal effects of Ocimum sanctum var. cubensis Gomes essential oil on the post embryonic development of Chrysomya putoria. Methods: The colonies of Chrysomya putoria were established and maintained at the Laboratório de Entomologia Médica e Forense (FIOCRUZ, Rio de Janeiro, Brazil. The basil essential oil was tested in six concentrations (4.13, 8.25, 20.63, 41.25, 61.87 and 80,25 mg/mL. Mortality and changes in life cycle were recorded daily. Results: β-caryophyllene, β-selinene and eugenol, were the main constituents of the basil essential oil. The experiments demonstrated that in all concentrations tested, this essential oil shortening the duration of all post embryonic stages having a direct impact in the viability of this fly estimating the LC50 in 7.47 mg/mL of concentration. In addition, the essential oil caused morphological alterations in abdomen, wings and ptilinum at lower concentrations. Conclusions: This essential oil emerge as a good option for the control of the disease vector blowfly Chrysomya putoria.

  4. Dissipation of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb?insecticides used to control codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae) in apples for production of baby food

    OpenAIRE

    Szpyrka, Ewa; Matyaszek, Aneta; S?owik-Borowiec, Magdalena

    2017-01-01

    Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and n...

  5. Physiological selectivity and activity reduction of insecticides by rainfall to predatory wasps of Tuta absoluta.

    Science.gov (United States)

    Barros, Emerson C; Bacci, Leandro; Picanco, Marcelo C; Martins, Júlio C; Rosado, Jander F; Silva, Gerson A

    2015-01-01

    In this study, we carried out three bioassays with nine used insecticides in tomato crops to identify their efficiency against tomato leaf miner Tuta absoluta, the physiological selectivity and the activity reduction of insecticides by three rain regimes to predatory wasps Protonectarina sylveirae and Polybia scutellaris. We assessed the mortality caused by the recommended doses of abamectin, beta-cyfluthrin, cartap, chlorfenapyr, etofenprox, methamidophos, permethrin, phenthoate and spinosad to T. absoluta and wasps at the moment of application. In addition, we evaluated the wasp mortality due to the insecticides for 30 days on plants that did not receive rain and on plants that received 4 or 125 mm of rain. Spinosad, cartap, chlorfenapyr, phenthoate, abamectin and methamidophos caused mortality higher than 90% to T. absoluta, whereas the pyrethroids beta-cyfluthrin, etofenprox and permethrin caused mortality between 8.5% and 46.25%. At the moment of application, all the insecticides were highly toxic to the wasps, causing mortality higher than 80%. In the absence of rain, all the insecticides continued to cause high mortality to the wasps for 30 days after the application. The toxicity of spinosad and methamidophos on both wasp species; beta-cyfluthrin on P. sylveirae and chlorfenapyr and abamectin on P. scutellaris, decreased when the plants received 4 mm of rain. In contrast, the other insecticides only showed reduced toxicity on the wasps when the plants received 125 mm of rain.

  6. The potentiality of botanicals and their products as an alternative to chemical insecticides to sandflies (Diptera: Psychodidae): a review.

    Science.gov (United States)

    Dinesh, Diwakar Singh; Kumari, Seema; Kumar, Vijay; Das, Pradeep

    2014-03-01

    Use of chemical pesticides is the current method for controlling sandflies. However, resistance is being developed in sandflies against the insecticide of choice that is DDT (dichlorodiphenyl trichloroethane). Botanicals have potential to act as an alternative to chemical insecticides as the crude extracts and active molecules of some plants show insecticidal effect to sandflies. This will lead to safe, easy and environment friendly method for control of sandflies. Therefore, information regarding botanicals acting as alternative to chemical insecticide against sandflies assumes importance in the context of development of resistance to insecticides as well as to prevent environment from contamination. This review deals with some plants and their products having repellent and insecticidal effect to sandflies in India and abroad. Different methods of extraction and their bioassay on sandflies have been emphasized in the text. Various extracts of some plants like Ricinus communis (Euphorbiaceae), Solanum jasminoides (Solanaceae), Bougainvillea glabra (Nyctaginaceae), Capparis spinosa (Capparidaceae), Acalypha fruticosa (Euphorbiaceae) and Tagetes minuta (Asteraceae) had shown repellent/insecticidal effect on sandflies. This review will be useful in conducting the research work to find out botanicals of Indian context having insecticidal effect on sandflies.

  7. Degradation of Insecticides in Poultry Manure: Determining the Insecticidal Treatment Interval for Managing House Fly (Diptera: Muscidae) Populations in Poultry Farms.

    Science.gov (United States)

    Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan

    2016-04-01

    It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.

  8. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  9. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.

  10. Insecticidal and Repellant Activities of Four indigenous medicinal Plants Against Stored Grain Pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of four indigenous plants for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Methods: Four widely distributed plants (Artemisia vulgaris, Sphaeranthus indicus, Tephrosia purpurea, and Prosopis juliflora were sequentially extracted with increasing polarity of organic solvents such as, hexane, chloroform and ethyl acetate were evaluated for their insecticidal and repellent activities against Tribolium castaneum by adapting the standard protocol in in vitro. Results: Data pertaining to the present investigation clearly revealed that the percentage of mortality was maximum in(72 hr 58% hexane extract of A. vulgaris, chloroform extract (72 hr 34% of S. indicus, and ethyl acetate extract (72 hr 52% of T. purpurea. Repellant activities of plant extracts were tested against T. castaneum, repellent activity was maximum in hexane extract of P. fuliflora, ( EPI value for P. fuliflora in 2.5% was – 0.11 and – 0.33 at 1hr and 6 hr respectively chloroform extract of T. purpurea (2.5% was -0.17 at 6 hr and ethyl acetate extract of S. indicus (2.5% was -0.65 at 6 hr against T. castaneum. Conclusions: The present work for botanical products to control the insect pest of stored grain Tribolium castaneum (Herbst.These results suggest the presence of actives toxic substances acting after consumption or topical application.

  11. Evolution of resistance to pyrethroid insecticides in Musca domestica.

    Science.gov (United States)

    Scott, Jeffrey G

    2017-04-01

    Houseflies, Musca domestica L., are a significant pest because of the numerous diseases they transmit. Control of housefly populations, particularly at animal production facilities, is frequently done using pyrethroid insecticides which kill insects by prolonging the open time of the voltage-sensitive sodium channel (VSSC). Houseflies have evolved resistance to pyrethroids owing to mutations in Vssc and by cytochrome-P450-mediated detoxification. Three Vssc mutations are known: kdr (L1014F), kdr-his (L1014H) and super-kdr (M918T + L1014F). Generally, the levels of resistance conferred by these mutations are kdr-his resistance than kdr. P450-mediated resistance can result from overexpression of CYP6D1 or another P450 (unidentified) whose overexpression is linked to autosomes II or V. The initial use of field-stable pyrethroids resulted in different patterns of evolution across the globe, but with time these mutations have become more widespread in their distribution. What is known about the fitness costs of the resistance alleles in the absence of insecticide is discussed, particularly with respect to the current and future utility of pyrethroid insecticides. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  12. Identification and Characterization of CYP9A40 from the Tobacco Cutworm Moth (Spodoptera litura), a Cytochrome P450 Gene Induced by Plant Allelochemicals and Insecticides

    Science.gov (United States)

    Wang, Rui-Long; Staehelin, Christian; Xia, Qing-Qing; Su, Yi-Juan; Zeng, Ren-Sen

    2015-01-01

    Cytochrome P450 monooxygenases (P450s) of insects play crucial roles in the metabolism of endogenous and dietary compounds. Tobacco cutworm moth (Spodoptera litura), an important agricultural pest, causes severe yield losses in many crops. In this study, we identified CYP9A40, a novel P450 gene of S. litura, and investigated its expression profile and potential role in detoxification of plant allelochemicals and insecticides. The cDNA contains an open reading frame encoding 529 amino acid residues. CYP9A40 transcripts were found to be accumulated during various development stages of S. litura and were highest in fifth and sixth instar larvae. CYP9A40 was mainly expressed in the midgut and fat body. Larval consumption of xenobiotics, namely plant allelochemicals (quercetin and cinnamic acid) and insecticides (deltamethrin and methoxyfenozide) induced accumulation of CYP9A40 transcripts in the midgut and fat body. Injection of dsCYP9A40 (silencing of CYP9A40 by RNA interference) significantly increased the susceptibility of S. litura larvae to the tested plant allelochemicals and insecticides. These results indicate that CYP9A40 expression in S. litura is related to consumption of xenobiotics and suggest that CYP9A40 is involved in detoxification of these compounds. PMID:26393579

  13. The antioxidative response system in Glycine max (L.) Merr. exposed to Deltamethrin, a synthetic pyrethroid insecticide

    International Nuclear Information System (INIS)

    Bashir, Fozia; Mahmooduzzafar; Siddiqi, T.O.; Iqbal, Muhammad

    2007-01-01

    Forty-five-day-old plants of Glycine max (soybean) were exposed to several Deltamethrin (synthetic pyrethroid insecticide) concentrations (0.00 %, 0.05 %, 0.10 %, 0.15 % and 0.20 %) through foliar spray in the field conditions. In the treated plants, as observed at the pre-flowering (10 DAT), flowering (45 DAT) and post-flowering (70 DAT) stages, lipid peroxidation, proline content and total glutathione content increased, whereas the total ascorbate content decreased, as compared with the control. Among the enzymatic antioxidants, activity of superoxide dismutase, ascorbate peroxidase and glutathione reductase increased significantly whereas that of catalase declined markedly in relation to increasing concentration of Deltamethrin applied. The changes observed were dose-dependent, showing a strong correlation with the degree of treatment. - The Deltamethrin-induced oxidative stress alters the ascorbate-glutathione cycle in Glycine max

  14. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  15. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    OpenAIRE

    D.C. Pathak

    2011-01-01

    Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei) in Chakrashila Wildlife Sanctuary (CWS) in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pu...

  16. SELETIVIDADE DE INSETICIDAS AO COMPLEXO DE INIMIGOS NATURAIS NA CULTURA DO ALGODÃO (Gossypium hirsutum L. SELECTIVITY OF INSECTICIDES ON THE COMPLEX OF NATURAL ENEMIES IN COTTON CROP (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Fábio Shigeo Takatsuka

    2007-09-01

    ="justify">The selectivity of insecticides was evaluated in the complex of natural enemies of the cotton (Gossypium hirsutum L. crop. The cultivar Deltapine was used in a randomized block experimental design, with seven treatments and four replications. The treatments, all in their commercial formulation, were: control; thiamethoxam (300 g.ha-1; lufenuron (300 mL.ha-1; betacyflutrin (800 mL.ha-1; imidacloprid (70g.ha-1; diflubenzuron (6,0 g.ha-1; and endosulfan (1500 mL.ha-1. The insecticides were sprayed at 45 days after germination. Besides the initial evaluation, other evaluations were performed three and seven days after insecticide application. Each plot was sampled by the fabric beating method, with two random beatings per plot. Natural enemies were identified and counted. Three days after application, the insecticides thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1, and diflubenzuron (60 g.ha-1 did not showed negative effect on the complex of predators present in the cotton. However, seven days after application, only the lufenuron treatment maintained the selective effect over predator complex.

    KEY-WORDS: Insecticide; biological control; Gossypium.

  17. Effects of organic-farming-compatible insecticides on four aphid natural enemy species.

    Science.gov (United States)

    Jansen, Jean P; Defrance, Thibaut; Warnier, Anne M

    2010-06-01

    The toxicities of pyrethrins + rapeseed oil, pyrethrins + piperonyl butoxide (PBO), potassium salts of fatty acids and linseed oil were assessed in the laboratory on the parasitic wasp Aphidius rhopalosiphi (Destefani-Perez), the ladybird Adalia bipunctata (L.), the rove beetle Aleochara bilineata (Gyll.) and the carabid beetle Bembidion lampros (Herbst.). The methods selected were residual contact toxicity tests on inert and natural substrates. Both the pyrethrin products led to 100% mortality in the adult parasitic wasps and ladybird larvae on glass plates and plants. The pyrethrins + PBO formulation was toxic for B. lampros on sand and natural soil, but the pyrethrins + rapeseed oil formulation was harmless for this species. Insecticidal soaps were harmless for all these beneficial species. None of the tested products significantly affected the parasitism of the onion fly pupae by A. bilineata. The results indicated the potentially high toxicity of natural pyrethrins for beneficial arthropods. Although this toxicity needs to be confirmed in field conditions, the toxicity levels obtained in the laboratory were similar to or higher than those of several synthetic insecticides known to be toxic in the field. Insecticidal soaps could be considered as an alternative for aphid control in organic farming in terms of selectivity.

  18. Status of insecticide resistance in high-risk malaria provinces in Afghanistan.

    Science.gov (United States)

    Ahmad, Mushtaq; Buhler, Cyril; Pignatelli, Patricia; Ranson, Hilary; Nahzat, Sami Mohammad; Naseem, Mohammad; Sabawoon, Muhammad Farooq; Siddiqi, Abdul Majeed; Vink, Martijn

    2016-02-18

    Insecticide resistance seriously threatens the efficacy of vector control interventions in malaria endemic countries. In Afghanistan, the status of insecticide resistance is largely unknown while distribution of long-lasting insecticidal nets has intensified in recent years. The main objective of this study was thus to measure the level of resistance to four classes of insecticides in provinces with medium to high risk of malaria transmission. Adult female mosquitoes were reared from larvae successively collected in the provinces of Nangarhar, Kunar, Badakhshan, Ghazni and Laghman from August to October 2014. WHO insecticide susceptibility tests were performed with DDT (4 %), malathion (5 %), bendiocarb (0.1 %), permethrin (0.75 %) and deltamethrin (0.05 %). In addition, the presence of kdr mutations was investigated in deltamethrin resistant and susceptible Anopheles stephensi mosquitoes collected in the eastern provinces of Nangarhar and Kunar. Analyses of mortality rates revealed emerging resistance against all four classes of insecticides in the provinces located east and south of the Hindu Kush mountain range. Resistance is observed in both An. stephensi and Anopheles culicifacies, the two dominant malaria vectors in these provinces. Anopheles superpictus in the northern province of Badakhshan shows a different pattern of susceptibility with suspected resistance observed only for deltamethrin and bendiocarb. Genotype analysis of knock down resistance (kdr) mutations at the voltage-gated channel gene from An. stephensi mosquitoes shows the presence of the known resistant alleles L1014S and L1014F. However, a significant fraction of deltamethrin-resistant mosquitoes were homozygous for the 1014L wild type allele indicating that other mechanisms must be considered to account for the observed pyrethroid resistance. This study confirms the importance of monitoring insecticide resistance for the development of an integrated vector management in Afghanistan. The

  19. [Discriminating concentrations for three insecticides used in public health in a Lutzomyia longipalpis experimental strain from Colombia].

    Science.gov (United States)

    Marceló, Catalina; Cabrera, Olga Lucía; Santamaría, Erika

    2014-01-01

    In Colombia, periurban populations of Lutzomyia longipalpis , vector of the causative agent of visceral leishmaniasis in the upper and middle valley of the Magdalena River, may be exposed to insecticide applications with different purposes. Thus, it is important to begin a susceptibility surveillance of this species to insecticides. To determine indicators of susceptibility to three insecticides habitually used in public health, such as malathion, deltamethrin and lambda-cyhalothrin in an experimental strain of L. longipalpis . We used the method proposed by the Centers for Disease Control and Prevention. Groups of 10 to 15 unfed females were exposed to different concentrations of the insecticides using 250 ml glass bottles as test chambers. Mortality was registered every five minutes for an hour. Diagnostic concentrations and lethal times for each insecticide were calculated. In the evaluated L. longipalpis strain, the diagnostic concentrations and times were 75 µg/ml and 25 minutes for malathion, 10 µg/ml and 35 minutes for deltamethrin, and 15 µg/ml during 30 minutes for lambda-cyhalothrin. Baseline data over mortality response to three insecticides were established in a susceptibility strain of L. longipalpis vector. These indicators will allow establishing comparisons with populations of L. longipalpis exposed regularly or sporadically to chemical control measures to detect changes in their resistance to these insecticides.

  20. Effects of Different Systemic Insecticides in Carotenoid Content, Antibacterial Activity and Morphological Characteristics of Tomato (Solanum lycopersicum var Diamante)

    OpenAIRE

    LEXTER R. NATIVIDAD; Maria Fatima T. Astrero; Lenard T. Basinga; Maria Karysa G. Calang

    2014-01-01

    This study aimed to determine the effects of different systemic insecticides in tomato (Lycopersicon esculentum var. Diamante). The study also assessed different systemic insecticides used in other plants in their effectiveness and suitability to tomato by evaluating the carotenoid content and antibacterial activity of each insecticide. Morphological characteristics such as the weight, the number and the circumference of tomato fruits and the height of the plant were also observed. Moreover, ...

  1. Larvicidal properties of three plants on Anopheles gambiae ...

    African Journals Online (AJOL)

    No larvae exposed to Q. africana developed into pupae while development was also curtailed when exposed to K. senegalensis and L. multiflora extracts. Larvicidal activity was concentration dependent. These plants could be sources of botanical insecticides for malarial control. Journal of Pharmacy and Bioresources, Vol.

  2. Is there a relationship between insect metabolic rate and mortality of mealworms Tenebrio molitor L. after insecticide exposure?

    OpenAIRE

    MALISZEWSKA, Justyna; TĘGOWSKA, Eugenia

    2016-01-01

    Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxic...

  3. Phytotoxicity of the combination of some insecticides and fungicides on the ornamental species Petunia sp.

    Directory of Open Access Journals (Sweden)

    Renata Bažok

    2016-12-01

    Full Text Available In the production of ornamental plants, it is often necessary to combine plant protection products (PPPs for simultaneous pest control. The use of a combination of PPPs often leads to phytotoxicity. The aim of this study was to determine the phytotoxicity of the combination of fungicides (azoxystrobin and cyprodinil + fludioxonil and insecticides based on abamectin and thiomethoxam on the ornamental plant Petunia sp. The PPPs are used at recommended and double doses. Based on the damage, phytotoxicity indices were calculated. Petunia plants are sensitive even when PPPs are used in recommended doses. Combinations of the both insecticides with the combined fungicide based on cyprodinil and fludioxinil can be advised to protect petunias only if one applies the recommended doses. All combinations of insecticides with a fungicide based on azoxystrobin should not be applied because there is a serious risk of phytotoxicity.

  4. Insecticidal Activities of Tunisian Halophytic Plant Extracts against Larvae and Adults of Tribolium confusum

    Directory of Open Access Journals (Sweden)

    Mighri, Z.

    2007-01-01

    Full Text Available Salt marsh plants were tested for their insecticidal activities against adults and larvae of Tribolium confusum. Sixteen aerial part extracts of Frankenia laevis, Statice echioides, Suaeda fructicosa and Tamarix boveana were obtained using organic solvents of increasing polarity and tested for their insect growth, antifeedant and toxicity effects. Responses varied with plant material, extract type, insect stage and exposition time. Larval growth inhibition was significantly induced by chloroformic, ethyl acetate extracts of F. laevis, S. echioides and T. boveana, and petroleum ether extract of F. laevis. On the other hand, all extracts of S. fructicosa and the methanolic ones of the four plants tested didn't show any significant activity. In addition, ethyl acetate extracts of F. laevis, S. echioides and T. boveana and petroleum ether extract of F. laevis presented antifeedant property. S. fructicosa seemed to be, however, slightly attractive to the flour beetle. For all extracts, mortality was higher for larvae than adults. By using ethyl acetate extracts of F. laevis, S. echioides and T. boveana, and petroleum ether extract of F. laevis, mortality reached respectively 97, 87, 97 and 80%, when applied at a dose of 1%, mixed with the insect diet.

  5. Proteomic and properties analysis of botanical insecticide rhodojaponin III-induced response of the diamondback moth, Plutella xyllostella (L..

    Directory of Open Access Journals (Sweden)

    Xiaolin Dong

    Full Text Available BACKGROUND: Rhodojaponin III, as a botanical insecticide, affects a wide variety of biological processes in insects, including reduction of feeding, suspension of development, and oviposition deterring of adults in a dose-dependent manner. However, the mode of these actions remains obscure. PRINCIPAL FINDINGS: In this study, a comparative proteomic approach was adopted to examine the effect of rhodojaponin III on the Plutella xyllostella (L.. Following treating 48 hours, newly emergence moths were collected and protein samples were prepared. The proteins were separated by 2-DE, and total 31 proteins were significantly affected by rhodojaponin III compared to the control identified by MALDI-TOF/TOF-MS/MS. These differentially expressed proteins act in the nervous transduction, odorant degradation and metabolic change pathways. Further, gene expression patterns in treated and untreated moths were confirmed by qRT-PCR and western blot analysis. RNAi of the chemosensory protein (PxCSP gene resulted in oviposition significantly increased on cabbage plants treated with rhodojaponin III. CONCLUSIONS: These rhodojaponin III-induced proteins and gene properties analysis would be essential for a better understanding of the potential molecular mechanism of the response to rhodojaponin III from moths of P. xylostella.

  6. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  7. Daya Insektisida Alami Kombinasi Perasan Umbi Gadung (Dioscorea Hispida Dennst ) Dan Ekstrak Tembakau ( Nicotiana Tabacum L) (the Natural Insecticide Capacity of Squeeze Combination of Cassava (Dioscoreahispida Dennst) and Tobacco's Extract (Nicotiana T)

    OpenAIRE

    Hasanah, Misroul; Tangkas, I Made; Sakung, Jamaluddin

    2012-01-01

    The research regarding the natural insecticide capacity of squeeze combination of cassava (dioscoreahispida Dennst) and tobacco's extract has been done. The purposes are to measure the capacity of squeeze combination of cassava and tobacco's extract as a natural insecticide and to determine the most effective combination as natural insecticide. The method was the laboratory experiments by using squeeze cassava and tobacco's extract with the comparison ratio (in mL) as follow; 0:100, 25:75, 50...

  8. Metabolic control of the insecticides safety use

    Directory of Open Access Journals (Sweden)

    L.I. Solomenko

    2016-06-01

    Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.

  9. Removal of chlorpyrifos insecticide in constructed wetlands with different plant species

    Directory of Open Access Journals (Sweden)

    Tamara D. de Souza

    Full Text Available ABSTRACT The objective of this study was to evaluate the remediation of water containing the insecticide chlorpyrifos by using constructed wetlands (CW cultivated with Polygonum punctatum, Cynodon spp. and Mentha aquatica, operated under different hydraulic retention times: 24, 48, 96, 144 and 192 h. The system efficiency was based on reduction of the initial concentration of chlorpyrifos and toxicity of the contaminated water. The results showed that constructed wetlands are an excellent alternative for remediation of the insecticide chlorpyrifos in aqueous medium. It was observed that the average overall removal efficiency of the insecticide was 98.6%, and in the first hydraulic retention time, 24 h, chlorpyrifos was removed to levels below the detection limit in all CW. This result is mainly attributed to adsorption and microbial degradation. For the qualitative standard acute toxicity tests with Daphnia similis, for most samples there was a reduction in toxicity greater than 80%. It was reported that the ecotoxicological tests with the effluents of the constructed wetland are a good option as an indicator of the effectiveness of treatments and a promising alternative to complement the physical and chemical analyses.

  10. Degradation of Organophosphorus and Pyrethroid Insecticides in Beverages: Implications for Risk Assessment

    Directory of Open Access Journals (Sweden)

    Samantha A. Radford

    2018-02-01

    Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.

  11. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  12. Chemical Constituents and Insecticidal Activities of Ajania fruticulosa Essential Oil.

    Science.gov (United States)

    Liang, Jun-Yu; Guo, Shan-Shan; You, Chun-Xue; Zhang, Wen-Juan; Wang, Cheng-Fang; Geng, Zhu-Feng; Deng, Zhi-Wei; Du, Shu-Shan; Zhang, Ji

    2016-08-01

    The insecticidal activity and chemical constituents of the essential oil from Ajania fruticulosa were investigated. Twelve constituents representing 91.0% of the essential oil were identified, and the main constituents were 1,8-cineole (41.40%), (+)-camphor (32.10%), and myrtenol (8.15%). The essential oil exhibited contact toxicity against Tribolium castaneum and Liposcelis bostrychophila adults with LD50 values of 105.67 μg/adult and 89.85 μg/cm(2) , respectively. The essential oil also showed fumigant toxicity against two species of insect with LC50 values of 11.52 and 0.65 mg/l, respectively. 1,8-Cineole exhibited excellent fumigant toxicity (LC50  = 5.47 mg/l) against T. castaneum. (+)-Camphor showed obvious fumigant toxicity (LC50  = 0.43 mg/l) against L. bostrychophila. Myrtenol showed contact toxicity (LD50  = 29.40 μg/cm(2) ) and fumigant toxicity (LC50  = 0.50 mg/l) against L. bostrychophila. 1,8-Cineole and (+)-camphor showed strong insecticidal activity to some important insects, and they are main constituents of A. fruticulosa essential oil. The two compounds may be related to insecticidal activity of A. fruticulosa essential oil against T. castaneum and L. bostrychophila. © 2016 Wiley-VHCA AG, Zürich.

  13. Preliminary investigation on the effects of biological and synthetic insecticides on large white butterfly (Pieris brassicae L. larvae

    Directory of Open Access Journals (Sweden)

    Klokočar-Šmit Zlata D.

    2007-01-01

    Full Text Available Control of cabbage pests is oriented towards the use of efficient but high-risk insecticides, some of them being endocrine disruptors. Biopesticides are more environment-friendly, operator-and consumers-safe, but they have low initial toxicity, low efficacy to advanced larval stages, and they require certain knowledge of pest and host biology. In our laboratory experiments we have investigated the effects of formulated synthetic pyrethroid cypermethrin (0.3 l/ha and biological products - formulations based on Bacillus thuringiensis subsp. kurstaki (2 and 3/ha and Spinosad (0.1 l/ha - on large white butterfly (Pieris brassicae L. larvae-instars 2, 3, 4 and 5. The effect of insecticides was inversely proportional to larval instars. Btk effect could be improved if tank-mixed with cypermethrin. The mixing of ready-made products allows a reduction 3 and 6 times compared with the recommended dose, still obtaining satisfactory results. Rate of leaf damage was reduced when tank mixtures were used. Use of two products in mixture would be of significance especially for control of advanced late instars late in season, when Btk action alone is insufficient. Spinosad was effective in inducing mortality and reducing leaf damage by all larval instars, therefore we assume that the dose could be reduced. Feeding rate and mortality are equally important parameters when assessing biopesticide efficacy. This strategy should also reduce the possibility of inducing resistance in pest population. It also tends to reduce the residues in commodities and is good solution in production of hygienic and health safe food.

  14. Plant extracts in the control of aphids Brevicoryne brassicae (L. and Myzus persicae (SulzerExtratos vegetais no controle dos afídeos Brevicoryne brassicae (L. e Myzus persicae (Sulzer

    Directory of Open Access Journals (Sweden)

    Rafael Reginato Ávila

    2011-07-01

    Full Text Available Were accomplished the effect of plant extracts of clove basil (Ocimum gratissimum L., horsetail (Equisetum hyemale L., coriander (Coriandrum sativum L. and tobacco (Nicotiana tabacum L. on Brevicoryne brassicae (L., 1758 and Myzus persicae (Sulzer, 1776 aphids in cabbage Brassica oleracea (L.. The treatments consisted of plant extracts prepared fresh and dry (concentrations of 2.5; 5.0; and 10% and the controls insecticide acephate and water. These solutions were sprayed on cabbage discs placed on agar in Petri dishes, containing twenty adult aphids. In sequence, the Petri dishes were sealed with plastic film and this procedure was repeated for the two aphid species studied. The assessment of the number of live nymphs and adults occurred at 1, 12, 24, and 72 hours after installation. The extracts of coriander and tobacco prepared in a concentration of 10% showed toxic effects similar to the organophosphate insecticide acephate, on adults and nymphs of the aphids Brevicoryne brassicae and Myzus persicae. Coriander revealed a promising alternative that deserves detailed studies regarding the performance of its active ingredients and dosage determination in order to provide a safe herbal product to control insects.Avaliou-se o efeito de extratos vegetais de alfavaca-cravo (Ocimum gratissimum L., cavalinha (Equisetum hyemale L., coentro (Coriandrum sativum L. e fumo (Nicotiana tabacum L. sobre os pulgões Brevicoryne brassicae (L., 1758 e Myzus persicae (Sulzer, 1776 em couve Brassica oleracea (L.. Os tratamentos consistiram de extratos vegetais preparados a fresco e seco (nas concentrações de 2,5; 5,0 e 10%, do padrão inseticida acefato e de água. As soluções assim obtidas foram pulverizadas em discos de couve colocados sobre agar em placas de Petri, contendo vinte pulgões adultos. Na sequência, as placas de Petri foram vedadas com filme plástico transparente, sendo este procedimento repetido para as duas espécies de afídeos. A avalia

  15. Persistence and distribution of [14C]-lindane residues in coffee plants

    International Nuclear Information System (INIS)

    Flores-Rueegg, E.; Mesquita, T.B.

    1976-01-01

    Studies on weathering, volatilization, absorption, translocation and accumulation of [ 14 C]-lindane (γ-1,2,3,4,5,6-hexachlorocyclohexane) in coffee (Coffeea arabica L. var. Bourbon) plants are reported. Ten days after topical application to the leaf surface the insecticide can be absorbed and translocated to different parts of the plant. It accumulates mainly in the roots and appears in other leaves. In these experiments, when plants are cultivated in nutrient solution, release of radiocarbon through roots could be detected, indicating exchange of labelled material between plant and surrounding media. When the insecticide is supplied to coffee plants through the roots immersed in nutrient solution containing [ 14 C]-lindane, the labelled material is absorbed and, after 24 hours, radioactive material can be detected in young leaves of the upper parts of the plant. Loss of [ 14 C]-lindane by volatilization, evaporation and co-distillation with water is apparently continuous and represents a significant proportion of that applied. (author)

  16. GC-MS Analysis of Insecticidal Essential Oil of Aerial Parts of Echinops latifolius Tausch

    Directory of Open Access Journals (Sweden)

    Xin Chao Liu

    2013-01-01

    Full Text Available The roots of Echinops latifolius Tausch (Asteraceae have been used in the traditional medicine. However, no report on chemical composition and insecticidal activities of the essential oil of this plant exists. The aim of this research was to determine chemical composition and insecticidal activities of the essential oil of E. latifolius aerial parts against maize weevils (Sitophilus zeamais Motschulsky for the first time. Essential oil of E. latifolius aerial parts at flowering stage was obtained by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS. A total of 35 components of the essential oil of E. latifolius aerial parts were identified. The major compounds in the essential oil were 1,8-cineole (19.63%, (Z-β-ocimene (18.44%, and β-pinene (15.56% followed by β-myrcene (4.75% and carvone (4.39%. The essential oil of E. latifolius possessed contact toxicity against S. zeamais with an LD50 value of 36.40 µg/adult. The essential oil also exhibited fumigant toxicity against S. zeamais with an LC50 value of 9.98 mg/L. The study indicates that the essential oil of E. latifolius aerial parts has a potential for development into a natural insecticide/fumigant for control of insects in stored grains.

  17. Field evaluation of non-synthetic insecticides for the management of ...

    African Journals Online (AJOL)

    /l and B.thurigiensis was applied at the rate 1.0 g/l of water. Actellic 25 EC, a synthetic insecticide, was applied at the rate of 2 ml/l as standard check. Arthropod fauna on okra were sampled using traps, sweep nets, aspirators and handpicking.

  18. Synergistic interactions between a variety of insecticides and an ergosterol biosynthesis inhibitor fungicide in dietary exposures of bumble bees (Bombus terrestris L.).

    Science.gov (United States)

    Raimets, Risto; Karise, Reet; Mänd, Marika; Kaart, Tanel; Ponting, Sally; Song, Jimao; Cresswell, James E

    2018-03-01

    In recent years, concern has been raised over honey bee colony losses, and also among wild bees there is evidence for extinctions and range contractions in Europe and North America. Pesticides have been proposed as a potential cause of this decline. Bees are exposed simultaneously to a variety of agrochemicals, which may cause synergistically detrimental impacts, which are incompletely understood. We investigated the toxicity of the fungicide imazalil in mixture with four common insecticides: fipronil (phenylpyrazoid), cypermethrin (pyrethroid), thiamethoxam, and imidacloprid (neonicotinoids). Ergosterol biosynthesis inhibitor (EBI) fungicides like imazalil can inhibit P450 detoxification systems in insects and therefore fungicide - insecticide co-occurrence might produce synergistic toxicity in bees. We assessed the impact of dietary fungicide - insecticide mixtures on the mortality and feeding rates of laboratory bumble bees (Bombus terrestris L.). Regarding mortality, imazalil synergised the toxicity of fipronil, cypermethrin and thiamethoxam, but not imidacloprid. We found no synergistic effects on feeding rates. Our findings suggest that P450-based detoxification processes are differentially important in mitigating the toxicity of certain insecticides, even those of the same chemical class. Our evidence that cocktail effects can arise in bumble bees should extend concern about the potential impacts of agrochemical mixtures to include wild bee species in farmland. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  19. Insecticidal and acetylcholine esterase inhibition activity of Asteraceae plant essential oils and their constituents against adults of the German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Jung, Chan-Sik; Kang, Jaesoon; Kim, Junheon; Lee, Jae-Hyeon; Kim, Dong-Soo; Kim, Hyun-Seok; Park, Pil-Sun; Kang, Kyu-Suk; Park, Il-Kwon

    2015-03-04

    The fumigant and contact toxicities of 16 Asteraceae plant essential oils and their constituents against adult male and female Blattella germanica were examined. In a fumigant toxicity test, tarragon oil exhibited 100% and 90% fumigant toxicity against adult male German cockroaches at 5 and 2.5 mg/filter paper, respectively. Fumigant toxicities of Artemisia arborescens and santolina oils against adult male German cockroaches were 100% at 20 mg/filter paper, but were reduced to 60% and 22.5% at 10 mg/filter paper, respectively. In contact toxicity tests, tarragon and santolina oils showed potent insecticidal activity against adult male German cockroaches. Components of active oils were analyzed using gas chromatography, gas chromatography-mass spectrometry, or nuclear magnetic resonance spectrometer. Among the identified compounds from active essential oils, estragole demonstrated potent fumigant and contact toxicity against adult German cockroaches. β-Phellandrene exhibited inhibition of male and female German cockroach acetylcholinesterase activity with IC50 values of 0.30 and 0.28 mg/mL, respectively.

  20. The Genus Artemisia: A 2012–2017 Literature Review on Chemical Composition, Antimicrobial, Insecticidal and Antioxidant Activities of Essential Oils

    Science.gov (United States)

    Singh, Pooja

    2017-01-01

    Essential oils of aromatic and medicinal plants generally have a diverse range of activities because they possess several active constituents that work through several modes of action. The genus Artemisia includes the largest genus of family Asteraceae has several medicinal uses in human and plant diseases aliments. Extensive investigations on essential oil composition, antimicrobial, insecticidal and antioxidant studies have been conducted for various species of this genus. In this review, we have compiled data of recent literature (2012–2017) on essential oil composition, antimicrobial, insecticidal and antioxidant activities of different species of the genus Artemisia. Regarding the antimicrobial and insecticidal properties we have only described here efficacy of essential oils against plant pathogens and insect pests. The literature revealed that 1, 8-cineole, beta-pinene, thujone, artemisia ketone, camphor, caryophyllene, camphene and germacrene D are the major components in most of the essential oils of this plant species. Oils from different species of genus Artemisia exhibited strong antimicrobial activity against plant pathogens and insecticidal activity against insect pests. However, only few species have been explored for antioxidant activity. PMID:28930281

  1. The Genus Artemisia: a 2012–2017 Literature Review on Chemical Composition, Antimicrobial, Insecticidal and Antioxidant Activities of Essential Oils

    Directory of Open Access Journals (Sweden)

    Abhay K. Pandey

    2017-09-01

    Full Text Available Essential oils of aromatic and medicinal plants generally have a diverse range of activities because they possess several active constituents that work through several modes of action. The genus Artemisia includes the largest genus of family Asteraceae has several medicinal uses in human and plant diseases aliments. Extensive investigations on essential oil composition, antimicrobial, insecticidal and antioxidant studies have been conducted for various species of this genus. In this review, we have compiled data of recent literature (2012–2017 on essential oil composition, antimicrobial, insecticidal and antioxidant activities of different species of the genus Artemisia. Regarding the antimicrobial and insecticidal properties we have only described here efficacy of essential oils against plant pathogens and insect pests. The literature revealed that 1, 8-cineole, beta-pinene, thujone, artemisia ketone, camphor, caryophyllene, camphene and germacrene D are the major components in most of the essential oils of this plant species. Oils from different species of genus Artemisia exhibited strong antimicrobial activity against plant pathogens and insecticidal activity against insect pests. However, only few species have been explored for antioxidant activity.

  2. Fate of the insecticide lambda-cyhalothrin in ditch enclosures differing in vegetation density.

    Science.gov (United States)

    Leistra, Minze; Zweers, Anton J; Warinton, Jacqui S; Crum, Steven J H; Hand, Laurence H; Beltman, Wim H J; Maund, Stephen J

    2004-01-01

    Use of the insecticide lambda-cyhalothrin in agriculture may result in the contamination of water bodies, for example by spray drift. Therefore, the possible exposure of aquatic organisms to this insecticide needs to be evaluated. The exposure of the organisms may be reduced by the strong sorption of the insecticide to organic materials and its susceptibility to hydrolysis at the high pH values in the natural range. In experiments done in May and August, formulated lambda-cyhalothrin was mixed with the water body of enclosures in experimental ditches containing a bottom layer and macrophytes (at different densities) or phytoplankton. Concentrations of lambda-cyhalothrin in the water body and in the sediment layer, and contents in the plant compartment, were measured by gas-liquid chromatography at various times up to 1 week after application. Various water quality parameters were also measured. Concentrations of lambda-cyhalothrin decreased rapidly in the water column: 1 day after application, 24-40% of the dose remained in the water, and by 3 days it had declined to 1.8-6.5%. At the highest plant density, lambda-cyhalothrin residue in the plant compartment reached a maximum of 50% of the dose after 1 day; at intermediate and low plant densities, this maximum was only 3-11% of the dose (after 1-2 days). The percentage of the insecticide in the ditch sediment was 12% or less of the dose and tended to be lower at higher plant densities. Alkaline hydrolysis in the water near the surface of macrophytes and phytoplankton is considered to be the main dissipation process for lambda-cyhalothrin.

  3. Impact of fungicide and insecticide use on non-target aquatic organisms in rice paddy fields

    Directory of Open Access Journals (Sweden)

    Alana Cristina Dorneles Wandscheer

    Full Text Available ABSTRACT: The intensive use of plant protection products in rice paddy fields ( Oryza sativa L. has caused concern about the environmental impact on communities of non-target organisms that are natural inhabitants in these agroecosystems. The purpose of this review is to analyze the data currently available in the literature about some important fungicides and insecticides (such as trifloxystrobin, tebuconazole, tricyclazole, lambda-cyhalothrin, and thiamethoxam, which are currently used to control pests and diseases in rice paddy fields, as well as their effects on the community of non-target aquatic organisms.

  4. Antifeedant and insecticidal activity of Polygonum persicaria extracts on Nomophila indistinctalis

    Directory of Open Access Journals (Sweden)

    Luisa Quesada-Romero

    2017-05-01

    Full Text Available Context: Vegetal extracts represent an alternative to control against agricultural pests that have become resistant to pesticides. Using natural products is considered to be more friendly to the environment and safe. Aims: To determine the insecticidal and antifeedant activity of Polygonum persicaria extracts of two differents populations in Chile (Valparaiso and Curico against Nomophila indistinctalis larvae. Methods: Insecticide Resistance Action Committee (IRAC susceptibility test was used to evaluate the insecticidal activity of the extracts at concentrations of 100, 250, 500 and 1000 mg/L; against first instar larvae of Nomophila indistinctalis. The antifeedant activity was evaluated to determine the percentage of consumption in third instar larvae on treatment. Results: When comparing the control and the treatment groups in the antifeedant activity assay, significant differences (p<0.05 were observed after 90 minutes of exposure. With respect to the insecticidal activity, all extracts showed significant effects at the applied concentrations compared to the negative control. Moreover, the dichloromethane extracts of Curico and Valparaiso at concentrations greater than 500 mg/L showed a similar insecticidal activity as compared to the commercial formulation Neem. Conclusions: This work presents for the first time the results of the anti-feeding and insecticide activity of ethanol, methanol, and dichloromethane extracts from Polygonum persicaria on Nomophila indistinctalis. The results show that the extracts of this species can be used as an alternative for biological control. In addition, the results obtained allow a bioguided fractionation for the identification of secondary metabolites present in these extracts.

  5. Larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus ...

    African Journals Online (AJOL)

    Purpose: To evaluate the larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus, Foenuculum vulgare and Tagetes minuta leaf extracts against Culex quinquefasciatus mosquitoes. Methods: The leaves of the plants were extracted with distilled water, ethanol (95 %), and hexane and the extracts screened for ...

  6. Evaluasi Sifat Ovisidal dan Nimfasidal Insektisida Buprofezin 100 g/l terhadap Telur dan Nimfa Wereng Coklat, Nilaparvata lugens (Stal. (Hemiptera: Delphacidae

    Directory of Open Access Journals (Sweden)

    BAEHAKI SUHERLAN EFFENDI

    2016-11-01

    Full Text Available Evaluation of ovicidal and nymphcidal properties of buprofezin 100 g/linsecticide to eggs and nymphs of brown planthopper, Nilaparvata lugens(Stal. (Hemiptera: Delphacidae. Research was carried out in screen house ofSukamandi, Indonesian Center for Rice Research (ICRR in the wet season of 2013. Theresearch used randomized block design with 5 doses levels insecticide treatment of buprofezin100 g/l and four replications. The buprofezin treatments were 250, 500, 750, 1000, and 1500ml/ha compared with control without insecticide. The objective of the research to evaluate ofovicidal and nymphcidal of buprofezin to brown planthopper (BPH. The results showed thatthe ovicidal properties of buprofezin 100 g/l with a range doses of treatments to BPH eggsthat application at 5 days after inoculation with eggs remains in the plant tissue were 39,79-94,88%. The raising ovicidal of buprofezin were 74,84-99,5% that applied at 9 days afterinoculation with eggs remains in the plant tissue. In the other hand the ovicidal properties ofbuprofezin decreased dramatically were 20-48% that applied at 5 days after inoculation andthen BPH eggs removed from plant tissue (dissected at 9 days after inoculation. The higherovicidal properties of buprofezin is better in the plant tissue than in the dissected eggs treated,because buprofezin working on eggs in plant tissue as a systemic insecticide. The dissectedBPH eggs of rice treated to show the normal eggs shape and no eggs contracted. Theunhatched eggs of buprofezin treatments were milk white due to insecticide effect, sometranslucent color with a red dot as a fertile eggs or without a red dot as unfertile eggs.Buprofezin was the excellent nymphcidal insecticide with the value of the efficacy to BPHnymphs were very high about 87,44 -100% for a range doses treatments. Buprofezin did notresurgence effect, moreover this insecticides still have ovicidal and nimphcidal properties as abasic to reduce offspring of brown planthopper.

  7. Comparative acute toxicity of neonicotinoid and pyrethroid insecticides to non-target crayfish (Procambarus clarkii) associated with rice-crayfish crop rotations.

    Science.gov (United States)

    Barbee, Gary C; Stout, Michael J

    2009-11-01

    Most insecticides used to control rice water weevil (Lissorhoptrus oryzophilus Kuscel) infestations are pyrethroids. However, pyrethroids are highly toxic to non-target crayfish associated with rice-crayfish crop rotations. One solution to the near-exclusive reliance on pyrethroids in a rice-crayfish pest management program is to incorporate neonicotinoid insecticides, which are insect specific and effective against weevils but not extremely toxic to crayfish. This study aimed to take the first step to assess neonicotinoids as alternatives to pyrethroids in rice-crayfish crop rotations by measuring the acute toxicities of three candidate neonicotinoid insecticides, clothianidin, dinotefuran and thiamethoxam, to juvenile Procambarus clarkii (Girard) crayfish and comparing them with the acute toxicities of two currently used pyrethroid insecticides, lambda-cyhalothrin and etofenprox. Neonicotinoid insecticides are at least 2-3 orders of magnitude less acutely toxic (96 h LC(50)) than pyrethroids to juvenile Procambarid crayfish: lambda-cyhalothrin (0.16 microg AI L(-1)) = etofenprox (0.29 microg AI L(-1)) > clothianidin (59 microg AI L(-1)) > thiamethoxam (967 microg AI L(-1)) > dinotefuran (2032 microg AI L(-1)). Neonicotinoid insecticides appear to be much less hazardous alternatives to pyrethroids in rice-crayfish crop rotations. Further field-level neonicotinoid acute and chronic toxicity testing with crayfish is needed. (c) 2009 Society of Chemical Industry.

  8. A study under semi-field conditions on the efficacy of insecticides against Meligethes aeneus F

    DEFF Research Database (Denmark)

    Kaiser, Caroline; Bormann, Inga; Ahlemann, Martin

    2014-01-01

    Oilseed rape (Brassica napus L.) is one of the most important oilseed crops in the world. One of the major pests is the pollen beetle (Meligethes aeneus F.) (Nitidulidae). Under certain conditions the beetle can cause yield losses of up to 100%. One contributing factor is the decreased sensitivity...... with different mode of actions were sprayed in the field. Treated plants were cut and brought into the greenhouse on nine sampling occasions. Each plant was placed into a perforated plastic bag with 10 beetles. The vitality of the beetles was observed after two and five days following inoculation. To describe...... of the observations due to repeated observations on the same plant was accounted for by a random plant effect. The comparison of the different insecticides and their significance test was made by using the marginal expectation values. For the computational implementation, we used the procedure NL MIXED (SAS 9.3)....

  9. Effect of isodillapiole on the expression of the insecticide resistance genes GSTE7 and CYP6N12 in Aedes aegypti from central Amazonia.

    Science.gov (United States)

    Lima, V S; Pinto, A C; Rafael, M S

    2015-12-11

    The yellow fever mosquito Aedes (Stegomyia) aegypti is the main vector of dengue arbovirus and other arboviruses. Dengue prevention measures for the control of A. aegypti involve mainly the use of synthetic insecticides. The constant use of insecticides has caused resistance in this mosquito. Alternative studies on plant extracts and their products have been conducted with the aim of controlling the spread of the mosquito. Dillapiole is a compound found in essential oils of the plant Piper aduncum (Piperaceae) which has been effective as a biopesticide against A. aegypti. Isodillapiole is a semisynthetic substance obtained by the isomerization of dillapiole. In the present study, isodillapiole was evaluated for its potential to induce differential expression of insecticide resistance genes (GSTE7 and CYP6N12) in 3rd instar larvae of A. aegypti. These larvae were exposed to this compound at two concentrations (20 and 40 μg/mL) for 4 h during four generations (G1, G2, G3, and G4). Quantitative RT-PCR was used to assess the expression of GSTE7 and CYP6N12 genes. GSTE7 and CYP6N12 relative expression levels were higher at 20 than at 40 μg/mL and varied among generations. The decrease in GSTE7 and CYP6N12 expression levels at the highest isodillapiole concentration suggests that larvae may have suffered from metabolic stress, revealing a potential alternative product in the control of A. aegypti.

  10. Insecticidal activity of Piper essential oils from the Amazon against the fire ant Solenopsis saevissima (Smith) (Hymenoptera: Formicidae).

    Science.gov (United States)

    Souto, R N P; Harada, A Y; Andrade, E H A; Maia, J G S

    2012-12-01

    Pepper plants in the genus Piper (Piperales: Piperaceae) are common in the Brazilian Amazon and many produce compounds with biological activity against insect pests. We evaluated the insecticidal effect of essential oils from Piper aduncum, Piper marginatum (chemotypes A and B), Piper divaricatum and Piper callosum against workers of the fire ant Solenopsis saevissima (Smith) (Hymenoptera: Formicidae), as well as their chemical composition by gas chromatography and gas chromatography-mass spectrometry. The lowest median lethal concentration (LC50) in 48 h was obtained with the oil of P. aduncum (58.4 mg/L), followed by the oils of P. marginatum types A (122.4 mg/L) and B (167.0 mg/L), P. divaricatum (301.7 mg/L), and P. callosum (312.6 mg/L). The major chemical constituents were dillapiole (64.4%) in the oil of P. aduncum; p-mentha-1(7),8-diene (39.0%), 3,4-methylenedioxypropiophenone (19.0%), and (E)-β-ocimene (9.8%) in P. marginatum chemotype A and (E)-isoosmorhizole (32.2%), (E)-anethole (26.4%), isoosmorhizole (11.2%), and (Z)-anethole (6.0%) in P. marginatum chemotype B; methyleugenol (69.2%) and eugenol (16.2%) in P. divaricatum; and safrole (69.2%), methyleugenol (8.6%), and β-pinene (6.2%) in P. callosum. These chemical constituents have been previously known to possess insecticidal properties.

  11. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  12. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  13. Partial purification and characterization of α-amylases from one insecticide-resistant population of Sitophilus zeamais

    International Nuclear Information System (INIS)

    Lopes, K.V.; Oliveira, M.G.A.; Paixao, G.P.; Visotto, L.E.; Veloso, R.V.S.; Marinho, J.S.; Guedes, R.N.C.; Oliveira, J.A.

    2008-01-01

    Full text: α-Amylases (EC 3.2.1.1) constitute a family of endo-amylases that catalyze the hydrolysis of a-D- (1,4)-glucan linkages in st ach components and various other related carbohydrates. They play a central role in carbohydrate metabolism of animals, plants and microorganisms. Many insects, especially those that feed on grain products during larval and/or adult life, depend on their amylases for survival. This is particularly true for the Sitophilus zeamais Motschulsky, a cosmopolitan pest of stored products. It is mainly controlled by insecticides. Amylases from adults of S.zeamais insecticide-resistant were purified by using a sequential procedure of glycogen-complex precipitation and ion exchange chromatography. Specific activity increased from 58,0454 AU/dL/mg protein in the crude homogenate to 2558,8720 AU/dL/mg protein in the final purified sample. Amylase unit (AU/dL) refers to the amount of amylase that hydrolysis 10 mg starch in 30 min at 37 deg C. The purified amylase ran as a single protein band on SDS-PAGE. From a plot of log molecular weight against relative mobility in 10% acrylamide gel, molecular weight was estimated to be 56 kDa. The enzyme had a K m of 0,2243 g/L for soluble starch and was most active at ph 5,0. The temperature of major activity was 40 deg C. The activity of enzyme was unaffected by presence or absence of Cl - and Ca 2+

  14. Effects of a naturally occurring and a synthetic synergist on toxicity of three insecticides and a phytochemical to navel orangeworm (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Niu, Guodong; Pollock, Henry S; Lawrance, Allen; Siegel, Joel P; Berenbaum, May R

    2012-04-01

    The navel orangeworm, Amyelois transitella (Walker) (Lepidoptera: Pyralidae), is the most destructive lepidopteran pest of almonds [Prunus dulcis (Mill.) D.A.Webb] and pistachios (Pistacia vera L.) in California and is a serious problem in figs (Ficus carica L.) and walnuts (Juglans spp.). In addition to direct damage, larval feeding leaves nuts vulnerable to infection by Aspergillus spp., fungi that produce toxic aflatoxins. A potentially safe and sustainable approach for managing navel orangeworm in orchards may be to use natural essential oil synergists to interfere with this insect's ability to detoxify insecticides and phytochemicals. We tested the effects of a naturally occurring plant-derived chemical, myristicin, and a synthetic inhibitor of cytochrome P450 monooxygenases (P450s), piperonyl butoxide, on the toxicity of three insecticides (alpha-cypermethrin, tau-fluvalinate, and methoxyfenozide [Intrepid]) and a phytochemical (xanthotoxin) to A. transitella. Piperonyl butoxide significantly synergized alpha-cypermethrin and tau-fluvalinate, whereas myristicin synergized only alpha-cypermethrin. Piperonyl butoxide synergized the toxicity of xanthotoxin as early as 72 h after exposure, whereas myristicin synergized xanthotoxin after 120 h. In view of these findings and the limited availability of environmentally safe synthetic insecticides for sustainable management, particularly in organic orchards, myristicin is a potential field treatment in combination with insecticides to reduce both navel orangeworm survival and aflatoxin contamination of nuts. In addition, this study demonstrates that in A. transitella the insect growth regulator methoxyfenozide is not detoxified by P450s.

  15. Biological Control Against the Cowpea Weevil (Callosobruchus Chinensis L., Coleoptera: Bruchidae Using Essential Oils of Some Medicinal Plants

    Directory of Open Access Journals (Sweden)

    Fatiha Righi Assia

    2014-07-01

    Full Text Available Chickpea (Cicer arietinum L. is a valuable foodstuff but unfortunately this legume is prone to insect attacks from the chick pea weevil (Callosobruchus chinensis L.. This serious pest damages the chickpea and causes decreases in the yield and in the nutritional quality. Biological control is being used to deal with this problem. We tried different doses of the essential oils of three new medicinal plants, namely Salvia verbenaca L., Scilla maritima L., and Artemisia herba-alba Asso to limit the damage of the chick pea weevil pest, and to protect consumer’s health. To determine the effect and efficiency of the oil, the tests were conducted using the different biological parameters of fertility, longevity, and fecundity, under controlled temperature and relative humidity (28°C and 75%. The effectiveness of organic oils was demonstrated. We tested these oils on the germination of seeds. The obtained results showed that the tested plant oils have a real organic insecticide effect. The essential oil of Artemisia proved most effective as a biocide; achieving a mortality rate of 100%. A significant reduction in longevity was observed under the effect of 30 μl of S. maritima (1.3 days and S. verbenaca (2.8, 4.6 days, respectively, for males and females compared to 8 and 15 days for the control. For fecundity, an inhibition of oviposition was obtained using 30 μl of Salvia and Scilla essential oils. The test on the seed germination using different essential oils, showed no damage to the germinating seeds. The germination rate was 99%. These findings suggest that the tested plants can be used as a bioinsecticide for control of the C. chinensis pest of stored products.

  16. Imaginal and ovicidal effect of some insecticides against Bruchus pisorum L. (Coleoptera: Chrisomelidae

    Directory of Open Access Journals (Sweden)

    Nikolova I. M.

    2015-06-01

    Full Text Available Trials were conducted in 2011 and 2012 at the Institute of Forage Crops, Pleven, Bulgaria, in order to study the imaginal and possible ovicidal effect of some insecticides against Bruchus pisorum under field conditions. Treatments with insecticides were started after the appearance of the first pea weevils eggs on pods located on the bottom two nodes. It was found that treatment with acetamiprid; thiacloprid; thiacloprid+deltamethrin; 50 g cypermethrin+480 g chlorpyrifosethyl, 50 g cypermethrin+500 g chlorpyrifosethyl and zeta-cypermethrin resulted in the cessation of additional oviposition on the lower nodes by Bruchus pisorum, due to the toxic effect of the insecticides on the pea weevil. It was found that spraying with acetamiprid and zeta-cypermethrin was the most effective. These insecticides significantly reduced the proportion of infected pods in comparison with the proportion of pods with eggs before the treatment by 30.2 and 27.4% and by 15.8 and 24.0% in 2011 and 2012, respectively. The use of acetamiprid and zeta-cypermethrin was also associated with the lowest percentage of infected seeds (21.7 and 23.6%, respectively, with the lowest percentage of infected seed in infected pods (40.5 and 42.5%, respectively and the highest weight of 1000 infected seeds (161.94 and 182.04 g, respectively. It was concluded that the management of pea weevils in the crop with acetamiprid and zetacypermethrin can lead to satisfactory results when spray timing is chosen when the first eggs are visible.

  17. Adaptation to toxic hosts as a factor in the evolution of insecticide resistance.

    Science.gov (United States)

    Alyokhin, Andrei; Chen, Yolanda H

    2017-06-01

    Insecticide resistance is a serious economic problem that jeopardizes sustainability of chemical control of herbivorous insects and related arthropods. It can be viewed as a specific case of adaptation to toxic chemicals, which has been driven in large part, but not exclusively, by the necessity for insect pests to tolerate defensive compounds produced by their host plants. Synthetic insecticides may simply change expression of specific sets of detoxification genes that have evolved due to ancestral associations with host plants. Feeding on host plants with more abundant or novel secondary metabolites has even been shown to prime insect herbivores to tolerate pesticides. Clear understanding of basic evolutionary processes is important for achieving lasting success in managing herbivorous arthropods. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Evaluation of plant-mediated synthesized silver nanoparticles against vector mosquitoes.

    Science.gov (United States)

    Veerakumar, Kaliyan; Govindarajan, Marimuthu; Hoti, S L

    2014-12-01

    Diseases transmitted by blood-feeding mosquitoes, such as dengue fever, dengue hemorrhagic fever, Japanese encephalitis, malaria, and filariasis, are increasing in prevalence, particularly in tropical and subtropical zones. To control mosquitoes and mosquito-borne diseases, which have worldwide health and economic impacts, synthetic insecticide-based interventions are still necessary, particularly in situations of epidemic outbreak and sudden increases of adult mosquitoes. Green nanoparticle synthesis has been achieved using environmentally acceptable plant extract and eco-friendly reducing and capping agents. In view of the recently increased interest in developing plant origin insecticides as an alternative to chemical insecticide, in the present study, the adulticidal activity of silver nanoparticles (AgNPs) synthesized using Heliotropium indicum plant leaf extract against adults of Anopheles stephensi, Aedes aegypti, and Culex quinquefasciatus was determined. Adult mosquitoes were exposed to varying concentrations of aqueous extract of H. indicum and synthesized AgNPs for 24 h. AgNPs were rapidly synthesized using the leaf extract of H. indicum, and the formation of nanoparticles was observed within 6 h. The results recorded from UV-vis spectrum, Fourier transform infrared, X-ray diffraction, scanning electron microscopy, and transmission electron microscopy support the biosynthesis and characterization of AgNPs. The maximum efficacy was observed in synthesized AgNPs against the adult of A. stephensi (lethal dose (LD)₅₀ = 26.712 μg/mL; LD₉₀ = 49.061 μg/mL), A. aegypti (LD₅₀ = 29.626 μg/mL; LD₉₀ = 54.269 μg/mL), and C. quinquefasciatus (LD₅₀ = 32.077 μg/mL; LD₉₀ = 58.426 μg/mL), respectively. No mortality was observed in the control. These results suggest that the leaf aqueous extracts of H.indicum and green synthesis of AgNPs have the potential to be used as an ideal eco-friendly approach for the control of

  19. Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.

    Science.gov (United States)

    Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E

    2009-10-01

    Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.

  20. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    Directory of Open Access Journals (Sweden)

    Tamrin Abdullah

    2015-08-01

    Full Text Available Abstract The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e neem seed extract together with rice planting neem seed extract on soybean 17 days after rice planting synthetic insecticides on 17 days after rice planting Delthametrin on soybean and Chlorpirifos on rice respectively. Research was conducted in rice fields with irrigation channels. The land area is 0.8 hectares with extensive experiments each rice terraces approximately 900 m2 with separate by rice terraces for every treatment. Each treatment consisted of three groups and using nine rice terraces. Samples of the rice plant population is 25 plants per sample unit. The results was showed treatment by neem seed extract with different time planting of soybeans able to reduce number of pest insects populations such as N. virescens 80.38 N. lugens 67.17 S. incertulas 66.5 and L. oratorius 93.46 when compared to treatment with synthetic insecticides Delthamethrin and Chlorpyrifos.

  1. N-Substituted 5-Chloro-6-phenylpyridazin-3(2H-ones: Synthesis, Insecticidal Activity Against Plutella xylostella (L. and SAR Study

    Directory of Open Access Journals (Sweden)

    Song Yang

    2012-08-01

    Full Text Available A series of N-substituted 5-chloro-6-phenylpyridazin-3(2H-one derivatives were synthesized based on our previous work; all compounds were characterized by spectral data and tested for in vitro insecticidal activity against Plutella xylostella. The results showed that the synthesized pyridazin-3(2H-one compounds possessed good insecticidal activities, especially the compounds 4b, 4d, and 4h which showed > 90% activity at 100 mg/L. The structure-activity relationships (SAR for these compounds were also discussed.

  2. Review of the evolution of insecticide resistance in main malaria vectors in Cameroon from 1990 to 2017.

    Science.gov (United States)

    Antonio-Nkondjio, Christophe; Sonhafouo-Chiana, N; Ngadjeu, C S; Doumbe-Belisse, P; Talipouo, A; Djamouko-Djonkam, L; Kopya, E; Bamou, R; Awono-Ambene, P; Wondji, Charles S

    2017-10-10

    Malaria remains a major public health threat in Cameroon and disease prevention is facing strong challenges due to the rapid expansion of insecticide resistance in vector populations. The present review presents an overview of published data on insecticide resistance in the main malaria vectors in Cameroon to assist in the elaboration of future and sustainable resistance management strategies. A systematic search on mosquito susceptibility to insecticides and insecticide resistance in malaria vectors in Cameroon was conducted using online bibliographic databases including PubMed, Google and Google Scholar. From each peer-reviewed paper, information on the year of the study, mosquito species, susceptibility levels, location, insecticides, data source and resistance mechanisms were extracted and inserted in a Microsoft Excel datasheet. The data collected were then analysed for assessing insecticide resistance evolution. Thirty-three scientific publications were selected for the analysis. The rapid evolution of insecticide resistance across the country was reported from 2000 onward. Insecticide resistance was highly prevalent in both An. gambiae (s.l.) and An. funestus. DDT, permethrin, deltamethrin and bendiocarb appeared as the most affected compounds by resistance. From 2000 to 2017 a steady increase in the prevalence of kdr allele frequency was noted in almost all sites in An. gambiae (s.l.), with the L1014F kdr allele being the most prevalent. Several detoxification genes (particularly P450 monooxygenase) were associated with DDT, pyrethroids and bendiocarb resistance. In An. funestus, resistance to DDT and pyrethroids was mainly attributed to the 119F-GSTe2 metabolic resistance marker and over-expression of P450 genes whereas the 296S-RDL mutation was detected in dieldrin-resistant An. funestus. The review provides an update of insecticide resistance status in malaria vector populations in Cameroon and stresses the need for further actions to reinforce malaria

  3. Synthesis and Insecticidal Activities of Novel Analogues of Chlorantraniliprole Containing Nitro Group

    Institute of Scientific and Technical Information of China (English)

    FENG Qi; WANG Ming-zhong; XIONG Li-xia; LIU Zhi-li; LI Zheng-ming

    2011-01-01

    Twelve novel analogues of chlorantraniliprole containing nitro group were synthesized,and their structures were characterized by 1H NMR and high-resolution mass spectrometry(HRMS).Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the nitro-containing analogues showed favorable insecticidal activities,while the activity of compounds 5g at 0.25 mg/L was 40%,but still lower than chlorantraniliprole.

  4. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  5. Widespread occurrence of neonicotinoid insecticides in streams in a high corn and soybean producing region, USA

    Science.gov (United States)

    Hladik, Michelle; Kolpin, Dana W.; Kuivila, Kathryn

    2014-01-01

    Neonicotinoid insecticides are of environmental concern, but little is known about their occurrence in surface water. An area of intense corn and soybean production in the Midwestern United States was chosen to study this issue because of the high agricultural use of neonicotinoids via both seed treatments and other forms of application. Water samples were collected from nine stream sites during the 2013 growing season. The results for the 79 water samples documented similar patterns among sites for both frequency of detection and concentration (maximum:median) with clothianidin (75%, 257 ng/L:8.2 ng/L) > thiamethoxam (47%, 185 ng/L: imidacloprid (23%, 42.7 ng/L: <2 ng/L). Neonicotinoids were detected at all nine sites sampled even though the basin areas spanned four orders of magnitude. Temporal patterns in concentrations reveal pulses of neonicotinoids associated with rainfall events during crop planting, suggesting seed treatments as their likely source.

  6. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  7. Joint use of fungicides, insecticides and inoculants in the treatment of soybean seeds

    Directory of Open Access Journals (Sweden)

    Yara Cristiane Buhl Gomes

    Full Text Available ABSTRACT The interference of the joint application of pesticides with seed inoculation on the survival of Bradyrhizobium has been reported in the last years. So, the objective of this study was to evaluate the joint use of fungicides, insecticides and inoculant in the treatment of soybean seeds on various parameters of Bradyrhizobium nodulation in soybean as well as on crop productivity parameters. The experiment was conducted during the 2013/2014 crop in the experimental field of the Instituto Federal de Educação, Ciência e Tecnologia de Mato Grosso - Campo Novo do Parecis Campus. The seeds of TMG 133 RR variety were sown in pots. It was used a randomized block design in a 4 x 4 + 1 factorial, four fungicides (1: fludioxonil + metalaxyl-M, 2: carboxine + thiram, 3: difeconazole and 4: carbendazim + thiram, four insecticides (1: fipronil 250 SC, 2: thiamethoxam, 3: imidacloprid + thiodicarpe and 4: imodacloprid 600 FC and an inoculant (SEMIA 5079 and SEMIA 5080, common to all treatments, with three replications. The experiment was not repeated. The joint application of fungicide and insecticide with inoculant does not affect nodulation, foliar N content and vegetative growth of the plants as well as the masses of grains per plant and 100-grain mass. The use of the carbendazim + thiram mixed with fipronil and carbendazim + thiram mixed with imidacloprid provides less number of pods per plant and grains per plant, reflecting in reductions in the production of soybean grains. In this way, the fungicide carbendazim + thiram, regardless of the combined applied insecticide, is the most harmful to Bradyrhizobium spp.

  8. The role of L-DOPA in plants

    Science.gov (United States)

    Soares, Anderson Ricardo; Marchiosi, Rogério; Siqueira-Soares, Rita de Cássia; Barbosa de Lima, Rogério; Dantas dos Santos, Wanderley; Ferrarese-Filho, Osvaldo

    2014-01-01

    Since higher plants regularly release organic compounds into the environment, their decay products are often added to the soil matrix and a few have been reported as agents of plant-plant interactions. These compounds, active against higher plants, typically suppress seed germination, cause injury to root growth and other meristems, and inhibit seedling growth. Mucuna pruriens is an example of a successful cover crop with several highly active secondary chemical agents that are produced by its seeds, leaves and roots. The main phytotoxic compound encountered is the non-protein amino acid L-3,4-dihydroxyphenylalanine (L-DOPA), which is used in treating the symptoms of Parkinson disease. In plants, L-DOPA is a precursor of many alkaloids, catecholamines, and melanin and is released from Mucuna into soils, inhibiting the growth of nearby plant species. This review summarizes knowledge regarding L-DOPA in plants, providing a brief overview about its metabolic actions. PMID:24598311

  9. Impact of insecticides on parasitoids of the leafminer, Liriomyza trifolii, in pepper in south Texas.

    Science.gov (United States)

    Hernández, Ricardo; Harris, Marvin; Liu, Tong-Xian

    2011-01-01

    Liriomyza leafminers (Diptera: Agromyzidae) are cosmopolitan, polyphagous pests of horticultural plants and many are resistant to insecticides. Producers in South Texas rely on insecticides as the primary management tool for leafminers, and several compounds are available. The objective of this study is to address the efficacy of these compounds for controlling Liriomyza while minimizing their effects against natural enemies. Research plots were established at Texas AgriLife research center at Weslaco, Texas in fall 2007 and spring 2008 seasons, and peppers were used as a model crop. Plots were sprayed with novaluron, abamectin, spinetoram, lambda-cyhalothrin and water as treatments according to leafminer infestation; insecticide efficacy was monitored by collecting leaves and infested foliage. Plant phenology was also monitored. Novaluron was the most effective insecticide and lambda-cyhalothrin showed resurgence in leafminer density in fall 2007 and no reduction in spring 2008. Other compounds varied in efficacy. Novaluron showed the least number of parasitoids per leafminer larva and the lowest parasitoid diversity index among treatments followed by spinetoram. Liriomyza trifolii (Burgess) was the sole leafminer species on peppers, and 19 parasitoid species were found associated with this leafminer. Application of these insecticides for management of leafminers with conservation of natural enemies is discussed.

  10. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  11. SELECTIVITY OF INSECTICIDES TO PREDATORS OF PESTS COTTON PLANT SELETIVIDADE DE INSETICIDAS AOS PREDADORES DAS PRAGAS DO ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Julio Cezar Silveira Nunes

    2007-09-01

    Full Text Available

    The selectivity of insecticides for the complex of predators of the pests of cotton plant was evaluated in field experiment, in Goiânia- Goiás (Brazil, during the crop 1998/99. The experimental design was the randomized blocks with seven treatments and four repetitions (check, clorfluazuron, Bacillus thuringiensis, alanycarb, endosulfan and acephate in two amounts. The samplings were accomplished in beforeapplication, two days, seven and fourteen days after the treatment. For the obtained results (Henderson & Tilton, the products, in the decreasing order of selectivity, were: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    KEY-WORDS: Insecta; insecticides; cotton plant; predators.

    A seletividade de inseticidas para o complexo das pragas do algodoeiro foi avaliada em experimento de campo, em Goiânia (GO, durante a safra 1998/99. O delineamento experimental foi em blocos ao acaso com sete tratamentos testemunha, clorfluazuron, B. thuringiensis, alanycarb, endosulfan e acephate em duas dosagens, em quatro repetições. As amostragens foram realizadas em pré-aplicação; aos dois, sete e quatorze dias após as pulverizações. Pelos resultados obtidos (fórmula de Herderson & Tilton, os produtos, na ordem decrescente de seletividade, foram: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    PALAVRAS-CHAVE: Insecta; inseticidas; algodão; predadores.

  12. Residual insecticides, inert dusts and botanicals for the protection of durable stored products against pest infestation in developing countries

    Directory of Open Access Journals (Sweden)

    Obeng-Ofori, D.

    2010-09-01

    Full Text Available Insect pests associated with durable grains and processed food cause considerable quantitative and qualitative losses throughout the world. Insect infestation can occur just prior to harvest, during storage in traditional storage structures, cribs, metal or concrete bins, and in warehouses, food handling facilities, retail grocery stores as well as in-transit. Many tools are available for managing insects associated with grains and processed food. Although pest management strategies are changing to meet consumer’s demand for food free of insecticide residues, address concerns about safety of insecticides to humans, delay insecticide resistance development in insects and comply with stricter insecticide regulations, the use of synthetic residual insecticides will continue to be a major component of stored-product pest management programmes. Selective use of residual insecticides requires a through understanding and evaluation of risks, costs and benefits. The use of plant and inert materials may be a safe, cost-effective and environmentally friendly method of grain preservation against pest infestation among low-resource poor farmers who store small amounts of grains. There is a dearth of information on the use of plant materials by rural farmers in Africa for stored-product protection. The most promising candidate plant materials for future utilization as grain protectants are Azadirachta, Acorus, Chenopodium, Eucalyptus, Mentha, Ocimum, Piper and Tetradenia together with vegetable oils from various sources. Neem is the only plant from which several commercial products have been developed worldwide. However, unlike synthetic insecticides these alternatives often do not provide effective or rapid suppression of pest populations and may not be effective against all species of pests. These alternatives are also more expensive than synthetic insecticides, and have not been tested extensively under field conditions in the tropics. This paper

  13. Potential Use of Insecticides and Mineral Oils for the Control of Transmission of Major Aphid-Transmitted Potato Viruses

    Directory of Open Access Journals (Sweden)

    Drago Milošević

    2012-01-01

    Full Text Available Viruses occurring in Serbia and other countries in the region are a huge problem constrainingseed potato production. At lower altitudes, in lowland and hilly regions, wheretable potato production is widely distributed, more than 50% of healthy plants becomeinfected with potato virus Y during one growing season. Under these conditions, seed potatoproduction is hindered due to a high infection pressure of potato virus Y which spreads farmore rapidly compared to leaf roll virus, virus S and other viruses hosted by this plant species.This study tended to clarify a frequent dilemma regarding the use of insecticides in preventingthe infection of healthy plants with potato virus Y and leaf roll virus, given the oraland written recommendations from pesticide manufacturers, agronomists and scientistsin the field of crop protection arising from a logical conclusion that aphid vector controlresults in virus transmission control.The present findings, which are in agreement with reports of authors from other countries,show that the use of insecticides is ineffective in preventing potato virus Y which isnonpersistently transmitted by aphids from an external source of infection.However, insecticides can exhibit efficacy in preventing potato virus Y transmissionfrom infected plants to healthy plants within a crop, which can have an overall positiveeffect only if seed potato is grown in areas that have no external source of infection.The present results and those of other authors show that insecticides are effective inpreventing the infection of healthy plants with persistently transmitted leaf roll virus.Mineral oils provide effective control of potato virus Y by preventing the infection ofpotato plants with the virus. They can be combined with other management practices toprotect seed potato crops against the virus.Given the fact that the initial first-year infection of healthy potato plants with virus Y inrelation to leaf roll virus is approximately 10

  14. Insecticide use in hybrid onion seed production affects pre- and postpollination processes.

    Science.gov (United States)

    Gillespie, Sandra; Long, Rachael; Seitz, Nicola; Williams, Neal

    2014-02-01

    Research on threats to pollination service in agro-ecosystems has focused primarily on the negative impacts of land use change and agricultural practices such as insecticide use on pollinator populations. Insecticide use could also affect the pollination process, through nonlethal impacts on pollinator attraction and postpollination processes such as pollen viability or pollen tube growth. Hybrid onion seed (Allium cepa L., Alliaceae) is an important pollinator-dependent crop that has suffered yield declines in California, concurrent with increased insecticide use. Field studies suggest that insecticide use reduces pollination service in this system. We conducted a field experiment manipulating insecticide use to examine the impacts of insecticides on 1) pollinator attraction, 2) pollen/stigma interactions, and 3) seed set and seed quality. Select insecticides had negative impacts on pollinator attraction and pollen/stigma interactions, with certain products dramatically reducing pollen germination and pollen tube growth. Decreased pollen germination was not associated with reduced seed set; however, reduced pollinator attraction was associated with lower seed set and seed quality, for one of the two female lines examined. Our results highlight the importance of pesticide effects on the pollination process. Overuse may lead to yield reductions through impacts on pollinator behavior and postpollination processes. Overall, in hybrid onion seed production, moderation in insecticide use is advised when controlling onion thrips, Thrips tabaci, on commercial fields.

  15. Transgenic plants over-expressing insect-specific microRNA acquire insecticidal activity against Helicoverpa armigera: an alternative to Bt-toxin technology.

    Science.gov (United States)

    Agrawal, Aditi; Rajamani, Vijayalakshmi; Reddy, Vanga Siva; Mukherjee, Sunil Kumar; Bhatnagar, Raj K

    2015-10-01

    The success of Bt transgenics in controlling predation of crops has been tempered by sporadic emergence of resistance in targeted insect larvae. Such emerging threats have prompted the search for novel insecticidal molecules that are specific and could be expressed through plants. We have resorted to small RNA-based technology for an investigative search and focused our attention to an insect-specific miRNA that interferes with the insect molting process resulting in the death of the larvae. In this study, we report the designing of a vector that produces artificial microRNA (amiR), namely amiR-24, which targets the chitinase gene of Helicoverpa armigera. This vector was used as transgene in tobacco. Northern blot and real-time analysis revealed the high level expression of amiR-24 in transgenic tobacco plants. Larvae feeding on the transgenic plants ceased to molt further and eventually died. Our results demonstrate that transgenic tobacco plants can express amiR-24 insectice specific to H. armigera.

  16. Piperolein B and piperchabamide D isolated from black pepper (Piper nigrum L.) as larvicidal compounds against the diamondback moth (Plutella xylostella).

    Science.gov (United States)

    Hwang, Ki Seon; Kim, Young Kook; Park, Kee Woong; Kim, Young Tae

    2017-08-01

    There is growing demand for the development of alternative pest control agents that are effective as well as non-toxic to human health and the environment. Plant protection products derived from plant extracts are an eco-friendly alternative to synthetic pesticides. The aim of this study was to identify larvicidal compounds isolated from a natural source against Plutella xylostella L. In a larvicidal activity assay, several solvent fractions from the methanol extract of Piper nigrum L. fruit showed larvicidal effects against P. xylostella. Screening results indicated that chloroform extract was the most effective against P. xylostella larvae. Two compounds with insecticidal activity in the chloroform fraction were identified as piperolein B and piperchabamide D by spectroscopic analyses, including mass spectrometry and NMR, and by comparison to published data. At applications of 0.1 mg mL -1 concentration, piperolein B and piperchabamide D, respectively, induced 96.7 ± 5.8% and 79.2 ± 16.6% mortality rates of P. xylostella larvae 4 days post-application. Our results demonstrate that piperolein B and piperchabamide D isolated from P. nigrum are the major constituents of the extract demonstrating insecticidal properties for the control of P. xylostella larvae. These plant-derived compounds should become useful alternatives to synthetic chemicals after studying their insecticidal mechanisms. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  17. Survival and swimming behavior of insecticide-exposed larvae and pupae of the yellow fever mosquito Aedes aegypti

    Science.gov (United States)

    2014-01-01

    Background The yellow fever mosquito Aedes aegypti is essentially a container-inhabiting species that is closely associated with urban areas. This species is a vector of human pathogens, including dengue and yellow fever viruses, and its control is of paramount importance for disease prevention. Insecticide use against mosquito juvenile stages (i.e. larvae and pupae) is growing in importance, particularly due to the ever-growing problems of resistance to adult-targeted insecticides and human safety concerns regarding such use in human dwellings. However, insecticide effects on insects in general and mosquitoes in particular primarily focus on their lethal effects. Thus, sublethal effects of such compounds in mosquito juveniles may have important effects on their environmental prevalence. In this study, we assessed the survival and swimming behavior of A. aegypti 4th instar larvae (L4) and pupae exposed to increasing concentrations of insecticides. We also assessed cell death in the neuromuscular system of juveniles. Methods Third instar larvae of A. aegypti were exposed to different concentrations of azadirachtin, deltamethrin, imidacloprid and spinosad. Insect survival was assessed for 10 days. The distance swam, the resting time and the time spent in slow swimming were assessed in 4th instar larvae (L4) and pupae. Muscular and nervous cells of L4 and pupae exposed to insecticides were marked with the TUNEL reaction. The results from the survival bioassays were subjected to survival analysis while the swimming behavioral data were subjected to analyses of covariance, complemented with a regression analysis. Results All insecticides exhibited concentration-dependent effects on survival of larvae and pupae of the yellow fever mosquito. The pyrethroid deltamethrin was the most toxic insecticide followed by spinosad, imidacloprid, and azadirachtin, which exhibited low potency against the juveniles. All insecticides except azadirachtin reduced L4 swimming speed and

  18. Survival and swimming behavior of insecticide-exposed larvae and pupae of the yellow fever mosquito Aedes aegypti.

    Science.gov (United States)

    Tomé, Hudson Vv; Pascini, Tales V; Dângelo, Rômulo Ac; Guedes, Raul Nc; Martins, Gustavo F

    2014-04-24

    The yellow fever mosquito Aedes aegypti is essentially a container-inhabiting species that is closely associated with urban areas. This species is a vector of human pathogens, including dengue and yellow fever viruses, and its control is of paramount importance for disease prevention. Insecticide use against mosquito juvenile stages (i.e. larvae and pupae) is growing in importance, particularly due to the ever-growing problems of resistance to adult-targeted insecticides and human safety concerns regarding such use in human dwellings. However, insecticide effects on insects in general and mosquitoes in particular primarily focus on their lethal effects. Thus, sublethal effects of such compounds in mosquito juveniles may have important effects on their environmental prevalence. In this study, we assessed the survival and swimming behavior of A. aegypti 4th instar larvae (L4) and pupae exposed to increasing concentrations of insecticides. We also assessed cell death in the neuromuscular system of juveniles. Third instar larvae of A. aegypti were exposed to different concentrations of azadirachtin, deltamethrin, imidacloprid and spinosad. Insect survival was assessed for 10 days. The distance swam, the resting time and the time spent in slow swimming were assessed in 4th instar larvae (L4) and pupae. Muscular and nervous cells of L4 and pupae exposed to insecticides were marked with the TUNEL reaction. The results from the survival bioassays were subjected to survival analysis while the swimming behavioral data were subjected to analyses of covariance, complemented with a regression analysis. All insecticides exhibited concentration-dependent effects on survival of larvae and pupae of the yellow fever mosquito. The pyrethroid deltamethrin was the most toxic insecticide followed by spinosad, imidacloprid, and azadirachtin, which exhibited low potency against the juveniles. All insecticides except azadirachtin reduced L4 swimming speed and wriggling movements. A

  19. Dissipation of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb-insecticides used to control codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae) in apples for production of baby food.

    Science.gov (United States)

    Szpyrka, Ewa; Matyaszek, Aneta; Słowik-Borowiec, Magdalena

    2017-05-01

    Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and nitrogen-phosphorus detection (GC-ECD/NPD) was used for the residue analysis. The analytical performance of the method was satisfactory, with expanded uncertainties ≤36% (a coverage factor, k = 2, and a confidence level of 95%). The dissipations of insecticides were studied in pseudo-first-order kinetic models (for which the coefficient of determination, R 2 , ranged between 0.9188 and 0.9897). Residues of studied insecticides were below their maximum residue limits of 0.5 mg/kg at an early stage of growth of the fruit. The half-lives of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb were 16-17, 4-6 and 20-24 days, respectively. The initial residue levels declined gradually and reached the level of 0.01 mg/kg in 1 month for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb. To obtain the insecticide residue levels below 0.01 mg/kg, which is the default MRL for food intended for infants and young children, the application of the studied insecticides should be carried out at recommended doses not later then: 1 month before harvest for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb.

  20. Insecticide resistance in Blattella germanica (L.)(Dictyoptera: Blattellidae) from food producing establishments in Denmark

    DEFF Research Database (Denmark)

    Jensen, Karl-Martin Vagn

    1993-01-01

    Abstract-A number of cases of Blartella germanica control failure were reported to the Danish Pest Infestation Laboratory from 1987 to 1991. A screening of the insecticide resistance in B. germancia in some selected locations was conducted with permethrin using tarsal contact tests to estimate KT......,(/WHO/VBC/75.593). Based on these data more detailed measurement of the resistance in the German Cockroaches from chosen locations was then assessed by topical application techniques; 2.5 p1 insecticide in acetone on the ventral ...

  1. Effect of leaf extract of Azadirachta indica and plant ash on ...

    African Journals Online (AJOL)

    Seedlings of Vigna unguiculata L. Walp attacked by the pulse beetle, Callosobruchus maculatus were treated with water extracts of fresh leaves of Azadirachta indica A. Juss and plant ash separately. The extract was found to exhibit an insecticidal effect. It has an antifeedant and growth regulating effects on the pulse beetle.

  2. Study the effect of insecticide dimethoate on photosynthetic pigments and photosynthetic activity of pigeon pea: Laser-induced chlorophyll fluorescence spectroscopy.

    Science.gov (United States)

    Pandey, Jitendra Kumar; Dubey, Gunjan; Gopal, R

    2015-10-01

    Pigeon pea is one of the most important legume crops in India and dimethoate is a widely used insecticide in various crop plants. We studied the effect of dimethoate on growth and photosynthetic activity of pigeon pea plants over a short and long term exposure. Plant growth parameters, photosynthetic pigment content and chlorophyll fluorescence response of pigeon pea (Cajanus cajan L.) plants treated with various concentrations of the insecticide dimethoate (10, 20, 40 and 80 ppm) have been compared for 30 days at regular intervals of 10 days each. Laser induced chlorophyll fluorescence spectra and fluorescence-induction kinetics (FIK) curve of dimethoate treated pigeon pea plants were recorded after 10, 20 and 30 days of treatment. Fluorescence intensity ratio at the two fluorescence maxima (F685/F730) was calculated by evaluating curve-fitted parameters. The variable chlorophyll fluorescence decrease ratio (Rfd) was determined from the FIK curves. Our study revealed that after 10 days of treatment, 10 ppm of dimethoate showed stimulatory response whereas 20, 40 and 80 ppm of dimethoate showed inhibitory response for growth and photosynthetic activity of pigeon pea plants, but after 20 and 30 days of treatment all the tested concentrations of dimethoate became inhibitory. This study clearly shows that dimethoate is highly toxic to the pigeon pea plant, even at very low concentration (10 ppm), if used for a prolonged duration. Our study may thus be helpful in determining the optimal dose of dimethoate in agricultural practices. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Partial purification and characterization of {alpha}-amylases from one insecticide-resistant population of Sitophilus zeamais

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, K.V.; Oliveira, M.G.A.; Paixao, G.P.; Visotto, L.E. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Bioquimica e Biologia Molecular; Veloso, R.V.S.; Marinho, J.S.; Guedes, R.N.C. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; Oliveira, J.A. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Quimica

    2008-07-01

    Full text: {alpha}-Amylases (EC 3.2.1.1) constitute a family of endo-amylases that catalyze the hydrolysis of a-D- (1,4)-glucan linkages in st ach components and various other related carbohydrates. They play a central role in carbohydrate metabolism of animals, plants and microorganisms. Many insects, especially those that feed on grain products during larval and/or adult life, depend on their amylases for survival. This is particularly true for the Sitophilus zeamais Motschulsky, a cosmopolitan pest of stored products. It is mainly controlled by insecticides. Amylases from adults of S.zeamais insecticide-resistant were purified by using a sequential procedure of glycogen-complex precipitation and ion exchange chromatography. Specific activity increased from 58,0454 AU/dL/mg protein in the crude homogenate to 2558,8720 AU/dL/mg protein in the final purified sample. Amylase unit (AU/dL) refers to the amount of amylase that hydrolysis 10 mg starch in 30 min at 37 deg C. The purified amylase ran as a single protein band on SDS-PAGE. From a plot of log molecular weight against relative mobility in 10% acrylamide gel, molecular weight was estimated to be 56 kDa. The enzyme had a K{sub m} of 0,2243 g/L for soluble starch and was most active at ph 5,0. The temperature of major activity was 40 deg C. The activity of enzyme was unaffected by presence or absence of Cl{sup -} and Ca{sup 2+}.

  4. Bioefficacy, dissipation kinetics and safety evaluation of selected insecticides in Allium cepa L.

    Science.gov (United States)

    Srinivas P, Satya; Banerjee, Kaushik; Jadhav, Manjusha R; Ghaste, Manoj S; Lawande, K E

    2012-01-01

    This paper reports the bioefficacy of selected insecticides against thrips and their pre-harvest intervals (PHI) in onion pertaining to their recommended application rates and maximum residue limits. Profenophos, methomyl and imidacloprid showed comparatively higher bioefficacy against thrips. GC-MS and LC-MS/MS-based residue analysis methods in onion bulbs and composite matrix of bulbs+leaves were thoroughly validated. The residue data for bulb+leaves was assessed with reference to the EU-MRLs applicable for spring onion. Dimethoate was the most stable chemical with PHI of 52.5 days, followed by monocrotophos (24 days) and carbofuran (20.5 days). The PHIs of profenophos, chlorpyrifos, methomyl and cypermethrin were similar and within the range of 10-13 days. Imidacloprid and λ-cyhalothrin had similar PHI of 4.5 days. Spinosad was the fastest-degrading chemical with PHI of 2 days. The combined bioefficacy and residue dynamics information will support label-claim of these insecticides for the management of thrips in onion, help in scheduling their applications in pest management program as per relative PHIs and minimize the residue accumulations at harvest. The dietary exposure was less than the maximum permissible intake for most of the insecticides on all sampling days except for dimethoate and monocrotophos.

  5. Design, Synthesis, and Insecticidal Activity of Some Novel Diacylhydrazine and Acylhydrazone Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available In this study a series of diacylhydrazine and acylhydrazone derivatives were designed and synthesized according to the method of active group combination and the principles of aromatic group bioisosterism. The structures of the novel derivatives were determined on the basis on 1H-NMR, IR and ESI-MS spectral data. All of the compounds were evaluated for their in vivo insecticidal activity against the third instar larvae of Spodoptera exigua Hiibner, Helicoverpa armigera Hubner, Plutella xyllostella Linnaeus and Pieris rapae Linne, respectively, at a concentration of 10 mg/L. The results showed that all of the derivatives displayed high insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, metaflumizone and tolfenpyrad, and approximately identical insecticidal activity against H. armigera, P. xyllostella and P. rapae as the references metaflumizone and tolfenpyrad.

  6. Efficacy of some synthetic insecticides for control of cotton bollworms ...

    African Journals Online (AJOL)

    ... and Betsulfan at 3.2 l ha-1 recorded the highest and lowest yields, respectively. For effective control of cotton bollworms for maximum yield in the ecology, Thionex applied at 2.8 l ha-1 is recommended. Keywords: Control, cotton bollworms, efficacy, Ghana, synthetic insecticides. African Crop Science Journal, Vol. 20, No.

  7. Cytochrome P450s--Their expression, regulation, and role in insecticide resistance.

    Science.gov (United States)

    Liu, Nannan; Li, Ming; Gong, Youhui; Liu, Feng; Li, Ting

    2015-05-01

    P450s are known to be critical for the detoxification and/or activation of xenobiotics such as drugs and pesticides and overexpression of P450 genes can significantly affect the disposition of xenobiotics in the tissues of organisms, altering their pharmacological/toxicological effects. In insects, P450s play an important role in detoxifying exogenous compounds such as insecticides and plant toxins and their overexpression can result in increased levels of P450 proteins and P450 activities. This has been associated with enhanced metabolic detoxification of insecticides and has been implicated in the development of insecticide resistance in insects. Multiple P450 genes have been found to be co-overexpressed in individual insect species via several constitutive overexpression and induction mechanisms, which in turn are co-responsible for high levels of insecticide resistance. Many studies have also demonstrated that the transcriptional overexpression of P450 genes in resistant insects is regulated by trans and/or cis regulatory genes/factors. Taken together, these earlier findings suggest not only that insecticide resistance is conferred via multi-resistance P450 genes, but also that it is mediated through the interaction of regulatory genes/factors and resistance genes. This chapter reviews our current understanding of how the molecular mechanisms of P450 interaction/gene regulation govern the development of insecticide resistance in insects and our progress along the road to a comprehensive characterization of P450 detoxification-mediated insecticide resistance. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Risk assessment of insecticides used in rice on miridbug, Cyrtorhinus lividipennis Reuter, the important predator of brown planthopper, Nilaparvata lugens (Stal.).

    Science.gov (United States)

    Preetha, G; Stanley, J; Suresh, S; Samiyappan, R

    2010-07-01

    The green miridbug, Cyrtorhinus lividipennis, an important natural enemy of the rice brown planthopper (BPH), Nilaparvata lugens plays a major role as a predator in suppressing the pest population. The study assessed the impact of certain potential insecticides used in the rice ecosystem on the miridbug predator and brown planthopper through contact toxicity. Eleven insecticides, including neonicotinoids, diamides, azomethine pyridines, carbamates, pyrethroids, organophosphates and cyclodienes were selected to test their toxicities against the nymphs of C. lividipennis and N. lugens. Median lethal concentration (LC(50)) was determined for each insecticide using an insecticide-coated vial (scintillation) residue bioassay, which revealed BPMC as the highly toxic chemical with an LC(50) of 0.003mga.iL(-1) followed by ethofenprox and clothianidin with LC(50) of 0.006mga.iL(-1) at 48 HAT against C. lividipennis and ethofenprox as the highly toxic chemical with an LC(50) of 0.009mga.iL(-1) followed by clothianidin with an LC(50) of 0.211mga.iL(-1) at 48h after treatment (HAT) against N. lugens. Among the insecticides tested, the cyclodiene compound, endosulfan had the lowest acute contact toxicity (LC(50)=66.65mga.iL(-1) at 48 HAT) to C. lividipennis. Among the insecticides tested, endosulfan, chlorpyriphos, acephate and methyl parathion are regarded as safer to C. lividipennis based on selectivity ratio, hazard quotient and probit substitution method of risk assessments. 2010 Elsevier Ltd. All rights reserved.

  9. The effect of stereochemistry on the biological activity of natural phytotoxins, fungicides, insecticides and herbicides.

    Science.gov (United States)

    Evidente, Antonio; Cimmino, Alessio; Andolfi, Anna

    2013-02-01

    Phytotoxins are secondary microbial metabolites that play an essential role in the development of disease symptoms induced by fungi on host plants. Although phytotoxins can cause extensive-and in some cases devastating-damage to agricultural crops, they can also represent an important tool to develop natural herbicides when produced by fungi and plants to inhibit the growth and spread of weeds. An alternative strategy to biologically control parasitic plants is based on the use of plant and fungal metabolites, which stimulate seed germination in the absence of the host plant. Nontoxigenic fungi also produce bioactive metabolites with potential fungicide and insecticide activity, and could be applied for crop protection. All these metabolites represent important tools to develop eco-friendly pesticides. This review deals with the relationships between the biological activity of some phytotoxins, seed germination stimulants, fungicides and insecticides, and their stereochemistry. Copyright © 2012 Wiley Periodicals, Inc.

  10. Plant pigments (antioxidants of medicinal plants Malva Sylvestris l. and Malva Moschata l. (Malvaceae

    Directory of Open Access Journals (Sweden)

    Sulejman Redžić

    2005-05-01

    Full Text Available Qualitative-quantitative structure of plant pigments in wild plants Malva silvestrs L. and Malva moschata L. (Malvaceae, which were collected in 20 locations in Sarajevo area and surroundings, was tested during spring and summer in 2003. Acetone extracts of both categories were made and rising paper-chromatography done for the purpose of qualitative analysis. Quantitative analysis was done by spectrophotometry. Chlorophyll a, chlorophyll b and xanthophylls presence was confirmed by separation of pigments from acetone extract of these plant species. Spectrophotometric analysis of acetone extracts showed these results (given in mg/L: chlorophyll a 2,386, chlorophyll b 0,332 and carrotenoides 1,037. Data given in mg/g dry substance are: chlorophyll a 1,193x10(-2, chlorophyll b 1,66x10(-3, and carrotenoides 5,185x10(-3. Pigments structure (in mg/L in species Malva moschata is 1,6 for chlorophyll; 1,419 for chlorophyll b; and 0,364 for carrotenoides. Data given in mg/g are: chlorophyll a 8x10(-3, chlorophyll b 7,09x10(-3, and carrotenoides 1,82x10(-3. Considering that species Malva moschata L. grows on ecologically clear soils as opposed to well-known medicinal species Malvasylvestris L., and considering the production of phytomass, phytochemical structure and pharmacological influence it can be considered very medical and be given advantage over this wider spread category.

  11. Met lure&kill-systeem vliegen motten vanzelf naar het insecticide

    NARCIS (Netherlands)

    Kierkels, T.; Griepink, F.C.

    2008-01-01

    Insecten worden zo sterk aangetrokken door feromonen - seksstoffen - dat je daar bij de bestrijding gebruik van kunt maken. Als het insect naar het insecticide toekomt, hoef je niet areaaldekkend te spuiten. Dat heeft veel voordelen. Plant Research International is al ver met de ontwikkeling van

  12. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  13. Insecticidal and fungicidal compounds from Isatis tinctoria.

    Science.gov (United States)

    Seifert, K; Unger, W

    1994-01-01

    Tryptanthrin (1), indole-3-acetonitrile (2) and p-coumaric acid methylester (3) were isolated from the aerial parts of Isatis tinctoria L. The compounds show insecticidal and anti-feedant activity against termites (Reticulitermis santonensis), insect preventive and control activity against larvae of the house longhorn beetle (Hylotrupes bajulus) and fungicidal activity against the brown-rot fungus (Coniophora puteana).

  14. Wet air oxidation of seedcorn wastes containing pesticides and insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Sievers, M.; Schlaefer, O.; Onyeche, T.I.; Schroeder, C.; Bormann, H.; Schaefer, S. [CUTEC-Inst. GmbH (Clausthal Environment Technology Inst.), Clausthal-Zellerfeld (Germany)

    2003-07-01

    Wet air oxidation as an alternative treatment process to pyrolysis and combustion of seedcorn wastes was investigated in lab-scale experiments. Due to solid condition of the seed corn waste, the process has been adapted by repeated spraying of water on the seed corn bulk to avoid the production of sludge and its subsequent dewatering. Original seed corns from industrial production plants were used for a degradation kinetic study under smooth wet air oxidation conditions. The temperatures were between 80 and 150 C, the pressure from 1 to 4.5 bar and the pH at different values from 3 to 13. Degradation rates for five different compounds of pesticides and insecticides, namely Imidacloprid, Thiram, Hymexazol, Carbofuran and Tefluthrin were conducted. These compounds represent the recently used in agricultural seedcorn applications. The degradation rate depends linearly on temperature between 80 and 150 C. At 120 C the lowest degradation rate was found for Tefluthrin by 25 mg/h per L reaction volume while the highest degradation rate to be conducted was for Imidacloprid at 363 mg/h L. (orig.)

  15. Insecticide resistance monitoring and correlation analysis of insecticides in field populations of the brown planthopper Nilaparvata lugens (stål) in China 2012-2014.

    Science.gov (United States)

    Zhang, Xiaolei; Liao, Xun; Mao, Kaikai; Zhang, Kaixiong; Wan, Hu; Li, Jianhong

    2016-09-01

    The brown planthopper is a serious rice pest in China. Chemical insecticides have been considered a satisfactory means of controlling the brown planthopper. In the present study, we determined the susceptibility of twenty-one populations of Nilaparvata lugens to eleven insecticides by a rice-stem dipping method from 2012 to 2014 in eight provinces of China. These field-collected populations of N. lugens had developed high levels of resistance to imidacloprid (resistant ratio, RR=233.3-2029-fold) and buprofezin (RR=147.0-1222). Furthermore, N. lugens showed moderate to high levels of resistance to thiamethoxam (RR=25.9-159.2) and low to moderate levels of resistance to dinotefuran (RR=6.4-29.1), clothianidin (RR=6.1-33.6), ethiprole (RR=11.5-71.8), isoprocarb (RR=17.1-70.2), and chlorpyrifos (RR=7.4-30.7). In contrast, the susceptibility of N. lugens to etofenprox (RR=1.1-4.9), thiacloprid (RR=2.9-8.2) and acetamiprid (RR=2.7-26.2) remained susceptible to moderate levels of resistance. Significant correlations were detected between the LC50 values of imidacloprid and thiamethoxam, dinotefuran, buprofezin, and etofenprox, as well as between clothianidin and thiamethoxam, dinotefuran, ethiprole, acetamiprid, and thiacloprid. Similarly, significant correlations were observed between chlorpyrifos and etofenprox, acetamiprid and thiacloprid. Additionally, the activity of the detoxification enzymes of N. lugens showed a significant correlation with the log LC50 values of imidacloprid, dinotefuran and ethiprole. These results will be beneficial for effective insecticide resistance management strategies to prevent or delay the development of insecticide resistance. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Genotoxicity evaluation of the insecticide endosulfan in the wetland macrophyte Bidens laevis L

    International Nuclear Information System (INIS)

    Perez, Debora J.; Menone, Mirta L.; Camadro, Elsa L.; Moreno, Victor J.

    2008-01-01

    The frequency of micronuclei (MN) and chromosome aberrations in anaphase-telophase (CAAT) was determined in root tips of the wetland macrophyte Bidens laevis exposed to environmentally relevant concentrations of endosulfan (0.01, 0.02, 0.5 and 5 μg/L) for 48 h. MN frequency varied from 0 in negative controls and plants exposed to 0.01 μg/L endosulfan to 0-3 in plants exposed to 5 μg/L. Moreover, a significant concentration-dependent increase of CAAT was observed. The higher proportion of laggards and vagrand chromosomes observed at 5 μg/L would indicate that endosulfan interacts with the spindle interrupting normal chromosome migration. Endosulfan resulted genotoxic to B. laevis, a species of potential value for bioassays and in situ monitoring of environmental contamination by pesticides. - Endosulfan causes a concentration-dependent increase of chromosome aberrations in the macrophyte Bidens laevis

  17. Laboratory Evaluation of Different Insecticides against Hibiscus Mealybug, Maconellicoccus hirsutus (Hemiptera: Pseudococcidae

    Directory of Open Access Journals (Sweden)

    Samman Fatima

    2016-01-01

    Full Text Available Hibiscus mealybug, Maconellicoccus hirsutus (Hemiptera: Pseudococcidae, is the major pest of many vegetables, fruits, crops, and ornamental plants causing losses to the farmers and its control has been an issue of significance in the pest management. This study was aimed at evaluating different concentrations (0.06%, 0.1%, and 0.14% of Telsta, Advantage, Talstar, Imidacloprid, and their mixtures against hibiscus mealybug in the Laboratory of Systematics and Pest Management at University of Gujrat, Pakistan. The toxic effect was evaluated in the laboratory bioassay after 24 and 48 h of the application of insecticides. The highest mortality (95.83% was shown by Talstar and Talstar + Imidacloprid at the concentration of 0.14% after 48 h followed by Advantage + Talstar with 87.50% mortality at 0.14% concentration after 48 h of application. The study also showed that the least effective treatment observed was Advantage + Telsta with no mortality after 24 h and 25% mortality after 48 h at 0.14% concentration. The study revealed that the concentration 0.14% was highly effective in lowering the mealybug population and insecticide mixtures were effective in reducing mealybug density. The study emphasizes the use of such insecticide mixtures to develop better management strategy for mealybug populations attacking ornamental plants. However effects of such insecticide mixtures on other organisms and biological control agents should be checked under field conditions.

  18. Posttreatment Feeding Affects Mortality of Bed Bugs (Hemiptera: Cimicidae) Exposed to Insecticides.

    Science.gov (United States)

    Singh, Narinderpal; Wang, Changlu; Cooper, Richard

    2016-02-01

    Insecticide sprays and dusts are used for controlling bed bugs, Cimex lectularius L. In natural environments, bed bugs have daily access to hosts after they are exposed to insecticides. The established laboratory insecticide bioassay protocols do not provide feeding after insecticide treatments, which can result in inflated mortality compared with what would be encountered in the field. We evaluated the effect of posttreatment feeding on mortality of bed bugs treated with different insecticides. None of the insecticides tested had a significant effect on the amount of blood consumed and percent feeding. The effect of posttreatment feeding on bed bug mortality varied among different insecticides. Feeding significantly reduced mortality in bed bugs exposed to deltamethrin spray, an essential oil mixture (Bed Bug Fix) spray, and diatomaceous earth dust. Feeding increased the mean survival time for bed bugs treated with chlorfenapyr spray and a spray containing an essential oil mixture (Ecoraider), but did not affect the final mortality. First instars hatched from eggs treated with chlorfenapyr liquid spray had reduced feeding compared with nymphs hatched from nontreated eggs. Those nymphs hatched from eggs treated with chlorfenapyr liquid spray and successfully fed had reduced mortality and a higher mean survival time than those without feeding. We conclude that the availability of a bloodmeal after insecticide exposure has a significant effect on bed bug mortality. Protocols for insecticide efficacy testing should consider offering a bloodmeal to the treated bed bugs within 1 to 3 d after treatment. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

    Science.gov (United States)

    Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

    2018-04-01

    The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

  20. Insecticide resistance and resistance mechanisms in bed bugs, Cimex spp. (Hemiptera: Cimicidae).

    Science.gov (United States)

    Dang, Kai; Doggett, Stephen L; Veera Singham, G; Lee, Chow-Yang

    2017-06-29

    The worldwide resurgence of bed bugs [both Cimex lectularius L. and Cimex hemipterus (F.)] over the past two decades is believed in large part to be due to the development of insecticide resistance. The transcriptomic and genomic studies since 2010, as well as morphological, biochemical and behavioral studies, have helped insecticide resistance research on bed bugs. Multiple resistance mechanisms, including penetration resistance through thickening or remodelling of the cuticle, metabolic resistance by increased activities of detoxification enzymes (e.g. cytochrome P450 monooxygenases and esterases), and knockdown resistance by kdr mutations, have been experimentally identified as conferring insecticide resistance in bed bugs. Other candidate resistance mechanisms, including behavioral resistance, some types of physiological resistance (e.g. increasing activities of esterases by point mutations, glutathione S-transferase, target site insensitivity including altered AChEs, GABA receptor insensitivity and altered nAChRs), symbiont-mediated resistance and other potential, yet undiscovered mechanisms may exist. This article reviews recent studies of resistance mechanisms and the genes governing insecticide resistance, potential candidate resistance mechanisms, and methods of monitoring insecticide resistance in bed bugs. This article provides an insight into the knowledge essential for the development of both insecticide resistance management (IRM) and integrated pest management (IPM) strategies for successful bed bug management.

  1. Spectral Detection of Soybean Aphid (Hemiptera: Aphididae) and Confounding Insecticide Effects in Soybean

    Science.gov (United States)

    Alves, Tavvs Micael

    Soybean aphid, Aphis glycines (Hemiptera: Aphididae) is the primary insect pest of soybean in the northcentral United States. Soybean aphid may cause stunted plants, leaf discoloration, plant death, and decrease soybean yield by 40%. Sampling plans have been developed for supporting soybean aphid management. However, growers' perception about time involved in direct insect counts has been contributing to a lower adoption of traditional pest scouting methods and may be associated with the use of prophylactic insecticide applications in soybean. Remote sensing of plant spectral (light-derived) responses to soybean aphid feeding is a promising alternative to estimate injury without direct insect counts and, thus, increase adoption and efficiency of scouting programs. This research explored the use of remote sensing of soybean reflectance for detection of soybean aphids and showed that foliar insecticides may have implications for subsequent use of soybean spectral reflectance for pest detection. (Abstract shortened by ProQuest.).

  2. Efficient plant regeneration of bittersweet (Solanum dulcamara L., a medicinal plant

    Directory of Open Access Journals (Sweden)

    Arzu Ucar Turker

    2011-01-01

    Full Text Available Solanum dulcamara L. (bittersweet is a medicinal plant that has been used to treat skin diseases, warts, tumors, felons, arthritis, rheumatism, bronchial congestion, heart ailments, ulcerative colitis, eye inflammations, jaundice and pneumonia. A reliable in vitro culture protocol for bittersweet was established. Explants (leaf and petiole segments were cultured on Murashige and Skoog minimal organics (MSMO medium with various plant growth regulator combinations. Leaf explants formed more shoots than petiole explants. Plant regeneration was observed through indirect organogenesis with both explants. Best shoot proliferation was obtained from leaf explants with 3 mg/l BA (benzyladenine and 0.5 mg/l IAA (indole-3-acetic acid. Regenerated shoots were transferred to rooting media containing different levels of IAA (indole-3-acetic acid, IBA (indole-3-butyric acid, NAA (naphthalene acetic acid or 2,4-D (2,4 dichlorophenoxyacetic acid. Most shoots developed roots on medium with 0.5 mg/l IBA. Rooted explants were transferred to vermiculate in Magenta containers for acclimatization and after 2 weeks, they were planted in plastic pots containing potting soil and maintained in the plant growth room.

  3. A new mechanism of macrophyte mitigation: how submerged plants reduce malathion's acute toxicity to aquatic animals.

    Science.gov (United States)

    Brogan, William R; Relyea, Rick A

    2014-08-01

    A growing body of evidence suggests that aquatic plants can mitigate the toxicity of insecticides to sensitive aquatic animals. The current paradigm is that this ability is driven primarily by insecticide sorption to plant tissues, especially for hydrophobic compounds. However, recent work shows that submerged plants can strongly mitigate the toxicity of the relatively hydrophilic insecticide malathion, despite the fact that this compound exhibits a slow sorption rate to plants. To examine this disparity, we tested the hypothesis that the mitigating effect of submerged plants on malathion's toxicity is driven primarily by the increased water pH from plant photosynthesis causing the hydrolysis of malathion, rather than by sorption. To do this, we compared zooplankton (Daphnia magna) survival across five environmentally relevant malathion concentrations (0, 1, 4, 6, or 36 μg L(-1)) in test containers where we chemically manipulated water pH in the absence of plants or added the submerged plant (Elodea canadensis) but manipulated plant photosynthetic activity via shading or no shading. We discovered that malathion was equally lethal to Daphnia at all concentrations tested when photosynthetically inactive (i.e. shaded) plants were present (pH at time of dosing=7.8) or when pH was chemically decreased (pH=7.7). In contrast, when photosynthetically active (i.e. unshaded) plants were present (pH=9.8) or when pH was chemically increased (pH=9.5), the effects of 4 and 6 μg L(-1) of malathion on Daphnia were mitigated strongly and to an equal degree. These results demonstrate that the mitigating effect of submerged plants on malathion's toxicity can be explained entirely by a mechanism of photosynthesizing plants causing an increase in water pH, resulting in rapid malathion hydrolysis. Our findings suggest that current ecotoxicological models and phytoremediation strategies may be overlooking a critical mechanism for mitigating pesticides. Copyright © 2014 Elsevier Ltd

  4. Reduced ultraviolet light transmission increases insecticide longevity in protected culture raspberry production.

    Science.gov (United States)

    Leach, Heather; Wise, John C; Isaacs, Rufus

    2017-12-01

    High tunnels are large protective structures used for season extension of many crops, including raspberries. These structures are often covered in plastic films to reduce and diffuse ultraviolet light transmission for pest and disease control, but this may also affect the photodegradation and efficacy of pesticides applied under these tunnels. We compared the residue levels of ten insecticides under three tunnel plastics with varying levels of UV transmission and open field conditions. Raspberry plants placed in research-scale tunnels were treated with insecticides and residues on fruit and foliage were monitored for one or two weeks in early 2015 and early and late 2016. Plastics that reduce UV transmission resulted in 50% greater residues of some insecticides compared to transparent plastics, and 60% compared to uncovered tunnels. This increased persistence of residues was evident within 1 day and remained consistently higher for up to 14 days. This pattern was demonstrated for multiple insecticides, including bifenthrin, esfenvalerate, imidacloprid, thiamethoxam, and spinosad. In contrast, the insecticide malathion degraded rapidly regardless of the plastic treatment, indicating less sensitivity to photodegradation. Bioassays using insecticide-treated leaves that were under UV-blocking plastic revealed higher mortality of the invasive fruit pest, Drosophila suzukii, compared to leaves that were uncovered. This indicates that the activity of pesticides under high tunnels covered in UV-reducing plastics may be prolonged, allowing for fewer insecticide applications and longer intervals between sprays. This information can be used to help optimize pest control in protected culture berry production. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Effects of the botanical compound p-anisaldehyde on horn fly, Haematobia irritans irritans (L.) (Diptera: Muscidae) repellency, mortality, and reproduction

    Science.gov (United States)

    The horn fly, Haematobia irritans irritans (L.), is an economically important obligate blood-feeding ectoparasite that mainly attacks cattle worldwide. As resistance to conventional insecticides increases, alternative control tactics are being investigated. p-Anisaldehyde occurs in many plants and i...

  6. Insecticide Activity of Ageratina jahnii and Ageratina pichinchensis (Asteraceae against Lutzomyia migonei (Diptera: Psychodidae

    Directory of Open Access Journals (Sweden)

    Lizzeth Torres

    2017-01-01

    Full Text Available Background: Insects are mostly pathogens transmitters, thus the necessity of finding effective bioinsecticides to combat them. In the present investigation, the insecticide activity of Ageratina jahnii and Ageratina pichinchensis (Asteraceae essential oils, methanol, and aqueous extracts was evaluated against Lutzomyia migonei (Diptera: Psychodidae females, Leishmania transmitters, a wide distributed parasitosis in Latin America. Materials and Methods: All extracts were prepared by maceration at room temperature, and essential oils were obtained by hydrodistillation process. Females of L. migonei were used in the bioassays using the adulticide test in pots. Results: Essential oils from both assayed plant species showed 100% of L. migonei mortality at 48 h of exposure at the concentration of 10 mg/ml. A. jahnii essential oil exhibited the following values, LD50 = 0.39 mg/ml, LD90 = 1.57 mg/ml, LD95 = 2.31 mg/ml, and LD99 = 4.80 mg/ml while for A. pichinchensis essential oil values were LD50 = 0.31 mg/ml, LD90 = 0.99 mg/ml, LD95 = 1.38 mg/ml, and LD99 = 2.55 mg/ml. Conclusion: Higher toxicity was observed with A. pichinchensis essential oil against L. migonei, comparing to A. jahnii oil. Two new plant species are being reported, showing bioactive properties against common tropical disease vectors such as L. migonei, hence, opening possibilities to a more environmental friendly control.

  7. Insecticide Activity of Ageratina jahnii and Ageratina pichinchensis (Asteraceae) against Lutzomyia migonei (Diptera: Psychodidae).

    Science.gov (United States)

    Torres, Lizzeth; Rojas, Janne; Rondón, Maritza; Morales, Antonio; Nieves, Elsa

    2017-01-01

    Insects are mostly pathogens transmitters, thus the necessity of finding effective bioinsecticides to combat them. In the present investigation, the insecticide activity of Ageratina jahnii and Ageratina pichinchensis (Asteraceae) essential oils, methanol, and aqueous extracts was evaluated against Lutzomyia migonei (Diptera: Psychodidae) females, Leishmania transmitters, a wide distributed parasitosis in Latin America. All extracts were prepared by maceration at room temperature, and essential oils were obtained by hydrodistillation process. Females of L. migonei were used in the bioassays using the adulticide test in pots. Essential oils from both assayed plant species showed 100% of L. migonei mortality at 48 h of exposure at the concentration of 10 mg/ml. A. jahnii essential oil exhibited the following values, LD 50 = 0.39 mg/ml, LD 90 = 1.57 mg/ml, LD 95 = 2.31 mg/ml, and LD 99 = 4.80 mg/ml while for A. pichinchensis essential oil values were LD 50 = 0.31 mg/ml, LD 90 = 0.99 mg/ml, LD 95 = 1.38 mg/ml, and LD 99 = 2.55 mg/ml. Higher toxicity was observed with A. pichinchensis essential oil against L. migonei , comparing to A. jahnii oil. Two new plant species are being reported, showing bioactive properties against common tropical disease vectors such as L. migonei , hence, opening possibilities to a more environmental friendly control.

  8. The insecticide fipronil and its metabolite fipronil sulphone inhibit the rat α1β2γ2L GABAA receptor

    Science.gov (United States)

    Li, P; Akk, G

    2008-01-01

    Background and purpose: Fipronil is the active ingredient in a number of widely used insecticides. Human exposure to fipronil leads to symptoms (headache, nausea and seizures) typically associated with the antagonism of GABAA receptors in the brain. In this study, we have examined the modulation of the common brain GABAA receptor subtype by fipronil and its major metabolite, fipronil sulphone. Experimental approach: Whole-cell and single-channel recordings were made from HEK 293 cells transiently expressing rat α1β2γ2L GABAA receptors. Key results: The major effect of fipronil was to increase the rate of current decay in macroscopic recordings. In single-channel recordings, the presence of fipronil resulted in shorter cluster durations without affecting the intracluster open and closed time distributions or the single-channel conductance. The α1V256S mutation, previously shown alleviate channel inhibition by inhibitory steroids and several insecticides, had a relatively small effect on channel block by fipronil. The mode of action of fipronil sulphone was similar to that of its parent compound but the metabolite was less potent at inhibiting the α1β2γ2L receptor. Conclusions and implications: We conclude that exposure to fipronil induces accumulation of receptors in a novel, long-lived blocked state. This process proceeds in parallel with and independently of, channel desensitization. The lower potency of fipronil sulphone indicates that the conversion serves as a detoxifying process in mammalian brain. PMID:18660823

  9. Insecticide use and practices among cotton farmers in northern ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...

  10. Réduction des doses efficaces d'insecticides contre les larves de criquet pèlerin (Schistocerca gregaria Forskål, 1775 : Orthoptera, Acrididae par utilisation de quantités réduites de phénylacétonitrile

    Directory of Open Access Journals (Sweden)

    Bocar Bal, A.

    2013-01-01

    Full Text Available Reduction of effective doses of insecticide against desert locust (Schistocerca gregaria Forskål, 1775: Orthoptera, Acrididae nymphs using phenylacetonitrile. In order to reduce the amount of insecticides used during a locust upsurge, phenylacetonitrile (PAN was tested in 2007 and 2008, in the Niamey area (Niger. PAN was used, on the one hand, in topical applications on third stage nymphs (L3 of the desert locust, alone or in combination with reduced amounts of various insecticides (lambda-cyhalothrin, malathion, chlorpyrifos-ethyl. In addition, experiments were carried out in semi-natural conditions, in field enclosures, and also on third stage nymphs of the desert locust. Insecticides were each applied at the recommended dose and at half of that dose with the addition or not of phenylacetonitrile. All topical applications of insecticides led to the total mortality of the nymphs within 1 to 24 h; the use of PAN alone caused a mortality rate of no higher than 18% within 120 h. In the field enclosures, mortality rates for the desert locust nymphs were the same both with the recommended doses and with half of the dose with the addition of 10 ml of PAN·ha-1. Results indicate that the addition of small quantities of phenylacetonitrile could make it possible to decrease by half the quantities of insecticides used in the control of desert locust nymphs, while preserving the same effectiveness.

  11. Studies .on the efficacy of some biorational insecticides against the ...

    African Journals Online (AJOL)

    W. Tin znara*, C. Na11kinga, l Kashaija & W. Tu.vhemereirwe ... Biorat!onal insecticides obtained from tobacco, ash, urine, pepper and a concoction (mixture) were ... Cultural control ... single components were made by adding I 00 ml of tap.

  12. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  13. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    Experiments were carried out to evaluate the effect of water extracts of Fagonia arabica, Salix alba and Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of. Hyalopterus pruni and characters of Armeniaca vulgaris plants and their soils. The data revealed that F.arabica extract at 20% ...

  14. Insecticide resistance and intracellular proteases.

    Science.gov (United States)

    Wilkins, Richard M

    2017-12-01

    Pesticide resistance is an example of evolution in action with mechanisms of resistance arising from mutations or increased expression of intrinsic genes. Intracellular proteases have a key role in maintaining healthy cells and in responding to stressors such as pesticides. Insecticide-resistant insects have constitutively elevated intracellular protease activity compared to corresponding susceptible strains. This increase was shown for some cases originally through biochemical enzyme studies and subsequently putatively by transcriptomics and proteomics methods. Upregulation and expression of proteases have been characterised in resistant strains of some insect species, including mosquitoes. This increase in proteolysis results in more degradation products (amino acids) of intracellular proteins. These may be utilised in the resistant strain to better protect the cell from stress. There are changes in insect intracellular proteases shortly after insecticide exposure, suggesting a role in stress response. The use of protease and proteasome inhibitors or peptide mimetics as synergists with improved application techniques and through protease gene knockdown using RNA interference (possibly expressed in crop plants) may be potential pest management strategies, in situations where elevated intracellular proteases are relevant. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  15. Investigation of insecticide-resistance status of Cydia pomonella in Chinese populations.

    Science.gov (United States)

    Yang, X-Q; Zhang, Y-L

    2015-06-01

    The codling moth Cydia pomonella (L.) is an economically important fruit pest and it has been directly targeted by insecticides worldwide. Serious resistance to insecticides has been reported in many countries. As one of the most serious invasive pest, the codling moth has populated several areas in China. However, resistance to insecticides has not been reported in China. We investigated the insecticide-resistance status of four field populations from Northwestern China by applying bioassays, enzyme activities, and mutation detections. Diagnostic concentrations of lambda-cyhalothrin, chlorpyrifos-ethyl, carbaryl, and imidacloprid were determined and used in bioassays. Field populations were less susceptible to chlorpyrifos-ethyl and carbaryl than laboratory strain. Insensitive populations displayed an elevated glutathione S-transferases (GSTs) activity. Reduced carboxylesterase (CarE) activity was observed in some insecticide insensitive populations and reduced acetylcholinesterase activity was observed only in the Wuw population. The cytochrome P450 polysubstrate monooxygenases activities in four field populations were not found to be different from susceptible strains. Neither the known-resistance mutation F399V in the acetylcholinesterase (AChE) gene, ace1, nor mutations in CarE gene CpCE-1 were found in adult individuals from our field populations. Native-PAGE revealed that various CarE isozymes and AChE insensitivity were occurring among Chinese populations. Our results indicate that codling moth populations from Northwestern China were insensitivity to chlorpyrifos-ethyl and carbaryl. Increased GST activity was responsible for insecticides insensitivity. Decreased CarE activity, as well as the presence of CarE and AChE polymorphisms might also be involved in insecticides insensitivity. New management strategies for managing this pest are discussed.

  16. Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

    Science.gov (United States)

    Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

    2015-06-01

    Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Musca domestica laboratory susceptibility to three ethnobotanical culinary plants.

    Science.gov (United States)

    El Zayyat, Elham A; Soliman, Mohammed I; Elleboudy, Noha A; Ofaa, Shaimaa E

    2015-10-01

    Throughout history, synanthropic Musca domestica had remained a worldwide problem whenever poor sanitation and bad hygienic conditions exists. Houseflies growing resistance to chemical insecticides are a rising environmental problem that necessitates search for alternatives. Mentha cervina, Ocimum basilicum, and Coriandrum sativum were tested for bioactivity on M. domestica adults and larvae. They are culinary Mediterranean plants. In adulticidal bioassay, using both CDC bottles and fumigation techniques, basil was the most effective extract with LC50 1.074 and 34.996 g/L, respectively. Concerning larvicidal bioassay by fumigation technique, coriander had the highest toxicity index with LC50 29.521 g/L. In both dipping and feeding technique, basil had the highest toxicity with LC50 32.643 and 0.749 g/L, respectively. Basil showed the highest toxicity results in four out of the five models tested followed by coriander then mint; this result highlights the potentiality of basil as a green insecticide in management of flies and opens new insight in the industrialization of basil-based fly control products.

  18. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Matowo Pc

    91.5% (n=483) and An. funestus group was 8.5% (n=45). ..... Chitnis, N., Churcher, T., Donnelly, M.J., Ghani, A.C., Godfray, H.C.J., Gould, F., Hastings, ... Efficacy, persistence and vector susceptibility to pirimiphos-methyl (Actellic® 300CS) insecticide ... Macoris, M.L., Andrighetti, M.T.M., Wanderley, D.M.V. & Ribolla, P.E.M. ...

  19. Optimizing Conservation Strategies for a Threatened Tree Species: In Situ Conservation of White Ash (Fraxinus americana L. Genetic Diversity through Insecticide Treatment

    Directory of Open Access Journals (Sweden)

    Charles E. Flower

    2018-04-01

    Full Text Available Forest resources face numerous threats that require costly management. Hence, there is an increasing need for data-informed strategies to guide conservation practices. The introduction of the emerald ash borer to North America has caused rapid declines in ash populations (Fraxinus spp. L.. Natural resource managers are faced with a choice of either allowing ash trees to die, risking forest degradation and reduced functional resilience, or investing in conserving trees to preserve ecosystem structure and standing genetic diversity. The information needed to guide these decisions is not always readily available. Therefore, to address this concern, we used eight microsatellites to genotype 352 white ash trees (Fraxinus americana L. across 17 populations in the Allegheny National Forest; a subset of individuals sampled are part of an insecticide treatment regimen. Genetic diversity (number of alleles and He was equivalent in treated and untreated trees, with little evidence of differentiation or inbreeding, suggesting current insecticidal treatment is conserving local, neutral genetic diversity. Using simulations, we demonstrated that best practice is treating more populations rather than more trees in fewer populations. Furthermore, through genetic screening, conservation practitioners can select highly diverse and unique populations to maximize diversity and reduce expenditures (by up to 21%. These findings will help practitioners develop cost-effective strategies to conserve genetic diversity.

  20. Environmental risk assessment of registered insecticides in Iran using Environmental Impact Quotient (EIQ index

    Directory of Open Access Journals (Sweden)

    S. Moinoddini

    2016-05-01

    Full Text Available In the last decades, pesticides have been used extensively, in order to control pests and plant diseases, but negative impacts of pesticides caused several environmental problems and put human health in danger. In order to decrease environmental hazards of pesticide, risk of pesticide application should be measured briefly and precisely. In this study environmental impacts of registered insecticides in Iran which applied in 2001-2002, 2003-2004, 2004-2005, are considered using environmental impact quotient (EIQ index. Results showed that among considered insecticides, Imidacloprid, Fipronil and Tiodicarb, potentially (EIQ were the most hazardous insecticides, respectively. Taking rate of application and active ingredient of insecticide in to account, environmental impact (practical toxicity per cultivated hectare (EIQ Field of each provinces were investigated. In this regard, among different province of Iran, Kerman, Mazandaran and Golestan were in danger more than the others, respectively. Besides, considering the amount of agricultural production in provinces, environmental impact per ton of production were calculated for each provinces which three northern provinces of Mazandaran, Golestan and Guilan, respectively endure the most environmental impact per ton of production. Eventually based on environmental impact quotient, results demonstrated that majority of environmental impacts of insecticide in Iran were due to inadequate knowledge and also overuse of a few number of insecticides. Therefore, by improving knowledge about environmental impact of pesticides and also developing environmental friendly and ecological based methods, negative environmental impacts of insecticides will be reduced significantly.

  1. Survival and behavioural responses of the predatory ladybird beetle, Eriopis connexa populations susceptible and resistant to a pyrethroid insecticide.

    Science.gov (United States)

    Spíndola, A F; Silva-Torres, C S A; Rodrigues, A R S; Torres, J B

    2013-08-01

    The ladybird beetle, Eriopis connexa (Germar) (Coleoptera: Coccinellidae), is one of the commonest predators of aphids (Hemiptera: Aphididae) in the cotton agroecosystem and in many other row and fruit crops in Brazil, and has been introduced into other countries such as the USA for purposes of aphid control. In addition, the boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae) is the most serious cotton pest where it occurs, including Brazil. Controlling boll weevils and other pests such as cotton defoliators still tends to involve the intense application of insecticides to secure cotton production. The pyrethroid insecticide lambda-cyhalothrin (LCT) is commonly used, but this compound is not effective against aphids; hence, a desirable strategy would be to maintain E. connexa populations in cotton fields where LCT is applied. Using populations of E. connexa resistant (Res) and susceptible (Sus) to LCT, we compared behavioural responses on treated cotton plants and under confinement on partially and fully treated surfaces, and assessed the insects' survival on treated plants compared with that of the boll weevil. The E. connexa resistant population caged on treated plants with 15 and 75 g a.i. ha-1 exhibited ≫82% survival for both insecticide concentrations compared with ≪3% and ≪17% survival for susceptible E. connexa populations and boll weevils, respectively. The response of E. connexa Res and Sus populations when released, either on the soil or on the plant canopy, indicated avoidance towards treated plants, as measured by elapsed time to assess the plant. When compared with susceptible individuals, resistant ones took longer time to suffer insecticide knockdown, had a higher recovery rate after suffering knockdown, and spent more time in the plant canopy. Based on behavioural parameters evaluated in treated arenas, no ladybird beetles exhibited repellency. However, irritability was evident, with the susceptible population exhibiting

  2. The insecticide fipronil and its metabolite fipronil sulphone inhibit the rat alpha1beta2gamma2L GABA(A) receptor.

    Science.gov (United States)

    Li, P; Akk, G

    2008-11-01

    Fipronil is the active ingredient in a number of widely used insecticides. Human exposure to fipronil leads to symptoms (headache, nausea and seizures) typically associated with the antagonism of GABA(A) receptors in the brain. In this study, we have examined the modulation of the common brain GABA(A) receptor subtype by fipronil and its major metabolite, fipronil sulphone. Whole-cell and single-channel recordings were made from HEK 293 cells transiently expressing rat alpha1beta2gamma2L GABA(A) receptors. The major effect of fipronil was to increase the rate of current decay in macroscopic recordings. In single-channel recordings, the presence of fipronil resulted in shorter cluster durations without affecting the intracluster open and closed time distributions or the single-channel conductance. The alpha1V256S mutation, previously shown alleviate channel inhibition by inhibitory steroids and several insecticides, had a relatively small effect on channel block by fipronil. The mode of action of fipronil sulphone was similar to that of its parent compound but the metabolite was less potent at inhibiting the alpha1beta2gamma2L receptor. We conclude that exposure to fipronil induces accumulation of receptors in a novel, long-lived blocked state. This process proceeds in parallel with and independently of, channel desensitization. The lower potency of fipronil sulphone indicates that the conversion serves as a detoxifying process in mammalian brain.

  3. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  4. THE ACTION OF CORAGEN INSECTICIDE ON CERTAIN PHYSIOLOGICAL BIOMARKERS ON CARASSIUS AURATUS GIBELIO BLOCH L. 1758

    Directory of Open Access Journals (Sweden)

    Claudiu Alexandru Baciu

    2015-12-01

    Full Text Available In our researches we have determined the variation of certain physiological indexes, such as the oxygen consume, the breathing rhythm, the glycaemia and the number of red blood cells under the action of Coragen insecticide on Carassius auratus gibelio Bloch. Under the action of Coragen, we have registered significant changes in the oxygen consume, the breathing rhythm, the number of red blood cells and glycemia at the Carassius auratus gibelio Bloch items, considered as answers to the stress provoked by emissions. The highest variations of the physiological indexes, from the perspective of the percentage, were noticed at the glycemia, which at the mark was 28 mg/dl, and in the treated sample, with 0.1 ml/l Coragen is 42 mg/dl, representing a 50% growth and at the breathing rhythm in 24 hours, where values significantly decreased with 41.18% at the concentration of 0.07 ml/l and with 39.33% at the concentrations of 0.05 and 0.1 ml/l Coragen. The slightest variations of the physiological indexes, from the perspective of percentage, were noticed at the oxygen consumption, which, at the mark is of 55.302 ml oxygen/kg/hour, and for the treated sample, with 0.1 ml/l Coragen is 34.81 ml oxygen/kg/hour, representing a decrease of 37.06% in 24 hours and the number of red blood cells, where the values have significantly decrease with 9.58%, 13.48%, respectively 18.44% for the concentrations of 0.05, 0.07 and 0.1 ml/l Coragen.

  5. Plant Growth Modeling Using L-System Approach and Its Visualization

    Directory of Open Access Journals (Sweden)

    Atris Suyantohadi

    2011-05-01

    Full Text Available The visualizationof plant growth modeling using computer simulation has rarely been conducted with Lindenmayer System (L-System approach. L-System generally has been used as framework for improving and designing realistic modeling on plant growth. It is one kind of tools for representing plant growth based on grammar sintax and mathematic formulation. This research aimed to design modeling and visualizing plant growth structure generated using L-System. The environment on modeling design used three dimension graphic on standart OpenGL format. The visualization on system design has been developed by some of L-System grammar, and the output graphic on three dimension reflected on plant growth as a virtual plant growth system. Using some of samples on grammar L-System rules for describing of the charaterictics of plant growth, the visualization of structure on plant growth has been resulted and demonstrated.

  6. Setting the record straight: a rebuttal to an erroneous analysis on transgenic insecticidal crops and natural enemies

    Czech Academy of Sciences Publication Activity Database

    Shelton, A. M.; Naranjo, S. E.; Romeis, J.; Hellmich, R. L.; Wolt, J. D.; Federici, B. A.; Albajes, R.; Bigler, F.; Burgess, E. P. J.; Dively, G. P.; Gatehouse, A. M. R.; Malone, L. A.; Roush, R.; Sears, M.; Sehnal, František

    2009-01-01

    Roč. 18, č. 3 (2009), s. 317-322 ISSN 0962-8819 Institutional research plan: CEZ:AV0Z50070508 Keywords : transgenic insecticidal crops Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 2.467, year: 2009

  7. Flupyradifurone: a brief profile of a new butenolide insecticide

    Science.gov (United States)

    Nauen, Ralf; Jeschke, Peter; Velten, Robert; Beck, Michael E; Ebbinghaus-Kintscher, Ulrich; Thielert, Wolfgang; Wölfel, Katharina; Haas, Matthias; Kunz, Klaus; Raupach, Georg

    2015-01-01

    BACKGROUND The development and commercialisation of new chemical classes of insecticides for efficient crop protection measures against destructive invertebrate pests is of utmost importance to overcome resistance issues and to secure sustainable crop yields. Flupyradifurone introduced here is the first representative of the novel butenolide class of insecticides active against various sucking pests and showing an excellent safety profile. RESULTS The discovery of flupyradifurone was inspired by the butenolide scaffold in naturally occurring stemofoline. Flupyradifurone acts reversibly as an agonist on insect nicotinic acetylcholine receptors but is structurally different from known agonists, as shown by chemical similarity analysis. It shows a fast action on a broad range of sucking pests, as demonstrated in laboratory bioassays, and exhibits excellent field efficacy on a number of crops with different application methods, including foliar, soil, seed treatment and drip irrigation. It is readily taken up by plants and translocated in the xylem, as demonstrated by phosphor imaging analysis. Flupyradifurone is active on resistant pests, including cotton whiteflies, and is not metabolised by recombinantly expressed CYP6CM1, a cytochrome P450 conferring metabolic resistance to neonicotinoids and pymetrozine. CONCLUSION The novel butenolide insecticide flupyradifurone shows unique properties and will become a new tool for integrated pest management around the globe, as demonstrated by its insecticidal, ecotoxicological and safety profile. © 2014 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:25351824

  8. Efficacy of the organic-certified insecticide Diatect II against the boll weevil (Anthonomus grandis) in cotton.

    Science.gov (United States)

    Sappington, Thomas W

    2002-10-01

    The efficacy of the organic insecticide Diatect II against boll weevil (Anthonomus grandis Boheman) in cotton (Gossypium hirsutum L) in the Lower Rio Grande Valley of Texas were assessed in small-plot field trials and greenhouse cage tests using azinphos-methyl treatments as a standard for comparison. Plastic sheets were placed in the furrows of the treated plots to retrieve boll weevils which dropped from the plants after being killed by the insecticides. Samples of live weevils taken by a tractor-mounted vacuum sampler revealed a modest, but significant, reduction in boll weevil populations in Diatect II plots. However, samples of dead weevils indicated that this reduction was due to movement of weevils out of the plots rather than to mortality. This interpretation is supported by greenhouse cage studies, where mortality in Diatect II treated cages was no greater than that in untreated control cages. The effects of insecticide treatments in small plots can be confounded easily and quickly by interplot movement of target insects. Although the relative effects of various compounds can usually be assessed by sampling the populations in plots soon after treatment, the best measure of efficacy is obtained by directly sampling insects that have died in the plot. This parameter is insulated from the effects of interplot movement, unless the toxicant is slow to immobilize the target insect. Taken together, our results indicate little efficacy by Diatect II against boll weevil under our test conditions.

  9. Studying, the Insecticidal Effects of Melia azedarach and Citrus limonum Extracts on Two Aphid Species

    Directory of Open Access Journals (Sweden)

    maryam Pahlavan Yali

    2018-01-01

    Full Text Available Introduction: Wheat (Triticum aestivum L. is the most principal plant food for 35 percent of the world's population, and canola (Brassica napus L. is one of the most important brassicaceous crops that play a major role in the development of edible oil. The greenbug, Schizaphis graminum (Rondani and cabbage aphid, Brevicoryne brassicae (L. are the main pests of wheat and canola, respectively, which can considerably limit profitable production of these crops either through direct feeding or via transmission of plant pathogenic viruses. Although chemical control is the most effective and easiest way to control aphids, but this method causes problems such as pesticide residues in food and environment, and development of resistance to insecticides. The utilization of plant extracts is an environmentally safe method that can be used in control of these aphids. Among these, the products of the Melia seed (Melia azedarach Linnaeus and lemon peel (Citrus limonum Risso can be noted. Negative associations between phenolic compounds present in plant species and aphid’s invasion have been recorded for some aphid species. In this study, our goal was to determine the amount of phenol in plant extracts of Melia seed and lemon peel and evaluate the toxicity of these compounds on the wheat aphid and cabbage aphid in various doses after different time periods. Materials and methods: This research was conducted in a growth chamber (temperature 25 ± 1˚C, 65± 5% RH and a photoperiod of 16L: 8D. S. graminum and B. brassicae were bred on wheat (Pishtaz cultivar and canola (Hyola401 cultivar, respectively. The extraction of Melia seed and lemon peel was carried out and then contact toxicity bioassay was done to evaluate the insecticidal effects of these extracts on nymphs of wheat and cabbage aphids using a completely randomized design. The leaves of wheat and canola plants, impregnated with three different concentrations of each extract (10, 50 and 80 g/ml and

  10. Potential of plant materials for the management of cowpea bruchid callosobruchus analis (coleoptera: bruchidae) in gram cicer arietinum during storage

    International Nuclear Information System (INIS)

    Sarwar, M.; Ahmad, N.; Tofique, M.

    2012-01-01

    Present research was carried out to identify alternatives to synthetic insecticides to control cowpea weevil Callosobruchus analis (F.) population in gram seed (Cicer arietinum L.), during storage. The efficacies of three plant materials such as Nicotiana tabacum, Citrullus colocythis and Aloe vera were assessed to determine their insecticidal activities against survival of bruchid C. analis on seeds of gram varieties viz., CM-98 and Jubiha-1. These plant materials tested reduced weevil infestation and emergence as compared with untreated control seeds. Seeds treatment with A. vera followed by N. tabacum reduced maximum pest damage over C. colocythis, which proved least effective to control C. analis population. Consequently, the tested plant materials should be given due consideration for effective gram protection as a component of integrated pest management approach in storage. (author)

  11. Efficacy of eco-smart insecticides against certain biological stages of jasmine moth, Palpita unionalis Hb.(Lepidoptera: Pyralidae

    Directory of Open Access Journals (Sweden)

    Mahmoud Farag Mahmoud

    2014-03-01

    Full Text Available The efficacy of six eco-smart insecticides, Dipel 2x 6.4% WP (Bacillus thuringensis AI, Biofly 100% WP (Beauvaria bessiana AI, Radiant 12% SC (Saccharopolyspora spinosa AI, Mectin 1.8% EC (Streptomyces avermitilis AI, Nimbecidine 0.03% EC (Azadirachtin AI and Bio-Power 50% EC (Beauvaria bessiana AI, were tested against eggs, larvae and pupae of the jasmine moth, Palpita unionalis Hb. and its parasitoid Apanteles syleptae under laboratory conditions. Data indicated that all tested insecticides had ovicidal activity against P. unionalis. Mectin was the most toxic among the tested insecticides against the egg stage, followed by Radiant or Dipel 2x, and their respective values of LC50 were 0.005 cm/l, 0.006 cm/l and 0.055 g/l. Dipel 2x was the most toxic insecticide to the 1st instar larvae of P. unionalis, whereas Mectin was the most toxic to both the 3rd and 5th instar larvae. Also, the results revealed that Mectin was the most effective against the pupal stage, followed descendingly by Radiant and Dipel 2x. The toxicity index values showed a superior efficiency of Mectin at LC50 (100% against eggs, 3rd and 5th instar larvae, and pupal stage, whereas Dipel 2x showed such superior efficiency at LC50 (100% only against 1st instar larvae. The results showed that the percents of pupation and emergence of moths were significantly different in all treatments compared to control, while deformed pupae and malformed adults were insignificantly different when fifth instar larvae were treated with the tested insecticides. Moreover, the rate of P. unionalis adult emergence from treated pupae was concentration-dependent and significant differences were found between insecticide treatments and control. Generally, Mectin, Radiant and Dipel 2x caused the highest impacts on adult emergence and malformed adults percentages. Regarding the toxicity of insecticides to the endoparasitoid A. syleptae, the treated cocoons developed to adult stages with no significant

  12. Evaluation of systemic neonicotinoid insecticides for the management of the Asian citrus psyllid Diaphorina citri on containerized citrus.

    Science.gov (United States)

    Byrne, Frank J; Daugherty, Matthew P; Grafton-Cardwell, Elizabeth E; Bethke, James A; Morse, Joseph G

    2017-03-01

    Studies were conducted to evaluate uptake and retention of three systemic neonicotinoid insecticides, dinotefuran, imidacloprid and thiamethoxam, in potted citrus nursery plants treated at standard label rates. Infestation of these plants placed at a field site with moderate levels of Asian citrus psyllid (ACP) was monitored for 14 weeks following treatments, and insecticide residues in leaf tissue were quantified using enzyme-linked immunosorbent assay (ELISA). Bioassays were conducted using leaves harvested on various dates post-treatment to compare the efficacies of residues against adult ACP. Residues of the three neonicotinoids were detected in leaf tissues within 1 week after treatment. Peak concentrations established at 1 week for imidacloprid and dinotefuran and at 2 weeks for thiamethoxam. Imidacloprid and thiamethoxam outperformed the control and dinotefuran treatments at protecting trees from infestations by ACP eggs and nymphs. For a given insecticide concentration in leaf tissue, thiamethoxam induced the highest mortality of the three insecticides, and dinotefuran was the least toxic. If the time needed to achieve effective thresholds of a systemic neonicotinoid is known, treatments at production facilities could be scheduled that would minimize unnecessary post-treatment holding periods and ensure maximum retention of effective concentrations after the plants have shipped to retail outlets. The rapid uptake of the insecticides and retention at effective concentrations in containerized citrus suggest that the current 30 day post-treatment shipping restriction from production facilities to retail outlets outside of quarantine could be shortened to 14 days. Thiamethoxam should be added to the list of approved nursery treatments. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  13. Insecticide resistance in Anopheles gambiae from south-western Chad, Central Africa

    Directory of Open Access Journals (Sweden)

    Etang Josiane

    2008-09-01

    Full Text Available Abstract Background Indoor residual spraying and insecticide-treated nets (ITN are essential components of malaria vector control in Africa. Pyrethroids are the only recommended compounds for nets treatment because they are fast-acting insecticides with low mammalian toxicity. However, there is growing concern that pyrethroid resistance may threaten the sustainability of ITN scaling-up programmes. Here, insecticide susceptibility was investigated in Anopheles gambiae sensu lato from an area of large scale ITN distribution programme in south-western Chad. Methods Susceptibility to 4% DDT, 0.05% deltamethrin, 0.75% permethrin, 0.1% bendiocarb and 5% malathion was assessed using the WHO standard procedures for adult mosquitoes. Tests were carried out with two to four days-old, non-engorged female mosquitoes. The An. gambiae Kisumu strain was used as a reference. Knockdown effect was recorded every 5 min and mortality scored 24 h after exposure. Mosquitoes were identified to species and molecular form by PCR-RFLP and genotypes at the kdr locus were determined in surviving specimens by Hot Oligonucleotide Ligation Assay (HOLA. Results During this survey, full susceptibility to malathion was recorded in all samples. Reduced susceptibility to bendiocarb (mortality rate of 96.1% was found in one sample out of nine assayed. Increased tolerance to pyrethroids was detected in most samples (8/9 with mortality rates ranging from 70.2 to 96.6% for deltamethrin and from 26.7 to 96.3% for permethrin. Pyrethroid tolerance was not associated with a significant increase of knock-down times. Anopheles arabiensis was the predominant species of the An. gambiae complex in the study area, representing 75 to 100% of the samples. Screening for kdr mutations detected the L1014F mutation in 88.6% (N = 35 of surviving An. gambiae sensu stricto S form mosquitoes. All surviving An. arabiensis (N = 49 and M form An. gambiae s.s. (N = 1 carried the susceptible allele

  14. Research on the changes of some physiological parameters in several fish species under the action of the talstar insecticide

    Directory of Open Access Journals (Sweden)

    Maria Cristina PONEPAL

    2010-05-01

    Full Text Available Talstar insecticide is labeled for numerous bugs and many other household pests and lawn pests. Bifenthrin is highly toxic to fish and aquatic arthropods. Bifenhrin LC50 values range from 0.0038 to17.8 μg/L and is only slightly toxic to both waterfowl and upland game birds (LD50 values range from 1.800 mg/kg to > 2.150 mg/kg. Bifenthrin had no effect on mollusks at its limit of water solubility. This study was carried out to analyze the effects of sublethal and lethal concentrations – from 0.000625 to 0.005 ml Talstar/l water on some physiological parameters (oxygen consumption, breathing frequency, number of erythrocytes on fish belonging to three species: prussian carp (Carassius auratus gibelio Bloch, bleak (Alburnus alburnus L. and perch (Perca fluviatilis L.. The acute and subacute toxicity of Talstar insecticide was evaluated in glass aquaria under semystatic conditions. The Tlastar product, under the concentrations from 0.000625 to 0.005 ml/l water, produces, after one week of immersion, a significant decrease of the fish oxygen consumption. The insecticide has changed the fish respiratory rhythm in all investigated concentrations after seven days of exposure. The number of erythrocytes has significantly decrease after seven days of immersion at insecticide concentrations of 0.000625 ml Talstar/l water (bleak and perch and 0.00125 (prussian carp ml Talstar/l water. From the three investigated fish species, the perch proved to be the most sensitive to the action of the toxic substance, followed by the bleak and the prussian carp.

  15. Métodos de extração e concentrações no efeito inseticida de Ruta graveolens L., Artemisia verlotorum Lamotte e Petiveria alliacea L. a Diabrotica speciosa Germar Extraction methods and concentrations for the insecticidal effect of Ruta graveolens L., Artemisia verlotorum Lamotte, and Petiveria alliacea L. against Diabrotica speciosa Germar

    Directory of Open Access Journals (Sweden)

    F.S. Barbosa

    2009-01-01

    Full Text Available O objetivo deste trabalho foi determinar o melhor método de extração e concentração para Ruta graveolens L. (Rutaceae, Artemisia verlotorum Lamotte (Asteraceae e Petiveria alliacea L. (Phytolaccaceae quanto ao efeito inseticida a Diabrotica speciosa Germar (Coleoptera: Chrysomelidae. Os extratos que utilizaram óleo de soja comercial, pelo menos como um dos solventes, apresentaram maior mortalidade de D. speciosa em suas testemunhas (solvente = óleo, nas três plantas estudadas, em relação às suas concentrações. O extrato aquoso de R. graveolens, a 5% de concentração, apresentou maior mortalidade corrigida de D. speciosa (32,5% que os extratos de A. verlotorum em água (10% de concentração (20,3% e P. alliacea em álcool etílico (2% de concentração (12,5%. O método de extração com água é simples, sendo passível de utilização por pequenos agricultores. A R. graveolens é planta facilmente cultivada, sendo, portanto, boa alternativa de controle dessa praga.The aim of this work was to determine the best extraction method and concentration for Ruta graveolens L. (Rutaceae, Artemisia verlotorum Lamotte (Asteraceae and Petiveria alliacea L. (Phytolaccaceae concerning their insecticidal effect against Diabrotica speciosa Germar (Coleoptera: Chrysomelidae. Extracts using commercial soybean oil as at least one of the solvents resulted in higher D. speciosa mortality in controls (solvent = oil of the three studied plants, relative to their treatment concentrations. R. graveolens extract in water, at 5% concentration, showed higher D. speciosa corrected mortality (32.5% than A. verlotiorum extracts in water (10% concentration (20.3% and P. alliacea in ethanol (2% concentration (12.5%. The extraction method with water is simple and can be used by small farmers. R. graveolens is an easily cultivated plant and constitutes, therefore, a good alternative to control this plague.

  16. Toxicity and sublethal effects of seven insecticides to eggs of the flower bug Orius insidiosus (Say) (Hemiptera: Anthocoridae).

    Science.gov (United States)

    Moscardini, Valéria Fonseca; Gontijo, Pablo da Costa; Carvalho, Geraldo Andrade; Oliveira, Rodrigo Lopes de; Maia, Jader Braga; Silva, Fernanda Fonseca e

    2013-07-01

    The predatory bug Orius insidiosus is an important biological control agent of several insect pests, and is one of the most commonly used species in biological control programs worldwide. This study assessed the lethal and sublethal effects of insecticides on this species through life table, and classified the insecticides according to the definitions of toxicity given by the International Organization for Biological and Integrated Control of Noxious Animals and Plants (IOBC). A bioassay was carried out using a completely randomized design with eight treatments and 40 replicates. Eggs of O. insidiosus laid naturally in plant stems were immersed in aqueous solutions of the chemical products. Egg viability, duration of the embryonic period, survival of nymphs, and duration of the nymphal period were assessed daily. Insects that reached adulthood were paired and their reproduction assessed. The number of eggs produced and the survival of adults were assessed daily. The insecticides abamectin, cartap hydrochloride, spirotetramat+imidacloprid, and flubendiamid were classified as harmful. Pyriproxyfen and rynaxypyr were categorized as harmless and pymetrozine was classified as slightly harmful. Pyriproxyfen affected the population parameters rm, GT, DT, and λ, whereas other insecticides did not. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. Nitenpyram analogues with 1,4-dihydropyridine fixed cis-configuration:synthesis,insecticidal activities and molecular docking studies

    Directory of Open Access Journals (Sweden)

    XUE Sijia

    2013-08-01

    Full Text Available A novel series of Nitenpyram analogues(Ia-Ij with 1,4-dihydropyridine fixed cis-configuration were designed and synthesized.Preliminary bioassays showed that most of them exhibited good insecticidal activities against Aphis medicagini and Brown rice planthopper at 500 mg/L and 100 mg/L.The analogue Ij afforded the best activity in vitro,that had 100% mortality at 4 mg/L against Brown rice planthopper and Aphis medicagin.In addition,the molecular docking simulations revealed that the structural uniqueness of these analogues may lead to a unique molecular recognition and binding mode,and the results explained the SARs observed in vitro, which shed light on the novel insecticidal mechanism of these novel nitenpyam analogues.

  18. Insecticide resistance in Bemisia tabaci Gennadius (Homoptera: Aleyrodidae) and Anopheles gambiae Giles (Diptera: Culicidae) could compromise the sustainability of malaria vector control strategies in West Africa.

    Science.gov (United States)

    Gnankiné, Olivier; Bassolé, Imael H N; Chandre, Fabrice; Glitho, Isabelle; Akogbeto, Martin; Dabiré, Roch K; Martin, Thibaud

    2013-10-01

    Insecticides from the organophosphate (OP) and pyrethroid (PY) chemical families, have respectively, been in use for 50 and 30 years in West Africa, mainly against agricultural pests, but also against vectors of human disease. The selection pressure, with practically the same molecules year after year (mainly on cotton), has caused insecticide resistance in pest populations such as Bemisia tabaci, vector of harmful phytoviruses on vegetables. The evolution toward insecticide resistance in malaria vectors such as Anopheles gambiae sensus lato (s.l.) is probably related to the current use of these insecticides in agriculture. Thus, successful pest and vector control in West Africa requires an investigation of insect susceptibility, in relation to the identification of species and sub species, such as molecular forms or biotypes. Identification of knock down resistance (kdr) and acetylcholinesterase gene (Ace1) mutations modifying insecticide targets in individual insects and measure of enzymes activity typically involved in insecticide metabolism (oxidase, esterase and glutathion-S-transferase) are indispensable in understanding the mechanisms of resistance. Insecticide resistance is a good example in which genotype-phenotype links have been made successfully. Insecticides used in agriculture continue to select new resistant populations of B. tabaci that could be from different biotype vectors of plant viruses. As well, the evolution of insecticide resistance in An. gambiae threatens the management of malaria vectors in West Africa. It raises the question of priority in the use of insecticides in health and/or agriculture, and more generally, the question of sustainability of crop protection and vector control strategies in the region. Here, we review the susceptibility tests, biochemical and molecular assays data for B. tabaci, a major pest in cotton and vegetable crops, and An. gambiae, main vector of malaria. The data reviewed was collected in Benin and Burkina

  19. Systems of organic farming in spring vetch II: Biological response of Aeolothrips intermedius Bagnall and Coccinella septempunctata L.

    Directory of Open Access Journals (Sweden)

    Ivelina Nikolova

    2015-09-01

    Full Text Available The effects of four systems of organic farming of spring vetsch on Aeolothrips intermedius Bagnall (Thysanoptera: Aeolothripidae and Coccinella septempunctata L. (Coleoptera: Coccinellidae population density and the toxicity of several products on predatory insects were studied. The variants were: Control (without using any biological products; combined treatment with Polyversum (biological foliar fertilizer and Biofa (biological plant growth regulator; treatment with NeemAzal T/S (biological insecticide, a.i. azadirachtin and treatment with a combination of NeemAzal with Polyversum and Biofa. Variant V was a conventional farming system in which a combination of Nurelle D (synthetic insecticide, Masterblend (foliar fertilizer and Flordimex 420 (growth regulator was used as a standard treatment. In the organic farming system that included treatment of plants with the biological insecticide NeemAzal (azadirachtin, the reduction in A. intermedius abundance was 20.7% when it was applied alone and 24.6 % in combination with the organic products Polyversum and Biofa. NeemAzal achieved a lower reduction in the counts of predatory ladybirds C. septempunctata, from 14.9% (alone to 21.9% (combination. The biological insecticide, applied alone or in combination, was mostly harmless and rarely harmful to A. intermedius. NeemAzal manifested harmlessness to C. septempunctata as its toxic action did not exceed 25%. An analysis of variance regarding product toxicity to A. intermedius and C. septempunctata demonstrated that the type of treatment (the application of insecticides alone or in combination had the strongest effect on product toxicity. Тhe use of neem-based insecticides can be a substantial contribution towards preservation of biodiversity in ecosystems.

  20. Relative toxicity and residual activity of insecticides used in blueberry pest management: mortality of natural enemies.

    Science.gov (United States)

    Roubos, Craig R; Rodriguez-Saona, Cesar; Holdcraft, Robert; Mason, Keith S; Isaacs, Rufus

    2014-02-01

    A series of bioassays were conducted to determine the relative toxicities and residual activities of insecticides labeled for use in blueberry (Vaccinium corymbosum L.) on natural enemies, to identify products with low toxicity or short duration effects on biological control agents. In total, 14 insecticides were evaluated using treated petri dishes and four commercially available natural enemies (Aphidius colemani Viereck, Orius insidiosus [Say], Chrysoperla rufilabris [Burmeister], and Hippodamia convergens [Guérin-Menéville]). Dishes were aged under greenhouse conditions for 0, 3, 7, or 14 d before introducing insects to test residual activity. Acute effects (combined mortality and knockdown) varied by insecticide, residue age, and natural enemy species. Broad-spectrum insecticides caused high mortality to all biocontrol agents, whereas products approved for use in organic agriculture had little effect. The reduced-risk insecticide acetamiprid consistently caused significant acute effects, even after aging for 14 d. Methoxyfenozide, novaluron, and chlorantraniliprole, which also are classified as reduced-risk insecticides, had low toxicity, and along with the organic products could be compatible with biological control. This study provides information to guide blueberry growers in their selection of insecticides. Further research will be needed to determine whether adoption of a pest management program based on the use of more selective insecticides will result in higher levels of biological control in blueberry.

  1. Insecticide susceptibility of natural populations of Anopheles coluzzii and Anopheles gambiae (sensu stricto) from Okyereko irrigation site, Ghana, West Africa.

    Science.gov (United States)

    Chabi, Joseph; Baidoo, Philip K; Datsomor, Alex K; Okyere, Dora; Ablorde, Aikins; Iddrisu, Alidu; Wilson, Michael D; Dadzie, Samuel K; Jamet, Helen P; Diclaro, Joseph W

    2016-03-31

    The increasing spread of insecticide resistance in malaria vectors has been well documented across sub-Saharan Africa countries. The influence of irrigation on increasing vector resistance is poorly understood, and is critical to successful and ethical implementation of food security policies. This study investigated the insecticide resistance status of An. gambiae (s.l.) mosquitoes collected from the irrigated rice area of Okyereko, a village containing about 42 hectares of irrigated field within an irrigation project plan in the Central Region of Ghana. Large amounts of insecticides, herbicides and fertilizers are commonly used in the area to boost the annual production of the rice. Mosquito larvae were collected and adults were assayed from the F1 progeny. The resistance status, allele and genotype were characterized using WHO susceptibility testing and PCR methods respectively. The An. gambiae (s.l.) populations from Okyereko are highly resistant to DDT and pyrethroid insecticides, with possible involvement of metabolic mechanisms including the elevation of P450 and GST enzyme as well as P-gp activity. The population was mostly composed of An. coluzzii specimens (more than 96 %) with kdr and ace-1 frequencies of 0.9 and 0.2 %, respectively. This study brings additional information on insecticide resistance and the characterization of An. gambiae (s.l.) mosquitoes from Okyereko, which can be helpful in decision making for vector control programmes in the region.

  2. Susceptibility of pest Nezara viridula (Heteroptera: Pentatomidae) and parasitoid Trichopoda pennipes (Diptera: Tachinidae) to selected insecticides.

    Science.gov (United States)

    Tillman, P Glynn

    2006-06-01

    Susceptibility of the southern green stink bug, Nezara viridula (L.) (Heteroptera: Pentatomidae), and its endoparasitoid Trichopoda pennipes (F.) (Diptera: Tachinidae) to acetamiprid, cyfluthrin, dicrotophos, indoxacarb, oxamyl, and thiamethoxam was compared in residual and oral toxicity tests. In the residual toxicity test, cyfluthrin, dicrotophos, and oxamyl were highly toxic to N. viridula. Thiamethoxam was moderately toxic to these insects. Each of the four insecticides was highly toxic to T. pennipes after prolonged tarsal contact with dried residues of these chemicals. In the oral toxicity test, where N. viridula fed on food covered with insecticide residues, none of the insecticides were toxic to adults of this stink bug, but acetamiprid, dicrotophos, and thiamethoxam were moderately toxic to the nymphs. In the oral toxicity test, where N. viridula fed on a gel-food containing insecticides, cyfluthrin, dicrotophos, oxamyl, and thiamethoxam were highly toxic to this stink bug. In an oral toxicity test using contaminated sugar water, all of the insecticides were highly toxic to T. pennipes. Because insecticides were as toxic, or more toxic, to T. pennipes than to N. viridula, it is extremely important to conserve this parasitoid by applying these insecticides for control of southern green stink bugs only when the pest reaches economic threshold.

  3. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  4. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  5. Platinum bioaccumulation by mustard plants (Sinapis alba L.)

    International Nuclear Information System (INIS)

    Hawienczyk, M.; Bystrzejewska-Piotrowska, G.; Kowalska, J.; Asztemborska, M.

    2005-01-01

    The ability of hydroponically cultivated Indian mustard plants (Sinapis alba L.) to accumulate platinum was investigated. The Pt-bioaccumulation in leaves, stem and shoots of plants growing for 2 and 4 weeks at Pt-concentration of 50 and 500 μg/L was compared. The relation between dry and fresh weight was also estimated. Adsorptive stripping voltammetry (AdSV) and mass spectrometry with inductively coupled plasma (ICP-MS) were applied for determination of Pt. Increasing Pt-concentration from 50 to 500 μg/L in the medium causes: (1) reduction of the root tissue hydration level at unchanged modification in aboveground parts of the plants and (2) decrease of the Pt transfer factor (TF) for roots and increase for leaves and stem. Duration of the culture influenced on Pt-accumulation in roots and in aboveground organs of mustard plants. Transfer factor for Pt between 560 and 1600 makes Indian mustard plants one at Pt-hyperaccumulators. Distribution of Pt-bioaccumulation in the plant organs may be useful for biomonitoring of platinum in the environment. (author)

  6. Chemical Composition, Antifungal and Insecticidal Activities of Hedychium Essential Oils

    Science.gov (United States)

    2013-04-11

    Hedychiums have been reported to possess antibacterial, antifungal, and insecticidal activities [4,5]. Strawberry anthracnose, caused by the plant...pathogens Colletotrichum species is one of the most important diseases affecting strawberries worldwide [6]. Colletotrichum fragariae Brooks is most...often associated with anthracnose crown rot of strawberries grown in hot, humid areas such as the southeastern United States [7]. The azalea lace bug

  7. Virtual medical plant modeling based on L-system | Ding | African ...

    African Journals Online (AJOL)

    ... aid of graphics and PlantVR, we implemented the plant shape and 3-D structure's reconstruction. Conclusion: Three-dimensional structure virtual plant growth model based on time- controlled L-system has been successfully established. Keywords: Drug R&D, toxicity, medical plants, fractals; L-system; quasi binary-trees.

  8. Role of neonicotinyl insecticides in Washington apple integrated pest management. Part I. Control of lepidopteran pests

    Science.gov (United States)

    Brunner, J. F.; Beers, E. H.; Dunley, J. E.; Doerr, M.; Granger, K.

    2005-01-01

    Three neonicotinyl insecticides, acetamiprid, thiacloprid and clothianidin, were evaluated for their impact on four species of lepidopteran pests of apple in Washington, the codling moth, Cydia pomonella (L.), the Pandemis leafroller, Pandemis pyrusana Kearfott, and the obliquebanded leafroller, Choristoneura rosaceana (Harris), and Lacanobia subjuncta (Grote & Robinson). None of the neonicotinyl insecticides demonstrated sufficient activity against P. pyrusana, C. rosaceana, or L. subjuncta to warrant field trials. Conversely, all had some activity against one or more stages of C. pomonella. Acetamiprid was highly toxic to larvae in laboratory bioassays, and had relatively long activity of field-aged residues (21 days). It also showed some toxicity to C. pomonella eggs (via topical exposure) and adults. Acetamiprid provided the highest level of fruit protection from C. pomonella attack in field trials conducted over five years in experimental orchards with extremely high codling moth pressure. Thiacloprid performed similarly in bioassays, but fruit protection in field trials was slightly lower than acetamiprid. Clothianidin showed moderate to high toxicity in bioassays, depending on the C. pomonella stage tested, but poor fruit protection from attack in field trials. None of the neonicotinyl insecticides were as toxic to larvae or effective in protecting fruit as the current standard organophosphate insecticide used for C. pomonella control, azinphosmethyl. However, both acetamiprid and thiacloprid should provide acceptable levels of C. pomonella control in commercial orchards where densities are much lower than in the experimental orchards used for our trials. The advantages and disadvantages of the neonicotinyl insecticides as replacements for the organophosphate insecticides and their role in a pest management system for Washington apple orchards are discussed. Abbreviation: MFR Maximum field rate PMID:16341246

  9. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  10. Seed coating with a neonicotinoid insecticide negatively affects wild bees.

    Science.gov (United States)

    Rundlöf, Maj; Andersson, Georg K S; Bommarco, Riccardo; Fries, Ingemar; Hederström, Veronica; Herbertsson, Lina; Jonsson, Ove; Klatt, Björn K; Pedersen, Thorsten R; Yourstone, Johanna; Smith, Henrik G

    2015-05-07

    Understanding the effects of neonicotinoid insecticides on bees is vital because of reported declines in bee diversity and distribution and the crucial role bees have as pollinators in ecosystems and agriculture. Neonicotinoids are suspected to pose an unacceptable risk to bees, partly because of their systemic uptake in plants, and the European Union has therefore introduced a moratorium on three neonicotinoids as seed coatings in flowering crops that attract bees. The moratorium has been criticized for being based on weak evidence, particularly because effects have mostly been measured on bees that have been artificially fed neonicotinoids. Thus, the key question is how neonicotinoids influence bees, and wild bees in particular, in real-world agricultural landscapes. Here we show that a commonly used insecticide seed coating in a flowering crop can have serious consequences for wild bees. In a study with replicated and matched landscapes, we found that seed coating with Elado, an insecticide containing a combination of the neonicotinoid clothianidin and the non-systemic pyrethroid β-cyfluthrin, applied to oilseed rape seeds, reduced wild bee density, solitary bee nesting, and bumblebee colony growth and reproduction under field conditions. Hence, such insecticidal use can pose a substantial risk to wild bees in agricultural landscapes, and the contribution of pesticides to the global decline of wild bees may have been underestimated. The lack of a significant response in honeybee colonies suggests that reported pesticide effects on honeybees cannot always be extrapolated to wild bees.

  11. Systemic insecticides (neonicotinoids and fipronil): trends, uses, mode of action and metabolites.

    Science.gov (United States)

    Simon-Delso, N; Amaral-Rogers, V; Belzunces, L P; Bonmatin, J M; Chagnon, M; Downs, C; Furlan, L; Gibbons, D W; Giorio, C; Girolami, V; Goulson, D; Kreutzweiser, D P; Krupke, C H; Liess, M; Long, E; McField, M; Mineau, P; Mitchell, E A D; Morrissey, C A; Noome, D A; Pisa, L; Settele, J; Stark, J D; Tapparo, A; Van Dyck, H; Van Praagh, J; Van der Sluijs, J P; Whitehorn, P R; Wiemers, M

    2015-01-01

    Since their discovery in the late 1980s, neonicotinoid pesticides have become the most widely used class of insecticides worldwide, with large-scale applications ranging from plant protection (crops, vegetables, fruits), veterinary products, and biocides to invertebrate pest control in fish farming. In this review, we address the phenyl-pyrazole fipronil together with neonicotinoids because of similarities in their toxicity, physicochemical profiles, and presence in the environment. Neonicotinoids and fipronil currently account for approximately one third of the world insecticide market; the annual world production of the archetype neonicotinoid, imidacloprid, was estimated to be ca. 20,000 tonnes active substance in 2010. There were several reasons for the initial success of neonicotinoids and fipronil: (1) there was no known pesticide resistance in target pests, mainly because of their recent development, (2) their physicochemical properties included many advantages over previous generations of insecticides (i.e., organophosphates, carbamates, pyrethroids, etc.), and (3) they shared an assumed reduced operator and consumer risk. Due to their systemic nature, they are taken up by the roots or leaves and translocated to all parts of the plant, which, in turn, makes them effectively toxic to herbivorous insects. The toxicity persists for a variable period of time-depending on the plant, its growth stage, and the amount of pesticide applied. A wide variety of applications are available, including the most common prophylactic non-Good Agricultural Practices (GAP) application by seed coating. As a result of their extensive use and physicochemical properties, these substances can be found in all environmental compartments including soil, water, and air. Neonicotinoids and fipronil operate by disrupting neural transmission in the central nervous system of invertebrates. Neonicotinoids mimic the action of neurotransmitters, while fipronil inhibits neuronal receptors. In

  12. Oral toxicity of fipronil insecticide against the stingless bee Melipona scutellaris (Latreille, 1811).

    Science.gov (United States)

    Lourenço, Clara Tavares; Carvalho, Stephan Malfitano; Malaspina, Osmar; Nocelli, Roberta Cornélio Ferreira

    2012-10-01

    For a better evaluation of the model using Apis mellifera in toxicology studies with insecticides, the oral acute toxicity of the insecticide fipronil against the stingless bee Melipona scutellaris was determined. The results showed that fipronil was highly toxic to M. scutellaris, with a calculated LC(50) (48 h) value of 0.011 ng a.i./μL of sucrose solution and an estimated oral LD(50) (48 h) of 0.6 ng a.i./bee. Our results showed that M. scutellaris bee is more sensitive to fipronil than the model specie A. mellifera.

  13. Persistence and fate of chlorinated hydrocarbon insecticides used for crop protection in Brazil. Part of a coordinated programme of isotope tracer aided studies on the fate and significance of foreign substances in the agricultural environment

    International Nuclear Information System (INIS)

    Ruegg, E.F.

    1977-02-01

    The fate of 14 C-labelled lindane (gamma isomer of hexachlorocyclohexane) in coffee plant seedlings following exposure to the insecticide via the roots in nutrient solution or by foliar application has been compared. The insecticide was reversibly and rapidly sorbed by the exposed roots within 24 hours. There was evidence of a much slower translocation to stem and leaves. After foliar application 90% of the radioactive insecticide was lost by volatilization from the leaf surfaces. In a closed system the volatile insecticide was reabsorbed to some extent by untreated plant surfaces

  14. Insecticidal and repellent effects of tea tree and andiroba oils on flies associated with livestock.

    Science.gov (United States)

    Klauck, V; Pazinato, R; Stefani, L M; Santos, R C; Vaucher, R A; Baldissera, M D; Raffin, R; Boligon, A; Athayde, M; Baretta, D; Machado, G; DA Silva, A S

    2014-08-01

    This study aimed to evaluate the insecticidal and repellent effects of tea tree, Melaleuca alternifolia (Myrtales: Myrtaceae), and andiroba, Carapa guianensis (Sapindales: Meliaceae), essential oils on two species of fly. For in vitro studies, free-living adult flies were captured and reared in the laboratory. To evaluate the insecticidal effects of the oils, adult flies of Haematobia irritans (L.) and Musca domestica L. (both: Diptera: Muscidae) were separated by species in test cages (n = 10 per group), and subsequently tested with oils at concentrations of 1.0% and 5.0% using a negative control to validate the test. Both oils showed insecticidal activity. Tea tree oil at a concentration of 5.0% was able to kill M. domestica with 100.0% efficacy after 12 h of exposure. However, the effectiveness of andiroba oil at a concentration of 5.0% was only 67.0%. The insecticidal efficacy (100.0%) of both oils against H. irritans was observed at both concentrations for up to 4 h. The repellency effects of the oils at concentrations of 5.0% were tested in vivo on Holstein cows naturally infested by H. irritans. Both oils demonstrated repellency at 24 h, when the numbers of flies on cows treated with tea tree and andiroba oil were 61.6% and 57.7%, respectively, lower than the number of flies on control animals. It is possible to conclude that these essential oils have insecticidal and repellent effects against the species of fly used in this study. © 2014 The Royal Entomological Society.

  15. Assessing Insecticide Susceptibility of Laboratory Lutzomyia longipalpis and Phlebotomus papatasi Sand Flies (Diptera: Psychodidae: Phlebotominae).

    Science.gov (United States)

    Denlinger, David S; Lozano-Fuentes, Saul; Lawyer, Phillip G; Black, William C; Bernhardt, Scott A

    2015-09-01

    Chemical insecticides are effective for controlling Lutzomyia and Phlebotomus sand fly (Diptera: Psychodidae) vectors of Leishmania parasites. However, repeated use of certain insecticides has led to tolerance and resistance. The objective of this study was to determine lethal concentrations (LCs) and lethal exposure times (LTs) to assess levels of susceptibility of laboratory Lutzomyia longipalpis (Lutz and Nieva) and Phlebotomus papatasi (Scopoli) to 10 insecticides using a modified version of the World Health Organization (WHO) exposure kit assay and Centers for Disease Control and Prevention (CDC) bottle bioassay. Sand flies were exposed to insecticides coated on the interior of 0.5-gallon and 1,000-ml glass bottles. Following exposure, the flies were allowed to recover for 24 h, after which mortality was recorded. From dose-response survival curves for L. longipalpis and P. papatasi generated with the QCal software, LCs causing 50, 90, and 95% mortality were determined for each insecticide. The LCs and LTs from this study will be useful as baseline reference points for future studies using the CDC bottle bioassays to assess insecticide susceptibility of sand fly populations in the field. There is a need for a larger repository of sand fly insecticide susceptibility data from the CDC bottle bioassays, including a range of LCs and LTs for more sand fly species with more insecticides. Such a repository would be a valuable tool for vector management. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Plant Insecticidal Toxins in Ecological Networks

    Directory of Open Access Journals (Sweden)

    Sébastien Ibanez

    2012-04-01

    Full Text Available Plant secondary metabolites play a key role in plant-insect interactions, whether constitutive or induced, C- or N-based. Anti-herbivore defences against insects can act as repellents, deterrents, growth inhibitors or cause direct mortality. In turn, insects have evolved a variety of strategies to act against plant toxins, e.g., avoidance, excretion, sequestration and degradation of the toxin, eventually leading to a co-evolutionary arms race between insects and plants and to co-diversification. Anti-herbivore defences also negatively impact mutualistic partners, possibly leading to an ecological cost of toxin production. However, in other cases toxins can also be used by plants involved in mutualistic interactions to exclude inadequate partners and to modify the cost/benefit ratio of mutualism to their advantage. When considering the whole community, toxins have an effect at many trophic levels. Aposematic insects sequester toxins to defend themselves against predators. Depending on the ecological context, toxins can either increase insects’ vulnerability to parasitoids and entomopathogens or protect them, eventually leading to self-medication. We conclude that studying the community-level impacts of plant toxins can provide new insights into the synthesis between community and evolutionary ecology.

  17. Plant insecticidal toxins in ecological networks.

    Science.gov (United States)

    Ibanez, Sébastien; Gallet, Christiane; Després, Laurence

    2012-04-01

    Plant secondary metabolites play a key role in plant-insect interactions, whether constitutive or induced, C- or N-based. Anti-herbivore defences against insects can act as repellents, deterrents, growth inhibitors or cause direct mortality. In turn, insects have evolved a variety of strategies to act against plant toxins, e.g., avoidance, excretion, sequestration and degradation of the toxin, eventually leading to a co-evolutionary arms race between insects and plants and to co-diversification. Anti-herbivore defences also negatively impact mutualistic partners, possibly leading to an ecological cost of toxin production. However, in other cases toxins can also be used by plants involved in mutualistic interactions to exclude inadequate partners and to modify the cost/benefit ratio of mutualism to their advantage. When considering the whole community, toxins have an effect at many trophic levels. Aposematic insects sequester toxins to defend themselves against predators. Depending on the ecological context, toxins can either increase insects' vulnerability to parasitoids and entomopathogens or protect them, eventually leading to self-medication. We conclude that studying the community-level impacts of plant toxins can provide new insights into the synthesis between community and evolutionary ecology.

  18. Fipronil insecticide: novel photochemical desulfinylation with retention of neurotoxicity

    International Nuclear Information System (INIS)

    Hainzl, D.; Casida, J.E.

    1996-01-01

    Fipronil is an outstanding new insecticide for crop protection with good selectivity between insects and mammals. The insecticidal action involves blocking the gamma-aminobutyric acid-gated chloride channel with much greater sensitivity of this target in insects than in mammals. Fipronil contains a trifluoromethylsulfinyl moiety that is unique among the agrochemicals and therefore presumably important in its outstanding performance. We find that this substituent unexpectedly undergoes a novel and facile photoextrusion reaction on plants upon exposure to sunlight, yielding the corresponding trifluoromethylpyrazole, i.e., the desulfinyl derivative. The persistence of this photoproduct and its high neuroactivity, resulting from blocking the gamma-aminobutyric acid-gated chloride channel, suggest that it may be a significant contributor to the effectiveness of fipronil. In addition, desulfinylfipronil is not a metabolite in mammals, so the safety evaluations must take into account not only the parent compound but also this completely new environmental product

  19. Chloride channels as tools for developing selective insecticides.

    Science.gov (United States)

    Bloomquist, Jeffrey R

    2003-12-01

    Ligand-gated chloride channels underlie inhibition in excitable membranes and are proven target sites for insecticides. The gamma-aminobutyric acid (GABA(1)) receptor/chloride ionophore complex is the primary site of action for a number of currently used insecticides, such as lindane, endosulfan, and fipronil. These compounds act as antagonists by stabilizing nonconducting conformations of the chloride channel. Blockage of the GABA-gated chloride channel reduces neuronal inhibition, which leads to hyperexcitation of the central nervous system, convulsions, and death. We recently investigated the mode of action of the silphinenes, plant-derived natural compounds that structurally resemble picrotoxinin. These materials antagonize the action of GABA on insect neurons and block GABA-mediated chloride uptake into mouse brain synaptoneurosomes in a noncompetitive manner. In mammals, avermectins have a blocking action on the GABA-gated chloride channel consistent with a coarse tremor, whereas at longer times and higher concentrations, activation of the channel suppresses neuronal activity. Invertebrates display ataxia, paralysis, and death as the predominant signs of poisoning, with a glutamate-gated chloride channel playing a major role. Additional target sites for the avermectins or other chloride channel-directed compounds might include receptors gated by histamine, serotonin, or acetylcholine.The voltage-sensitive chloride channels form another large gene family of chloride channels. Voltage-dependent chloride channels are involved in a number of physiological processes including: maintenance of electrical excitability, chloride ion secretion and resorption, intravesicular acidification, and cell volume regulation. A subset of these channels is affected by convulsants and insecticides in mammals, although the role they play in acute lethality in insects is unclear. Given the wide range of functions that they mediate, these channels are also potential targets for

  20. SELECTIVITY OF INSECTICIDES USED IN PEACH FARMING TO LARVAE OF Chrysoperla externa (NEUROPTERA: CHRYSOPIDAE IN SEMI-FIELD CONDITIONS

    Directory of Open Access Journals (Sweden)

    RODOLFO VARGAS CASTILHOS

    2017-01-01

    Full Text Available The selectivity of five insecticides, regularly used in peach farming, was assessed for larvae of the predator Chrysoperla externa (Hagen (Neuroptera: Chrysopidae by means of bioassay in semi-field conditions. The bioassay was based on the counting of captured larvae after release in peach trees treated with the insecticides (% of active ingredient in spray liquid: deltamethrin (0.001, fenthion (0.050, phosmet (0.100, lufenuron (0.005 and malathion (0.200. Bait-cards with eggs of Anagasta kuehniella (Zeller (Lepidoptera: Pyralidae were used to capture larvae from treated plants; five of them were fixed in plant canopy and five others left on the soil around stem. A protective barrier made up of galvanized steel sheet was used for each plant to avoid loss of larvae. The number of larvae feeding on the bait-cards was measured for four days. According to the number of captured larvae, each insecticide effect was estimated and classified into toxicity categories as stated by the International Organization for Biological and Integratec Control of Noxious Animals and Plants (IOBC. Based on observations, the insect growth regulator lufenuron was harmless, while the neurotoxins deltamethrin and malathion were slightly harmful; and lastly, fenthion and phosmet were moderately harmful to C. externa larvae in semi-field conditions. Thus, lufenuron should be recommended for integrated pest management, since it would preserve this predator species in peach orchards.

  1. The effect of temperature on the toxicity of insecticides against Musca domestica L.: implications for the effective management of diarrhea.

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available BACKGROUND: Diarrhea is an important cause of childhood mortality in developing countries like Pakistan because of unhygienic conditions, lack of awareness, and unwise use of preventive measures. Mechanical transmission of diarrheal pathogens by house flies, Musca domestica, is believed as the most effective route of diarrhea transmission. Although the use of insecticides as a preventive measure is common worldwide for the management of house flies, success of the measure could be compromised by the prevailing environmental temperature since it significantly affects toxicity of insecticides and thus their efficacy. Peaks of the house fly density and diarrheal cases are usually coincided and season specific, yet little is known about the season specific use of insecticides. METHODOLOGY/PRINCIPAL FINDINGS: To determine the temperature-toxicity relationship in house flies, the effect of post-bioassays temperature (range, 20-34°C on the toxicity of seven insecticides from organophosphate (chlorpyrifos, profenofos, pyrethroid (cypermethrin, deltamethrin and new chemical (emamectin benzoate, fipronil, spinosad classes was evaluated by using a feeding bioassay method. From 20-34°C, the toxicities of chlorpyrifos, profenofos, emamectin and fipronil increased 2.10, 2.93, 2.40 and 3.82 fold (i.e. positive temperature coefficient, respectively. Whereas, the toxicities of cypermethrin, deltamethrin and spinosad decreased 2.21, 2.42 and 3.16 fold (i.e. negative temperature coefficient, respectively. CONCLUSION/SIGNIFICANCE: These findings suggest that for the reduction in diarrheal cases, house flies should be controlled with insecticides according to the prevailing environmental temperature. Insecticides with a positive temperature coefficient may serve as potential candidates in controlling house flies and diarrhea epidemics in hot season and vice versa.

  2. Comparing larvicidal Effect of Methanol Extract of the Aerial Parts of Henbane (Hyoscyamus niger L. and Oleander ( Nerium oleander L. plants on Anopheles spp Larvae (Diptera: Culicidae in Vitro

    Directory of Open Access Journals (Sweden)

    Mahmoodreza Behravan

    2017-03-01

    Full Text Available Background Malaria is an infectious disease by fever and chills, anemia and splenomegaly genus Plasmodium parasite is the agent it. One of the easiest and least expensive methods to prevent this disease is removing the vector that usually by been done insecticides and chemical pesticides, but nowadays due to the damaging effects of by toxic chemicals is currently trying to organic toxic and plant compounds used to combat the pests. So in this study used from the Hyoscyamus niger L. and Nerium oleander L. to destroy the larvae of this vectors and positive results were compared these two plants together. Methods In this experimental study, H. niger and N. oleander collected and dried to extraction by methanol usingthe Rotary Evaporator. Mosquito larvae collected from stagnant water pits and ponds around the Birjand, Iran and order to apply the relevant identity tests and isolation of Anopheles spp mosquito larvae. Survival measurement were used to estimate LC50 values using Probit analysis in Excel 2010 and SPSS (ver 20 software. Results Both Hyoscyamus niger and Nerium oleander had positive effects on destroying the Anopheles spp larvae and between obtained results, the most effective extract for destroying the mosquitoes Anopheles spp larvae, was the flower extract of henbane (LC50 = 0/26 ppm and the weakest one, was the leaves extract of oleander (LC50 = 4/85 ppm. Conclusions According to the results, the flower extract of henbane is recommended as a toxic, organic and natural compounds to fight Anopheles spp mosquito larvae, which it is stronger and more effective compared to the other parts of these two plants.

  3. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Expression of a Chimeric Gene Encoding Insecticidal Crystal Protein Cry1Aabc of Bacillus thuringiensis in Chickpea (Cicer arietinum L.) Confers Resistance to Gram Pod Borer (Helicoverpa armigera Hubner.).

    Science.gov (United States)

    Das, Alok; Datta, Subhojit; Thakur, Shallu; Shukla, Alok; Ansari, Jamal; Sujayanand, G K; Chaturvedi, Sushil K; Kumar, P A; Singh, N P

    2017-01-01

    Domain swapping and generation of chimeric insecticidal crystal protein is an emerging area of insect pest management. The lepidopteran insect pest, gram pod borer ( Helicoverpa armigera H.) wreaks havoc to chickpea crop affecting production. Lepidopteran insects were reported to be controlled by Bt ( cryI ) genes. We designed a plant codon optimized chimeric Bt gene ( cry1Aabc ) using three domains from three different cry1A genes (domains I, II, and III from cry1Aa , cry1Ab , and cry1Ac , respectively) and expressed it under the control of a constitutive promoter in chickpea ( cv . DCP92-3) to assess its effect on gram pod borer. A total of six transgenic chickpea shoots were established by grafting into mature fertile plants. The in vitro regenerated (organogenetic) shoots were selected based on antibiotic kanamycin monosulfate (100 mg/L) with transformation efficiency of 0.076%. Three transgenic events were extensively studied based on gene expression pattern and insect mortality across generations. Protein expression in pod walls, immature seeds and leaves (pre- and post-flowering) were estimated and expression in pre-flowering stage was found higher than that of post-flowering. Analysis for the stable integration, expression and insect mortality (detached leaf and whole plant bioassay) led to identification of efficacious transgenic chickpea lines. The chimeric cry1Aabc expressed in chickpea is effective against gram pod borer and generated events can be utilized in transgenic breeding program.

  5. Expression of a Chimeric Gene Encoding Insecticidal Crystal Protein Cry1Aabc of Bacillus thuringiensis in Chickpea (Cicer arietinum L. Confers Resistance to Gram Pod Borer (Helicoverpa armigera Hubner.

    Directory of Open Access Journals (Sweden)

    Alok Das

    2017-08-01

    Full Text Available Domain swapping and generation of chimeric insecticidal crystal protein is an emerging area of insect pest management. The lepidopteran insect pest, gram pod borer (Helicoverpa armigera H. wreaks havoc to chickpea crop affecting production. Lepidopteran insects were reported to be controlled by Bt (cryI genes. We designed a plant codon optimized chimeric Bt gene (cry1Aabc using three domains from three different cry1A genes (domains I, II, and III from cry1Aa, cry1Ab, and cry1Ac, respectively and expressed it under the control of a constitutive promoter in chickpea (cv. DCP92-3 to assess its effect on gram pod borer. A total of six transgenic chickpea shoots were established by grafting into mature fertile plants. The in vitro regenerated (organogenetic shoots were selected based on antibiotic kanamycin monosulfate (100 mg/L with transformation efficiency of 0.076%. Three transgenic events were extensively studied based on gene expression pattern and insect mortality across generations. Protein expression in pod walls, immature seeds and leaves (pre- and post-flowering were estimated and expression in pre-flowering stage was found higher than that of post-flowering. Analysis for the stable integration, expression and insect mortality (detached leaf and whole plant bioassay led to identification of efficacious transgenic chickpea lines. The chimeric cry1Aabc expressed in chickpea is effective against gram pod borer and generated events can be utilized in transgenic breeding program.

  6. Assessment of resistance risk to lambda-cyhalothrin and cross-resistance to four other insecticides in the house fly, Musca domestica L. (Diptera: Muscidae).

    Science.gov (United States)

    Abbas, Naeem; Shad, Sarfraz Ali

    2015-07-01

    Lambda-cyhalothrin, a sodium channel modulator insecticide, has been used frequently for the control of house flies, Musca domestica L. (Diptera: Muscidae) worldwide, including Pakistan. This experiment was performed to determine the selection and assessment of lambda-cyhalothrin resistance evolution along with four other insecticides. After 26 generations of selection, the lambda-cyhalothrin-selected population developed 445-fold resistance to lambda-cyhalothrin compared to the susceptible population. There was low cross-resistance to bifenthrin and very low cross-resistance to methomyl, imidacloprid, and fipronil in the lambda-cyhalothrin-selected population compared to the field population (G1). Realized heritability (h (2)) of resistance to lambda-cyhalothrin, bifenthrin, methomyl, imidacloprid, and fipronil was 0.07, 0.05, 0.01, 0.08, and 0.08, respectively. The projected rate of resistance development revealed that if 90 % house flies were selected, then a tenfold increase in lethal concentration 50 occurred after 17, 20, 159, 13, and 14 generations for lambda-cyhalothrin (h (2) = 0.07, slope = 2.09), bifenthrin (h (2) = 0.05, slope = 1.73), methomyl (h (2) = 0.01, slope = 2.52), imidacloprid (h (2) = 0.08, slope = 1.89), and fipronil (h (2) = 0.08, slope = 2.03), respectively. The results of our study concluded that the house fly has the potential to develop multiple insecticide resistances following continued selection pressure with lambda-cyhalothrin. This study will be helpful for assisting the development of resistance management strategies.

  7. DOI: 10.18697/ajfand.81.17095 13254 POTENTIALISATION DE L ...

    African Journals Online (AJOL)

    therefore to determine the insecticidal potential in powdery formulations of ... and seeds of neem tree Azadirachta indica A. Juss (Meliaceae ) in formulation with the ..... Candido ACS and MTLP Peres Insecticide irritability of plant extracts.

  8. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  9. Neonicotinoid insecticide residues in surface water and soil associated with commercial maize (corn fields in southwestern Ontario.

    Directory of Open Access Journals (Sweden)

    Arthur Schaafsma

    Full Text Available Neonicotinoid insecticides have come under scrutiny for their potential unintended effects on non-target organisms, particularly pollinators in agro-ecosystems. As part of a larger study of neonicotinoid residues associated with maize (corn production, 76 water samples within or around the perimeter of 18 commercial maize fields and neighbouring apiaries were collected in 5 maize-producing counties of southwestern Ontario. Residues of clothianidin (mean = 2.28, max. = 43.60 ng/mL and thiamethoxam (mean = 1.12, max. = 16.50 ng/mL were detected in 100 and 98.7% of the water samples tested, respectively. The concentration of total neonicotinoid residues in water within maize fields increased six-fold during the first five weeks after planting, and returned to pre-plant levels seven weeks after planting. However, concentrations in water sampled from outside the fields were similar throughout the sampling period. Soil samples from the top 5 cm of the soil profile were also collected in these fields before and immediately following planting. The mean total neonicotinoid residue was 4.02 (range 0.07 to 20.30 ng/g, for samples taken before planting, and 9.94 (range 0.53 to 38.98 ng/g, for those taken immediately after planting. Two soil samples collected from within an conservation area contained detectable (0.03 and 0.11 ng/g concentrations of clothianidin. Of three drifted snow samples taken, the drift stratum containing the most wind-scoured soil had 0.16 and 0.20 ng/mL mainly clothianidin in the melted snow. The concentration was at the limit of detection (0.02 ng/mL taken across the entire vertical profile. With the exception of one sample, water samples tested had concentrations below those reported to have acute, chronic or sublethal effects to honey bees. Our results suggest that neonicotinoids may move off-target by wind erosion of contaminated soil. These results are informative to risk assessment models for other non-target species in maize

  10. Neonicotinoid Insecticide Residues in Surface Water and Soil Associated with Commercial Maize (Corn) Fields in Southwestern Ontario

    Science.gov (United States)

    Schaafsma, Arthur; Limay-Rios, Victor; Baute, Tracey; Smith, Jocelyn; Xue, Yingen

    2015-01-01

    Neonicotinoid insecticides have come under scrutiny for their potential unintended effects on non-target organisms, particularly pollinators in agro-ecosystems. As part of a larger study of neonicotinoid residues associated with maize (corn) production, 76 water samples within or around the perimeter of 18 commercial maize fields and neighbouring apiaries were collected in 5 maize-producing counties of southwestern Ontario. Residues of clothianidin (mean = 2.28, max. = 43.60 ng/mL) and thiamethoxam (mean = 1.12, max. = 16.50 ng/mL) were detected in 100 and 98.7% of the water samples tested, respectively. The concentration of total neonicotinoid residues in water within maize fields increased six-fold during the first five weeks after planting, and returned to pre-plant levels seven weeks after planting. However, concentrations in water sampled from outside the fields were similar throughout the sampling period. Soil samples from the top 5 cm of the soil profile were also collected in these fields before and immediately following planting. The mean total neonicotinoid residue was 4.02 (range 0.07 to 20.30) ng/g, for samples taken before planting, and 9.94 (range 0.53 to 38.98) ng/g, for those taken immediately after planting. Two soil samples collected from within an conservation area contained detectable (0.03 and 0.11 ng/g) concentrations of clothianidin. Of three drifted snow samples taken, the drift stratum containing the most wind-scoured soil had 0.16 and 0.20 ng/mL mainly clothianidin in the melted snow. The concentration was at the limit of detection (0.02 ng/mL) taken across the entire vertical profile. With the exception of one sample, water samples tested had concentrations below those reported to have acute, chronic or sublethal effects to honey bees. Our results suggest that neonicotinoids may move off-target by wind erosion of contaminated soil. These results are informative to risk assessment models for other non-target species in maize agro

  11. (L.) Poit

    African Journals Online (AJOL)

    2015-12-31

    Dec 31, 2015 ... tannins, glycosides and essential oil isolated from the plant has ..... The aqueous extract with a lower dose of insecticides can control ..... Control of nematode pests of cowpea with Mocap(Ethoprop), leaf residues of neem.

  12. The spinosyn family of insecticides: realizing the potential of natural products research.

    Science.gov (United States)

    Kirst, Herbert A

    2010-03-01

    The spinosyns are a large family of unprecedented compounds produced from fermentation of two species of Saccharopolyspora. Their core structure is a polyketide-derived tetracyclic macrolide appended with two saccharides. They show potent insecticidal activities against many commercially significant species that cause extensive damage to crops and other plants. They also show activity against important external parasites of livestock, companion animals and humans. Spinosad is a defined combination of the two principal fermentation factors, spinosyns A and D. Structure-activity relationships (SARs) have been extensively studied, leading to development of a semisynthetic second-generation derivative, spinetoram. The spinosyns have a unique mechanism of action (MOA) involving disruption of nicotinic acetylcholine receptors. When compared with many other insecticides, the spinosyns generally show greater selectivity toward target insects and lesser activity against many beneficial predators as well as mammals and other aquatic and avian animals. Their insecticidal spectrum, unique MOA and lower environmental effect make them useful new agents for modern integrated pest management programs. As a result, this work has received U S Presidential Green Chemistry Challenge Awards.

  13. Identification of Insecticidal Constituents from the Essential Oil of Valeriana jatamansi Jones against Liposcelis bostrychophila Badonnel

    Directory of Open Access Journals (Sweden)

    Xin Chao Liu

    2013-01-01

    Full Text Available The aim of this research was to determine chemical composition and insecticidal activities of the essential oil of Valeriana jatamansi Jones roots against booklice, Liposcelis bostrychophila Badonnel, and to isolate insecticidal constituents from the oil. Essential oil of V. jatamansi was obtained by hydrodistillation and analyzed by GC-MS. A total of 27 components in the essential oil were identified. The major compounds were patchoulol (24.3%, α-bulnesene (13.8%, isovaleric acid (12.9%, α-guaiene (8.7%, and 3-methylvaleric acid (8.4%. Based on bioactivity-guided fractionation, isovaleric acid, 3-methylvaleric acid, and patchoulol were isolated and identified as the active constituents. The essential oil exhibited contact toxicity against L. bostrychophila with an LC50 value of 236.4 μg/cm2. Patchoulol (LC50 = 61.35 μg/cm2 exhibited stronger acute toxicity than 3-methylvaleric acid (LC50 = 210.69 μg/cm2 against the booklice. The essential oil also possessed fumigant toxicity against L. bostrychophila with an LC50 value of 6.0 mg/L, while 3-methylvaleric acid and isovaleric acid had LC50 values of 5.53 mg/L and 5.67 mg/L against the booklice, respectively. The results indicated that the essential oil and its constituent compounds have potential to develop into natural insecticides or fumigants for control of insects in stored grains.

  14. Effect of insecticides on mealybug destroyer (Coleoptera: Coccinellidae) and parasitoid Leptomastix dactylopii (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug (Homoptera: Pseudococcidae).

    Science.gov (United States)

    Cloyd, Raymond A; Dickinson, Amy

    2006-10-01

    In this study, we measured, under laboratory conditions, the direct and indirect effects of insecticides on mealybug destroyer, Cryptolaemus montrouzieri Mulsant (Coleoptera: Coccinellidae), and parasitoid Leptomastix dactylopii Howard (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug, Planococcus citri (Risso) (Homoptera: Pseudococcidae). The adult stages of both natural enemies were exposed to sprays of the insecticides buprofezin, pyriproxyfen, flonicamid, acetamiprid, dinotefuran, and clothianidin at label-recommended rates to assess direct mortality after 24, 48, and 72 h, respectively. The effects of the insecticides on L. dactylopii parasitization rate and percentage of parasitoid emergence also were monitored using the label and 4x the recommended label rate. Dinotefuran was extremely detrimental to the adult parasitoid at the label rate with 100% mortality after 24 h. Buprofezin, pyriproxyfen, and flonicamid were not harmful to L. dactylopii when applied at the label rate. At 4x the recommended label rate, dinotefuran, acetamiprid, and clothianidin were all harmful to the parasitoid with 100% mortality 72 h after application. Both buprofezin and flonicamid were not toxic to L. dactylopii with 100% adult survival after 72 h. Pyriproxyfen and flonicamid, at both the label and 4x the recommended label rate, did not negatively affect L. dactylopii parasitization rate or percentage of parasitoid emergence. Acetamiprid, dinotefuran, and clothianidin were toxic to C. montrouzieri adults with 100% mortality after 48 h, whereas buprofezin, pyriproxyfen, and flonicamid demonstrated minimal (10-20% mortality after 48 h) harmful effects to the predator. Based on the results from our study, the indirect effects of the insect growth regulator (IGR) buprofezin were not decisive; however, the IGR pyriproxyfen and the insecticide flonicamid were not directly or indirectly harmful to the predator C. montrouzieri and parastioid L. dactylopii, indicating that

  15. Chemical Composition and Insecticidal Activity against Sitophilus zeamais of the Essential Oils of Artemisia capillaris and Artemisia mongolica

    Directory of Open Access Journals (Sweden)

    Zhi Long Liu

    2010-04-01

    Full Text Available In our screening program for new agrochemicals from local wild plants, Artemisia capillaris and A. mongolica were found to possess insecticidal activity against the maize weevil, Sitophilus zeamais. The essential oils of aerial parts of the two plants were obtained by hydrodistillation and were investigated by GC and GC-MS. The main components of A. capillaris essential oil were 1,8-cineole (13.75%, germacrene D (10.41%, and camphor (8.57%. The main constituents of A. mongolica essential oil were α-pinene (12.68%, germacrene D (8.36%, and γ-terpinene (8.17%. Essential oils of A. capillaris and A. mongolica possess fumigant toxicity against S. zeamais adults with LC50 values of 5.31 and 7.35 mg/L respectively. The essential oils also show contact toxicity against S. zeamais adults with LD50 values of 105.95 and 87.92 mg/adult, respectively.

  16. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  17. Uptake and movement of 14C-lindane in coffee plants

    International Nuclear Information System (INIS)

    Ruegg, E.F.; Lord, K.A.; Mesquita, T.B.

    1977-01-01

    Several types of experiments were performed to investigate the uptake and distribution of lindane in coffee plants using 14 C-labelled insecticide. The investigations showed that the insecticide taken from nutrient solution is concentrated in the roots and then moves to other parts of the plant. Experiments using macerated plant tissue showed that concentration of lindane in the roots occurs probably by a passive physical process. In another series of tests, leaf tretments of coffee plants grown in pots or in solution indicated that in a few hours about 90% of lindane may be lost from treated leaf as vapor. Some lindane, however, has been detected in other parts of the plant indicating leaf transllocation or migration of the insecticide through the air. The latter hypothesis has been proved by closed and open system comparative experiments using gas chromatographic techniques. This does not exclude a slower and possibly smaller translocation within the plant, suggested by the experiments using radioactivity,. (author) [pt

  18. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Chemical Constituents and Insecticidal Activities of the Essential Oil of Cinnamomum camphora Leaves against Lasioderma serricorne

    Directory of Open Access Journals (Sweden)

    Hai Ping Chen

    2014-01-01

    Full Text Available During our screening program for agrochemicals from Chinese medicinal herbs and wild plants, the essential oil of Cinnamomum camphora leaves was found to possess strong fumigant and contact toxicity against Lasioderma serricorne adults with LC50/LD50 values of 2.5 mg/L air and 21.25 μg/adult, respectively. The essential oil obtained by hydrodistillation was investigated by GC and GC-MS. The main components of the essential oil were identified to be D-camphor (40.54%, linalool (22.92%, cineole (11.26%, and 3,7,11-trimethyl-3-hydroxy-6,10-dodecadien-1-yl acetate (4.50%. Bioactivity-directed chromatographic separation on repeated silica gel columns led to the isolation of D-camphor and linalool. D-camphor and linalool showed strong fumigant toxicity (LC50 = 2.36 and 18.04 mg/L air, resp. and contact toxicity (LD50 = 13.44 and 12.74 μg/adult, resp. against L. serricorne. The results indicate that the essential oil of C. camphora and its active compounds had the potential to be developed as natural fumigants and insecticides for control of L. serricorne.

  20. Chlorfenapyr, a Potent Alternative Insecticide of Phoxim To Control Bradysia odoriphaga (Diptera: Sciaridae).

    Science.gov (United States)

    Zhao, Yunhe; Wang, Qiuhong; Wang, Yao; Zhang, Zhengqun; Wei, Yan; Liu, Feng; Zhou, Chenggang; Mu, Wei

    2017-07-26

    Bradysia odoriphaga is the major pest affecting Chinese chive production, and in China, it has developed widespread resistance to organophosphorus insecticides. Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action that does not confer cross-resistance to neurotoxic insecticides. However, the effect of chlorfenapyr on organophosphate-resistant B. odoriphaga is not well understood. The present study evaluated the potential of chlorfenapyr for the control of phoxim-resistant B. odoriphaga. The results showed that chlorfenapyr had significant insecticidal activity to B. odoriphaga in multiple developmental stages, and there were no significant differences in susceptibility between the field (phoxim-resistant) and laboratory (phoxim-susceptible) populations. The pot experiment and field trials confirmed the results of our laboratory bioassays. In the field trial, chlorfenapyr applied at 3.0, 6.0, or 12.0 kg of active ingredient (a.i.)/ha significantly decreased the number of B. odoriphaga and improved the yield compared to phoxim at 6.0 kg of a.i./ha and the control conditions. Moreover, the final residues of chlorfenapyr on plants were below the maximum residue limits (MRLs) as a result of its non-systemic activity. These results demonstrate that chlorfenapyr has potential as a potent alternative to phoxim for controlling B. odoriphaga.

  1. Use of water by eastern hemlock: implications for systemic insecticide application

    Science.gov (United States)

    Chelcy R. Ford; James M. Vose; Michael Daley; Nathan Phillips

    2007-01-01

    The hemlock woolly adelgid (HWA, Adelges tsugae Annand) is causing widespread decline and mortality of eastern hemlock (Tsuga canadensis (L.) Carr.) throughout most of the range of eastern hemlock. Stem injection of insecticide is widely used as a chemical control measure, but the effectiveness of this method depends on the...

  2. Nutritional evaluation of plants of family zygophyllaceae and euphorbiaceae

    International Nuclear Information System (INIS)

    Dastagir, G.; Hussain, F.

    2014-01-01

    The study was conducted with the objective to find out the nutritional value of some selected plants of family Zygophyllaceae and Euphorbiaceae which are traditionally used in different parts of Pakistan. Fresh plants of Fagonia indica Burm. f., Peganum harmala L., Tribulus terrestris L., Chrozophora tinctoria (L.) Raf. and Ricinus communis L., were collected from Peshawar and Attock Hills during June, 2009. It was observed that the average values revealed that P. harmala excelled in high fat, carbohydrate, protein and moisture contents than other two species, therefore it can be considered a good nutritive plant followed by F. indica that contained the highest fibre. The T. terrestris had the maximum protein and gross energy. The differences found in the proximate composition of these medicinal plants might be attributed to the habitat, environment and time of harvest. Chrozophora tinctoria and R. communis revealed variation in various analysed biochemicals. The average values showed that C. tinctoria had high the moisture, ash contents, protein, fats, fibre, carbohydrate and gross energy than its counterpart R. communis. The cultivation of Ricinus communis should be encouraged on large scale for the development of biodiesel that will help people. Its seeds can be helpful for pharmaceutical, cosmetic, food and insecticidal industries. (author)

  3. Degradation dynamics of the insecticide: clothianidin (Dantop 50 % WDG) in a tea field ecosystem.

    Science.gov (United States)

    Chowdhury, Sutapa; Mukhopadhyay, Soumyadeep; Bhattacharyya, Anjan

    2012-08-01

    The fate of clothianidin [(E)-1-(2-chloro-1, 3-thiazol-5-ylmethyl)-3-methyl-2-nitroguanidine] applied to tea plant was studied at two location in West Bengal, India. The insecticide was applied in Tea field at two doses @30 and 60 g.a.i./ha during June-July 2009. Solid-phase extraction and liquid-liquid extraction was employed for the determination of this insecticide in tea samples. Clothianidin residues were analyzed and estimated quantitatively by HPLC at λ(max) 250 nm. The observed half life values of made tea and green tea leaf ranges from 3.71 to 4.07 days and 4.07 to 4.49 days respectively.

  4. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  5. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  6. The insecticide lindane. Identification of possible risks for human reproduction; L'insetticida lindano. Identificazione dei rischi possibili per la riproduzione umana

    Energy Technology Data Exchange (ETDEWEB)

    Traina, M E; Urbani, E [Istituto Superiore di Sanita' , Lab. di Igiene Ambientale, Rome (Italy); Rescia, M; Mantovani, A [Istituto Superiore di Sanita' , Lab. di Tossicologia Comparata e Ecotossicologia, Rome (Italy)

    2001-07-01

    A growing international concern exists about the potential harm to human reproduction caused by pollutants able to interfere with the endocrine system. Particular interest is addressed to organochlorine pesticides persisting in the environment and organisms; such compounds are extensively studied for their adverse effects on reproductive functions and development of laboratory animals. The insecticide lindane (the {gamma}-isomer of hexachlorocyclohexane), widely used before the 80s, has yet to be adequately evaluated as regards the possible reproductive risk. The present report contains a critical revision of the available scientific literature about lindane effects on the male and female reproductive system, pregnancy and development. Besides, the possible higher exposure periods to this pesticide (years 60s-70s) have been determined through the analysis of the lindane products consumed and the evaluation of the active ingredient levels in the environment and in the tissues and biological fluids, with particular regard to Italy. The present review aims at supporting further toxicological and epidemiological studies to assess the possible reproductive risk posed by environmental and professional exposure to chlorinated insecticides. [Italian] L'ipotesi che l'esposizione a sostanze inquinanti in grado di alterare l'equilibrio del sistema endocrino possa avere effetti sulla riproduzione umana e sullo sviluppo e' attualmente oggetto d'interesse nella comunita' scientifica. Particoalre attenzione e' stata indirizzata ai pesticidi organoclorurati a lunga persistenza nell'ambiente e negli organismi, per i quali esistono numerose evidenze di effetti nocivi per la riproduzione, negli studi di tossicologia sperimentale. L'insetticida lindano (l'isomero-{gamma} dell'esaclorocicloesano), largamente utilizzato prima degli anni '80, non e' stato fino ad oggi adeguatamente valutato per un possibile rischio riproduttivo a lungo termine. In questa rassegna e' stata pertanto

  7. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  8. Evaluation of toxicity of biorational insecticides against larvae of the alfalfa weevil

    Directory of Open Access Journals (Sweden)

    Gadi V.P. Reddy

    Full Text Available The alfalfa weevil, Hypera postica (Coleoptera: Curculionidae, is a major pest of alfalfa Medicago sativa L. (Fabaceae. While H. postica usually causes the most damage before the first cutting, in summer of 2015 damaging levels of the pest persisted in Montana well after the first harvest of alfalfa. Although conventional insecticides can control H. postica, these chemicals have adverse effects on non-target organisms including pollinators and natural enemy insects. In this context, use of biorational insecticides would be the best alternative options, as they are known to pose less risk to non-target organisms. We therefore examined the six commercially available biorational insecticides against H. postica under laboratory condition: Mycotrol® ESO (Beauveria bassiana GHA, Aza-Direct® (Azadirachtin, Met52® EC (Metarhizium brunneum F52, Xpectro OD® (B. bassiana GHA + pyrethrins, Xpulse OD® (B. bassiana GHA + Azadirachtin and Entrust WP® (spinosad 80%. Concentrations of 0.1, 0.5, 1.0, and 2.0 times the lowest labelled rates were tested for all products. However, in the case of Entrust WP, additional concentrations of 0.001 and 0.01 times the lowest label rate were also assessed. Mortality rates were determined at 1–9 days post treatment. Based on lethal concentrations and relative potencies, this study clearly showed that Entrust was the most effective, causing 100% mortality within 3 days after treatment among all the tested materials. With regard to other biorational, Xpectro was the second most effective insecticide followed by Xpulse, Aza-Direct, Met52, and Mycotrol. Our results strongly suggested that these biorational insecticides could potentially be applied for H. postica control. Keywords: Low risk insecticides, Insect pathogenic fungi, Efficacy, Lethal concentration, Mortality rate

  9. Evaluation of Insecticides Susceptibility and Malaria Vector Potential of Anopheles annularis s.l. and Anopheles vagus in Assam, India.

    Directory of Open Access Journals (Sweden)

    Sunil Dhiman

    Full Text Available During the recent past, development of DDT resistance and reduction to pyrethroid susceptibility among the malaria vectors has posed a serious challenge in many Southeast Asian countries including India. Current study presents the insecticide susceptibility and knock-down data of field collected Anopheles annularis sensu lato and An. vagus mosquito species from endemic areas of Assam in northeast India. Anopheles annularis s.l. and An. vagus adult females were collected from four randomly selected sentinel sites in Orang primary health centre (OPHC and Balipara primary health centre (BPHC areas, and used for testing susceptibility to DDT, malathion, deltamethrin and lambda-cyhalothrin. After insecticide susceptibility tests, mosquitoes were subjected to VectorTest™ assay kits to detect the presence of malaria sporozoite in the mosquitoes. An. annularis s.l. was completely susceptible to deltamethrin, lambda-cyhalothrin and malathion in both the study areas. An. vagus was highly susceptible to deltamethrin in both the areas, but exhibited reduced susceptibility to lambda-cyhalothrin in BPHC. Both the species were resistant to DDT and showed very high KDT50 and KDT99 values for DDT. Probit model used to calculate the KDT50 and KDT99 values did not display normal distribution of percent knock-down with time for malathion in both the mosquito species in OPHC (p<0.05 and An. vagus in BPHC (χ2 = 25.3; p = 0.0, and also for deltamethrin to An. vagus in BPHC area (χ2 = 15.4; p = 0.004. Minimum infection rate (MIR of Plasmodium sporozoite for An. vagus was 0.56 in OPHC and 0.13 in BPHC, while for An. annularis MIR was found to be 0.22 in OPHC. Resistance management strategies should be identified to delay the expansion of resistance. Testing of field caught Anopheles vectors from different endemic areas for the presence of malaria sporozoite may be useful to ensure their role in malaria transmission.

  10. Plant uptake of MBOCA (4,4'-methylene-bis (2-chloroaniline)). [Brassica oleracea L. ; Phaseolus vulgaris L. ; Beta vulgaris L. ; Sorghum vulgare Pers. ; Dactylis glomerata L. ; Daucus carrota L

    Energy Technology Data Exchange (ETDEWEB)

    Voorman, R; Penner, D

    1986-09-01

    (/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.

  11. Effets de l'exposition à un insecticide carbamate, le carbofuran, sur les performances de jeunes stades de brochet (Esox lucius L., 1758 : résultats préliminaires

    Directory of Open Access Journals (Sweden)

    AMBLARD G.

    1998-07-01

    Full Text Available Des lots de jeunes brochets au stade embryon libre, stabulés dans des béchers en verre, ont été exposés en conditions statiques à des solutions (0-250 µg.L-1 de carbofuran, un insecticide carbamate inhibiteur de l'activité de l'acétylcholinestérase (AchE. A partir de 10 µg.L-1, une inhibition significative de l'activité globale de l'AchE des embryons libres a été constatée. A partir de 50 µg.L-1, une diminution significative de la hauteur moyenne de fixation des embryons libres sur les parois des béchers a été observée. L'exposition au carbofuran n'a pas eu d'effet significatif sur le nombre de proies zooplanctoniques ingérées par les jeunes brochets parvenus au début de la phase larvaire ; une diminution de ce paramètre en fonction de concentrations croissantes de carbofuran a cependant été enregistrée. A 250 µg.L-1 , la résorption de la vésicule vitelline ne s'effectuant plus que très partiellement, les embryons libres exposés ne se sont pas transformés en larves. Cette étude montre que l'exposition à des concentrations sublétales de carbofuran est susceptible d'affecter le développement ontogénétique et les performances de jeunes stades de brochet. Un approfondissement de ces travaux est envisagé dans différentes directions.

  12. Using ichthyotoxic plants as bioinsecticide: A literature review

    Directory of Open Access Journals (Sweden)

    J. N. ANDRADE

    2015-12-01

    Full Text Available ABSTRACTSome ichthyotoxic plants are study object aiming to discover promising substances in the field of Biotechnology, in search of plant extracts which can be used or even transformed into natural insecticides. This paper presents a bibliographical survey in order to check the traditional use of ichthyotoxic plants as bioinsecticide. Among the plants identified as ichthyotoxic, the most cited in traditional use are those from the genera Derris, Serjania, Lonchocarpus, Magonia, and Tephrosia. The survey suggests that ichthyotoxic plant extracts can contain classes of chemical compounds such as isoflavonoids and tannins with a bioinsecticidal effect and, thus, they can be used in Biotechnology, contributing to reduce the use of synthetic insecticides that present a high toxicity level.

  13. Resistance irrelevant CYP417A2v2 was found degrading insecticide in Laodelphax striatellus.

    Science.gov (United States)

    Miah, Mohammad Asaduzzaman; Elzaki, Mohammed Esmail Abdalla; Han, Zhaojun

    2017-07-01

    Cytochrome P450 monooxygenases (CYPs) usually overexpressed in resistant strain were found involved in oxidative detoxification of insecticides. In this study, an investigation was conducted to confirm if resistance irrelevant CYPs which were not overexpressed in resistant strain before, were capable of degrading insecticides. Three resistance irrelevant CYPs viz. CYP417A2v2, CYP425A1v2, and CYP4DJ1 from CYP4 family of Laodelphax striatellus were randomly selected for experiments. CYP417A2v2 and CYP425A1v2 were found expressed successfully in Sf9 cell line while CYP4DJ1 was not expressed successfully and out of two expressed CYPs, only CYP417A2v2 showed its efficient catalytic activity. For catalytic activity, three traditional model probe substrates and five insecticides were assayed. For the probe substrates screened, p -nitroanisole and ethoxycoumarin were preferentially metabolized by CYP417A2v2 (specific activity 3.76 ± 1.22 and 1.63 ± 0.37 nmol min -1  mg protein -1 , respectively) and they may be potential diagnostic probes for this enzyme. Among insecticides, only imidacloprid was efficiently degraded by CYP417A2v2. Incubation of imidacloprid with CYP417A2v2 of L. striatellus and subsequent HPLC, LC-MS, and MS/MS analysis revealed the formation of imidacloprid metabolites, that is, 4' or 5'hydroxy-imidacloprid by hydroxylation. This result implies the exemption of CYPs character that it is not always, all the CYPs degrading insecticides being selected and overexpressed in resistant strains and the degrading CYPs without mutations to upregulate could be candidates during insecticide resistance evolution. This characterization of individual insect CYPs in insecticide degradation can provide insight for better understand of insecticide resistance development.

  14. Synthesis, herbicidal, fungicidal and insecticidal evaluation of 3-(dichlorophenyl)- isocoumarins and (±)-3-(dichlorophenyl)-3,4-dihydroisocoumarins

    International Nuclear Information System (INIS)

    Qadeer, Ghulam; Rama, Nasim Hasan; Fan, Zhi-Jin; Liu, Bin; Liu, Xiu-Feng

    2007-01-01

    This is the first report showing that 3-(dichlorophenyl)isocoumarins and (±)-3,4-dihydroisocoumarins are plant and plant fungus growth inhibitors. 3-Dichlorophenylisocoumarins were synthesized by condensation of homophthalic acid with dichlorobenzoyl chlorides. The alkaline hydrolysis of these isocoumarins afforded keto acids. Racemic 3-(Dichlorophenyl)-3,4-dihydroisocoumarins were obtained by reduction of keto acids to racemic hydroxy acids, followed by cyclodehydration using acetic anhydride. The herbicidal, fungicidal and insecticidal activities of the synthesized compounds have been evaluated. Some of the synthesized compounds show excellent herbicidal and fungicidal activities but none of the synthesized compounds presented any insecticidal effects on the test insects. The findings of this study suggest that isocoumarins and related compounds may serve as lead compounds towards the design of bioactive herbicides and fungicides. (author)

  15. Characterization of heat shock protein 70 transcript from Nilaparvata lugens (Stål): Its response to temperature and insecticide stresses.

    Science.gov (United States)

    Lu, Kai; Chen, Xia; Liu, Wenting; Zhang, Zhichao; Wang, Ying; You, Keke; Li, Yue; Zhang, Rongbin; Zhou, Qiang

    2017-10-01

    The brown planthopper, Nilaparvata lugens, possesses a strong adaptability to extreme temperature and insecticide stresses. Heat shock proteins (Hsps) are highly conserved molecular chaperones and play a pivotal role in response to various environmental stresses in insects. However, little is known about the response of Hsps to stresses in N. lugens. In the present study, an inducible Hsp70 (NlHsp70) was isolated from this insect and transcriptional expression patterns of NlHsp70 under temperature and insecticide stresses were analyzed. The full-length of NlHsp70 was 2805bp with an open reading frame (ORF) of 1896bp, showing high homology to its counterparts in other species. Expression of NlHsp70 was not altered by heat shock for 1h, nor following recovery from thermal stress. Conversely, decreased expression of NlHsp70 was observed in response to cold shock. In addition, the expression of NlHsp70 increased after imidacloprid exposure. RNA interference experiment combined with insecticide injury assay also demonstrated that NlHsp70 was essential for resistance against insecticide exposure. These observations indicated that NlHsp70 was an important gene involved in the resistance or tolerance to environmental stresses in N. lugens. Interestingly, weak changes in mRNA expression levels of two thermal-inducible Hsp genes, NlHsp90 and NlHsc70 were observed in imidacloprid-exposed N. lugens adults, suggesting that different Hsps may respond differential to the extreme temperature and insecticide stresses. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. EFFECT OF EXTRACTS FROM GERANIACEAE PLANTS ON PIERIS BRASSICAE L.

    Directory of Open Access Journals (Sweden)

    MARIA WAWRZYNIAK

    2010-06-01

    Full Text Available The conducted studies comprised the analyses of activity of extracts derived from selected plants of the Geranium family on some processes of large white butterfly (Pieris brassicae development (oviposition, survival of eggs and caterpillar feeding. The results proved that all tested extracts showed activity against large white butterfly. Geranium pratense L. and Geranium senquineum L. showed better activity than other Geranium plants. Water extracts from these species protected cabbage plants against laying eggs, while applied on eggs caused their mortality. Alcohol and water extracts from G. pratense L. and water extracts from G. senquineum L. increased an amount of food put on mass gain of caterpillars.

  17. Identification of Insecticidal Constituents of the Essential Oil of Acorus calamus Rhizomes against Liposcelis bostrychophila Badonnel

    Directory of Open Access Journals (Sweden)

    Shu Shan Du

    2013-05-01

    Full Text Available The aim of this research was to determine the chemical composition of the essential oil of Acorus calamus rhizomes, its insecticidal activity against the booklouse, (Liposcelis bostrychophila and to isolate any insecticidal constituents from the essential oil. The essential oil of A. calamus rhizomes was obtained by hydrodistillation and analyzed by GC-FID and GC-MS. A total of 32 components of the essential oil of A. calamus rhizomes was identified and the principal compounds in the essential oil were determined to be α-asarone (50.09%, (E-methylisoeugenol (14.01%, and methyleugenol (8.59%, followed by β-asarone (3.51%, α-cedrene (3.09% and camphor (2.42%. Based on bioactivity-guided fractionation, the three active constituents were isolated from the essential oil and identified as methyleugenol, (E-methylisoeugenol and α-asarone. The essential oil exhibited contact toxicity against L. bostrychophila with an LD50 value of 100.21 µg/cm2 while three constituent compounds, α-asarone, methyleugenol, and (E-methylisoeugenol had LD50 values of 125.73 µg/cm2, 103.22 µg/cm2 and 55.32 µg/cm2, respectively. Methyleugenol and (E-methylisoeugenol possessed fumigant toxicity against L. bostrychophila adults with LC50 values of 92.21 μg/L air and 143.43 μg/L air, respectively, while the crude essential oil showed an LC50 value of 392.13 μg/L air. The results indicate that the essential oil of A. calamus rhizomes and its constituent compounds have potential for development into natural fumigants/insecticides for control of the booklice.

  18. Insecticidal Activity and Chemical Composition of the Morinda lucida Essential Oil against Pulse Beetle Callosobruchus maculatus

    Directory of Open Access Journals (Sweden)

    Moses S. Owolabi

    2014-01-01

    Full Text Available Insecticidal activity of essential oil extracted from Morinda lucida was tested on pulse beetle Callosobruchus maculatus, which is a pest that causes serious damage to several pulses. The insecticidal activity was compared with two pesticides, Phostoxin and Primo-ban-20. 120 mixed sex adult C. maculatus were introduced, along with 30 g of cowpeas. Four concentrations (0.40, 0.20, 0.10, and 0.05 μg/mL of the M. lucida essential oil, Phostoxin, and Primo-ban-20 were tested. Essential oil chemical composition was analyzed by GC-MS. M. lucida essential oil showed a high toxicological effect, producing 100% mortality after 72 hours at a dose of 0.20 μg/mL. M. lucida essential oil had a potent insecticidal activity (LC90 = 0.629 μg/mL compared to both pesticides, Phostoxin (LC90 = 0.652 μg/mL and Primo-ban-20 (LC90 = 0.726 μg/mL, at 24 h. The main compounds of the essential oil were the oxygenated monoterpenoids, 1,8-cineole (43.4%, and α-terpinyl acetate (14.5%, and the monoterpene hydrocarbons, mostly sabinene (8.2% and β-pinene (4.0%. Results clearly indicate that M. lucida essential oil can be used as an effective alternative for pulse beetle C. maculatus control, and it could be tested against other pulse beetles affecting Asia and Africa and throughout the world, thereby reducing use of synthetic pesticides.

  19. Insecticide toxicity to Trichogramma pretiosum (Hymenoptera: Trichogrammatidae) females and effect on descendant generation.

    Science.gov (United States)

    Vianna, Ulysses R; Pratissoli, Dirceu; Zanuncio, José C; Lima, Eraldo R; Brunner, Jay; Pereira, Fabrício F; Serrão, José E

    2009-02-01

    The effect of nine insecticides used in tomato production was evaluated on adults of two Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae) populations from Rive and Afonso Cláudio, Espírito Santo State, Brazil. The experiment was developed in an acclimatized chamber at 25 +/- 1 degrees C, 70 +/- 10% relative humidity and 14 h photophase. Eggs of Anagasta kuehniella (Lepidoptera: Pyralidae), previously immersed in insecticides solutions were offered to females of both T. pretiosum populations. Bacillus thuringiensis, lufenuron and triflumuron had lowest negative effects on parasitism and viability of individuals of these populations; however, abamectin and pyrethroids (betacyflurin 50 and 125 g/l and esfenvalerate) insecticides reduced parasitism rates. T. pretiosum emerged from A. kuehniella eggs treated with esfenvalerate but were not able to parasitize non treated eggs of this host. B. thuringiensis, lufenuron and triflumuron may be used in integrated pest management programs to control tomato pests, because they have moderated negative effect on parasitoid wasps.

  20. Molecular modelling studies of kdr mutations in voltage gated sodium channel revealed significant conformational variations contributing to insecticide resistance.

    Science.gov (United States)

    Yellapu, Nanda Kumar; Gopal, Jeyakodi; Kasinathan, Gunasekaran; Purushothaman, Jambulingam

    2018-06-01

    Voltage gated sodium channels (VGSC) of mosquito vectors are the primary targets of dichlorodiphenyltrichloroethane (DDT) and other synthetic pyrethroids used in public health programmes. The knockdown resistant (kdr) mutations in VGSC are associated with the insecticide resistance especially in Anophelines. The present study is aimed to emphasize and demarcate the impact of three kdr-mutations such as L1014S, L1014F and L1014H on insecticide resistance. The membrane model of sodium transport domain of VGSC (STD-VGSC) was constructed using de novo approach based on domain and trans-membrane predictions. The comparative molecular modelling studies of wild type and mutant models of STD-VGSC revealed that L1014F mutant was observed to be near native to the wild type model in all the respects, but, L1014S and L1014H mutations showed drastic variations in the energy levels, root mean square fluctuations (RMSF) that resulted in conformational variations. The predicted binding sites also showed variable cavity volumes and RMSF in L1014S and L1014H mutants. Further, DDT also found be bound in near native manner to wild type in L1014F mutant and with variable orientation and affinities in L1014S and L1014H mutants. The variations and fluctuations observed in mutant structures explained that each mutation has its specific impact on the conformation of VGSC and its binding with DDT. The study provides new insights into the structure-function-correlations of mutant STD-VGSC structures and demonstrates the role and effects of kdr mutations on insecticide resistance in mosquito vectors.

  1. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  2. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  3. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  4. Effet du mode de conservation de l'huile de Jatropha curcas L. sur son efficacité dans la lutte contre les principaux insectes ravageurs du niébé (Vigna unguiculata (L. Walp. au Niger

    Directory of Open Access Journals (Sweden)

    Abdoul Habou, Z.

    2014-01-01

    Full Text Available Influence of the Conservation Mode of Jatropha curcas L. oil on its Efficacy in the Control of Major Insect Pests of Cowpea (Vigna unguiculata (L. Walp in Niger. Jatropha curcas oil has an insecticidal activity harnessed by the farmers in Niger. In this study, we compared the insecticidal activity of two batches of oil conserved during 70 days, one exposed to light and the other kept in the dark. The insecticidal efficacy was evaluated in a field with three concentrations (5, 10 and 15% trial on the main pests of Cowpea (Vigna unguiculata (L. Walp and in a laboratory test on Megalurothrips sjostedti Trybon (Thysanoptera: Thripidae with different concentrations of crude oil (50; 100; 150 and 200 µl. No difference in insecticidal effect was found between the two modes of oil conservation, both in the laboratory and in the field. In the field, regardless of the mode of conservation, the concentrations of 10% of J. curcas oil enables a reduction of over than 80% of thrips, aphids, and bugs compared to the control. Its increased seeds yield more than 50%. The concentration of 15% gives an insecticidal effect comparable to that of the reference treatment (deltaméthrine but induces phytotoxicity symptoms on the leaves of Cowpea.

  5. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  6. Insecticidal Constituents from Buddlej aalbiflora Hemsl.

    Science.gov (United States)

    Zhang, Xiu-Yun; Shen, Jing; Zhou, Yu; Wei, Zhi-Ping; Gao, Jin-Ming

    2017-06-01

    Eleven known compounds, deoxymikanolide (1), 1,3-dihydroxyxanthone (2), kumatakenin (3), apigenin (4), chrysin (5), kaempferol (6), Iso-kaempferol (7), luteolin (8), luteolin-3',4'-dimethylether-7-O-β-glucoside (9), luteolin-7-O-β-glucoside (10) and quercetin (11) were identified in MeOH extract of Buddleja albiflora Hemsl (Oleaceae). These compounds (each, 1, 0.5 and 0.25 mg mL -1 ) were tested for insecticidal activity against 3rd and 4th-instar larvae of Plutella xylostella, 3rd-instar larvae of Mythimna separata and 3rd-instar larvae of Macrosiphoniella sanborni. The lowest 50% anti-feedant concentration (AFC 50 ) against P. xylostella and 50% lethal concentration (LC 50 ) against P. xylostella and M. sanborni were observed as 0.0058, 0.0046 and 3.4048 mg L -1 , respectively.

  7. Chemical composition and insecticidal activity of the essential oil from Helichrysum faradifani endemic to Madagascar.

    Science.gov (United States)

    Benelli, Giovanni; Pavela, Roman; Rakotosaona, Rianasoambolanoro; Randrianarivo, Emmanuel; Nicoletti, Marcello; Maggi, Filippo

    2017-11-03

    Helichrysum faradifani (Asteraceae) is a perennial shrub growing in rocky and sandy places of Madagascar. The plant is used in the Malagasy traditional medicine as a wound-healing agent, disinfectant and for the treatment of syphilis, diarrhea, cough and headache. In the present work, we analysed the chemical composition of the essential oil distilled from the aerial parts of H. faradifani by GC-MS and evaluated its insecticidal activity against 2nd, 3rd and 4th instar larvae of the lymphatic filariasis vector Culex quinquefasciatus by acute toxicity assays. The most sensitive were 2nd instar (LC 50  = 85.7 μL L -1 ) larvae. For the 3rd and 4th instar larvae, the estimated LC 50 were 156.8 and 134.1 μL L -1 , respectively. Monoterpene hydrocarbons (51.6%) were the major fraction of the essential oil, with the bicyclic α-fenchene (35.6%) as the predominant component. Sesquiterpene hydrocarbons (34.0%) were the second major group characterising the oil, with γ-curcumene (17.7%) as the most abundant component.

  8. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  9. Mapping insecticide resistance and characterization of resistance mechanisms in Anopheles arabiensis (Diptera: Culicidae) in Ethiopia.

    Science.gov (United States)

    Alemayehu, Eba; Asale, Abebe; Eba, Kasahun; Getahun, Kefelegn; Tushune, Kora; Bryon, Astrid; Morou, Evangelia; Vontas, John; Van Leeuwen, Thomas; Duchateau, Luc; Yewhalaw, Delenasaw

    2017-09-02

    The emergence and spread of insecticide resistance in the major African malaria vectors Anopheles gambiae (s.s.) and An. arabiensis may compromise the current vector control interventions and threatens the global malaria control and elimination efforts. Insecticide resistance was monitored in several study sites in Ethiopia from 2013 to 2015 using papers impregnated with discriminating concentrations of DDT, deltamethrin, bendiocarb, propoxur, malathion, fenitrothion and pirimiphos-methyl, following the WHO insecticide susceptibility test procedure. Mosquitoes sampled from different localities for WHO bioassay were morphologically identified as An. gambiae (s.l.) using standard taxonomic keys. Samples were identified to species using species-specific polymerase chain reaction (PCR) and screened for the presence of target site mutations L1014F, L1014S and N1575Y in the voltage gated sodium channel (VGSC) gene and G119S in the acethylcholinesterase (AChE) gene using allele-specific PCR. Biochemical assays were performed to assess elevated levels of acetylcholinesterases, carboxylcholinesterases, glutathione-S-transferases (GSTs) and cytochrome P450s monooxygenases in wild populations of An. arabiensis, compared to the fully susceptible Sekoru An. arabiensis laboratory strain. Populations of An. arabiensis were resistant to DDT and deltamethrin but were susceptible to fenitrothion in all the study sites. Reduced susceptibility to malathion, pirimiphos-methyl, propoxur and bendiocarb was observed in some of the study sites. Knockdown resistance (kdr L1014F) was detected in all mosquito populations with allele frequency ranging from 42 to 91%. Elevated levels of glutathione-S-transferases (GSTs) were detected in some of the mosquito populations. However, no elevated levels of monooxygenases and esterases were detected in any of the populations assessed. Anopheles arabiensis populations from all surveyed sites in Ethiopia exhibited resistance against DDT and pyrethroids

  10. Insecticide Resistance and Metabolic Mechanisms Involved in Larval and Adult Stages of Aedes aegypti Insecticide-Resistant Reference Strains from Cuba.

    Science.gov (United States)

    Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario

    2014-12-01

    Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.

  11. Prioritizing stream types according to their potential risk to receive crop plant material--A GIS-based procedure to assist in the risk assessment of genetically modified crops and systemic insecticide residues.

    Science.gov (United States)

    Bundschuh, Rebecca; Kuhn, Ulrike; Bundschuh, Mirco; Naegele, Caroline; Elsaesser, David; Schlechtriemen, Ulrich; Oehen, Bernadette; Hilbeck, Angelika; Otto, Mathias; Schulz, Ralf; Hofmann, Frieder

    2016-03-15

    Crop plant residues may enter aquatic ecosystems via wind deposition or surface runoff. In the case of genetically modified crops or crops treated with systemic pesticides, these materials may contain insecticidal Bt toxins or pesticides that potentially affect aquatic life. However, the particular exposure pattern of aquatic ecosystems (i.e., via plant material) is not properly reflected in current risk assessment schemes, which primarily focus on waterborne toxicity and not on plant material as the route of uptake. To assist in risk assessment, the present study proposes a prioritization procedure of stream types based on the freshwater network and crop-specific cultivation data using maize in Germany as a model system. To identify stream types with a high probability of receiving crop materials, we developed a formalized, criteria-based and thus transparent procedure that considers the exposure-related parameters, ecological status--an estimate of the diversity and potential vulnerability of local communities towards anthropogenic stress--and availability of uncontaminated reference sections. By applying the procedure to maize, ten stream types out of 38 are expected to be the most relevant if the ecological effects from plant-incorporated pesticides need to be evaluated. This information is an important first step to identifying habitats within these stream types with a high probability of receiving crop plant material at a more local scale, including accumulation areas. Moreover, the prioritization procedure developed in the present study may support the selection of aquatic species for ecotoxicological testing based on their probability of occurrence in stream types having a higher chance of exposure. Finally, this procedure can be adapted to any geographical region or crop of interest and is, therefore, a valuable tool for a site-specific risk assessment of crop plants carrying systemic pesticides or novel proteins, such as insecticidal Bt toxins, expressed

  12. Insecticidal, antimicrobial and antioxidant activities of bulb extracts of Allium sativum.

    Science.gov (United States)

    Meriga, Balaji; Mopuri, Ramgopal; MuraliKrishna, T

    2012-05-01

    To evaluate the insecticidal, antimicrobial and antioxidant activities of bulb extracts of Allium sativum (A. sativum). Dried bulbs of A. sativum were extracted with different solvents and evaluated for insecticidal, antimicrobial and antioxidant activities. Aqueous and methanol extracts showed highest insecticidal activity (mortality rate of 81% and 64% respectively) against the larvae of Spodoptera litura (S. litura) at a concentration of 1 000 ppm. With regard to antimicrobial activity, aqueous extract exhibited antibacterial activity against gram positive (Bacillus subtilis, Staphylococcus aureu,) and gram negative (Escherichia coli and Klebsiella pneumonia) strains and antifungal activity against Candida albicans. While methanol extract showed antimicrobial activity against all the tested micro organisms except two (Staphylococcus aureus and Candida albicans), the extracts of hexane, chloroform and ethyl acetate did not show any anti microbial activity. Minimum inhibitory concentration of aqueous and methanol extracts against tested bacterial and fungal strains was 100-150 μg/mL. Antioxidant activity of the bulb extracts was evaluated in terms of inhibition of free radicals by 2, 2'-diphenly-1-picrylhydrazyl. Aqueous and methanol extracts exhibited strong antioxidant activity (80%-90% of the standard). Antioxidant and antimicrobial activity of A. sativum against the tested organisms therefore, provides scientific basis for its utilization in traditional and folk medicine. Also, our results demonstrated the insecticidal efficacy of A. sativum against S. litura, a polyphagous insect. Copyright © 2012 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  13. Assessment of two medicinal plants, Psidium guajava L. and Achillea millefolium L., in in vitro and in vivo assays

    Directory of Open Access Journals (Sweden)

    Teixeira Rosangela de Oliveira

    2003-01-01

    Full Text Available The use of medicinal plants by the general population is an old and still widespread practice, which makes studies of their genotoxicity essential. Psidium guajava L. and Achillea millefolium L. are examples of plants commonly used in popular medicine. P. guajava L. is indicated for diarrhea and also as an antiseptic, while A. millefolium L. is indicated as an analgesic, antispasmodic, digestive, diuretic, antiseptic, astringent, emollient, wound healer and hemorrhoid medication. The aim of this study was to determine the effects of the infusions of these two plant species on chromosomes and the cell cycle. Leaves from the plants were used to prepare infusions, in the same manner as teas, but at two different concentrations. Allium cepa L. root-tip cells (P. guajava L. - 2.62 and 26.2 mg/mL, and A. millefolium L. - 3.5 and 35.0 mg/mL and Wistar rat bone marrow cells (P. guajava L. - 2.62 and 26.2 mg/100g body weight, and A. millefolium L. - 3.5 and 35.0 mg/100g body weight were used as in vivo plant and animal test systems, respectively. Human peripheral blood lymphocytes (P. guajava L. - 0.262 and 2.62 mg/mL culture medium, and A. millefolium L. - 0.35 and 3.5 mg/mL culture medium were used as in vitro test system. The P. guajava L. infusion at the higher concentration caused a statistically significant inhibition of cellular division in the onion root-tip cells, not observed in onion root-tip cells treated with A. millefolium L. No statistically significant alterations were found, as compared to untreated controls, in either the cell cycle or the number of chromosome alterations, after treatments with either plant, in rat cells or in cultured human lymphocytes. These results regarding the cytotoxicity and mutagenicity of these plants provide valuable information about the safety of using them as therapeutic agents.

  14. Comparative analysis of mosquito (Diptera: Culicidae: Aedes aegypti Liston) responses to the insecticide Temephos and plant derived essential oil derived from Piper betle L.

    Science.gov (United States)

    Vasantha-Srinivasan, Prabhakaran; Senthil-Nathan, Sengottayan; Ponsankar, Athirstam; Thanigaivel, Annamalai; Edwin, Edward-Sam; Selin-Rani, Selvaraj; Chellappandian, Muthiah; Pradeepa, Venkatraman; Lija-Escaline, Jalasteen; Kalaivani, Kandaswamy; Hunter, Wayne B; Duraipandiyan, Veeramuthu; Al-Dhabi, Naif Abdullah

    2017-05-01

    Resistance to treatments with Temephos or plant derived oil, Pb-CVO, between a field collected Wild Strain (WS) and a susceptible Laboratory Strain (LS) of Ae. aegypti were measured. The Temephos (0.1mg/L) showed the greatest percentage of mosquito mortality compared to Pb-CVO (1.5mg/L) in LS Ae. aegypti. However, WS Ae. aegypti was not significantly affected by Temephos (0.1mg/L) treatment compare to the Pb-CVO (1.5mg/L). However, both strains (LS and WS) when treated with Pb-CVO (1.5mg/L) displayed steady larval mortality rate across all instars. The LC 50 of Temephos was 0.027mg in LS, but increased in WS to 0.081mg/L. The LC 50 of Pb-CVO treatment was observed at concentrations of 0.72 and 0.64mg/L for LS and WS strains respectively. The enzyme level of α- and β-carboxylesterase was reduced significantly in both mosquito strains treated with Pb-CVO. Whereas, there was a prominent deviation in the enzyme ratio observed between LS and WS treated with Temephos. The GST and CYP450 levels were upregulated in the LS, but decreased in WS, after treatment with Temephos. However, treatment with Pb-CVO caused both enzyme levels to increase significantly in both the strains. Visual observations of the midgut revealed cytotoxicity from sub-lethal concentrations of Temephos (0.04mg/L) and Pb-CVO (1.0mg/L) in both strains of Ae. aegypti compared to the control. The damage caused by Temephos was slightly less in WS compared to LS mosquito strains. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. The insecticide lindane. Identification of possible risks for human reproduction; L'insetticida lindano. Identificazione dei rischi possibili per la riproduzione umana

    Energy Technology Data Exchange (ETDEWEB)

    Traina, M.E.; Urbani, E. [Istituto Superiore di Sanita' , Lab. di Igiene Ambientale, Rome (Italy); Rescia, M.; Mantovani, A. [Istituto Superiore di Sanita' , Lab. di Tossicologia Comparata e Ecotossicologia, Rome (Italy)

    2001-07-01

    A growing international concern exists about the potential harm to human reproduction caused by pollutants able to interfere with the endocrine system. Particular interest is addressed to organochlorine pesticides persisting in the environment and organisms; such compounds are extensively studied for their adverse effects on reproductive functions and development of laboratory animals. The insecticide lindane (the {gamma}-isomer of hexachlorocyclohexane), widely used before the 80s, has yet to be adequately evaluated as regards the possible reproductive risk. The present report contains a critical revision of the available scientific literature about lindane effects on the male and female reproductive system, pregnancy and development. Besides, the possible higher exposure periods to this pesticide (years 60s-70s) have been determined through the analysis of the lindane products consumed and the evaluation of the active ingredient levels in the environment and in the tissues and biological fluids, with particular regard to Italy. The present review aims at supporting further toxicological and epidemiological studies to assess the possible reproductive risk posed by environmental and professional exposure to chlorinated insecticides. [Italian] L'ipotesi che l'esposizione a sostanze inquinanti in grado di alterare l'equilibrio del sistema endocrino possa avere effetti sulla riproduzione umana e sullo sviluppo e' attualmente oggetto d'interesse nella comunita' scientifica. Particoalre attenzione e' stata indirizzata ai pesticidi organoclorurati a lunga persistenza nell'ambiente e negli organismi, per i quali esistono numerose evidenze di effetti nocivi per la riproduzione, negli studi di tossicologia sperimentale. L'insetticida lindano (l'isomero-{gamma} dell'esaclorocicloesano), largamente utilizzato prima degli anni '80, non e' stato fino ad oggi adeguatamente valutato per un possibile rischio

  16. Bioimpact of application of pesticides with plant growth hormone (gibberellic acid on target and non-target microorganisms

    Directory of Open Access Journals (Sweden)

    Mohamed Abdullah Al Abboud

    2014-12-01

    Full Text Available The objective of this investigation was to determine the impacts of fungicide, insecticide, plant growth hormone (gibberellic acid on soil microbiota, and the growth characteristics of Aspergillus flavus. In the fungicide or insecticide mixed with plant growth hormone treated soil sample, the total viable number of soil microbiota was found to be higher than that of the soil treated with fungicide or insecticide alone. Moderate effect of insecticide used on the total number of fungi was observed. On the other hand the effect of insecticide on soil bacteria was more than effect of fungicide, and the negative effect of fungicide on soil bacteria was observed particularly at latent periods (15 and 20 days of application. A great sensitivity to fungicide and insecticide was observed in the case of nitrogen fixing bacteria. At 15 days after fungicide and insecticide application the adverse effect was found. Morphological deformations were clear in A. flavus cultivated on medium containing fungicide, the fungus failed to form conidiospores, conidiophores and vesicles. Intermediate and terminal outgrowths like blisters and terminal vesicle originate from hyphae. The addition of plant growth hormone reduced the effect of fungicide on fungus.

  17. Effect and fate of lindane in maize plant

    International Nuclear Information System (INIS)

    Bennaceur, M.; Ghezal, F.; Klaa, K.

    1992-10-01

    The fate and effect of lindane in maize plant, soil and predators were studied following insecticide application under field conditions. Respectively 84,2% and 93,3% of lindane residues were lost after 2 and 4 months in soil after treatment. About 90% of the insecticide was lost after one month in maize plant. Lindane residues were present in maize grains (0,205ppm). Lindane decreases the density of many predators in soils such as species of collembola, coccinellidae, formicidae, coleoptera

  18. Influence of gamma rays irradiation to chlorphyriphos insecticides residues in grapes (vitis vinifera L.)

    International Nuclear Information System (INIS)

    Chairul, S.M.

    2012-01-01

    Simulation methods to determination of chlorphyriphos insecticides residue in grapes cause effect gamma rays, was done. Fruits of grapes soaked with chlorpyriphos insecticide solution high level concentrated (100 ppm; 200 ppm; and 300 ppm) for 3 (three minutes). The treatment of the sample was direct of extraction after soaks; extract after storage for one week after soak, and extract after soak after storage for one week after irradiation at 0.5 kGy; 1.0 kGy; and 1.5 kGy dose. Extraction methods using ethyl acetate solvent, and using sodium sulphate as to dryed water level in grapes, and then extractan was injected to chromatography gas use electron capture detector. The result indicated that occur of descent of chlorpyrifos residues from eachs soaked consequence at storage for one week was amount 7,55; 8,42; and 18,88% respectively, while of consequence irradiation of gamma ray at 0,5 kGy doses, will be descent of chlorpyrifos residues in amount 13,90; 19,16; and 52,79% respectively, and at 1,0 kGy doses irradiation will be descent in amount 34,45; 36,15 and 49,79%, respectively. (author)

  19. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  20. Risk assessment of various insecticides used for management of Asian citrus psyllid, Diaphorina citri in Florida citrus, against honey bee, Apis mellifera.

    Science.gov (United States)

    Chen, Xue Dong; Gill, Torrence A; Pelz-Stelinski, Kirsten S; Stelinski, Lukasz L

    2017-04-01

    The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), is a major pest of citrus trees worldwide. A wide variety of insecticides are used to manage D. citri populations within citrus groves in Florida. However, in areas shared by citrus growers and beekeepers the use of insecticides may increase the risks of Apis mellifera  L. (Hymenoptera: Apidae) loss and contaminated honey. The objective of this research was to determine the environmental toxicity of insecticides, spanning five different modes of action used to control D. citri, to A. mellifera. The insecticides investigated were imidacloprid, fenpropathrin, dimethoate, spinetoram and diflubenzuron. In laboratory experiments, LD 50 values were determined and ranged from 0.10 to 0.53 ng/μl for imidacloprid, fenpropathrin, dimethoate and spinetoram. LD 50 values for diflubenzuron were >1000 ng/μl. Also, a hazard quotient was determined and ranged from 1130.43 to 10893.27 for imidacloprid, fenpropathrin, dimethoate, and spinetoram. This quotient was mellifera 3 and 7 days after application. Spinetoram and imidacloprid were moderately toxic to A. mellifera at the recommended rates for D. citri. Diflubenzuron was not toxic to A. mellifera in the field as compared with untreated control plots. Phenoloxidase (PO) activity of A. mellifera was higher than in untreated controls when A. mellifera were exposed to 14 days old residues. The results indicate that diflubenzuron may be safe to apply in citrus when A. mellifera are foraging, while most insecticides used for management of D. citri in citrus are likely hazardous under various exposure scenarios.

  1. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  2. Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae

    Directory of Open Access Journals (Sweden)

    Andréa Roveré Franz

    2011-03-01

    Full Text Available Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae. Stored grains are subject to losses in quality nutritional value and in sanitation from the time they are stored to the time they are consumed. Botanical insecticides may offer an alternative solution for pest control. The objective was to test the insecticidal properties of the essential oils of Cymbopogon citratus (leaf, Zingiber officinale (root and Mentha sp. (leaf. The efficacy of these oils was tested to control the rice weevil, S. oryzae, using hydrodistillation. Chemical analysis of the essential oils was carried out by gas chromatography. Major components of C. citratus were geranial (48% and neral (31%, of Z. officinale were α-zingibereno (13%, geranial (16%, neral (10% and α-farneseno (5% and of Mentha sp. was menthol (92%. Bioassays were carried out by fumigation and topical application. In topical application assays, the essential oil of C. citratus had greater toxicity (LC50 0.027 µL mL-1 and shorter exposure time than the oils of the other two plants. After 24 h and 48 h, 70% and 100% mortality of S. oryzae occurred, respectively. In fumigation assays, essential oil of Z. officinale had a lower LC50 (1.18 µL cm-2 and 70% mortality after 24 h exposure. Therefore, we recommend the use of essential oils of C. citratus and Z. officinale to control the rice weevil S. oryzae.

  3. Synergistic action of octopamine receptor agonists on the activity of selected novel insecticides for control of dengue vector Aedes aegypti (Diptera: Culicidae) mosquito.

    Science.gov (United States)

    Ahmed, Mohamed Ahmed Ibrahim; Vogel, Christoph Franz Adam

    2015-05-01

    Studying insecticide resistance in mosquitoes has attracted the attention of many scientists to elucidate the pathways of resistance development and to design novel strategies in order to prevent or minimize the spread and evolution of resistance. Here, we tested the synergistic action of piperonyl butoxide (PBO) and two octopamine receptor (OR) agonists, amitraz (AMZ) and chlordimeform (CDM) on selected novel insecticides to increase their lethal action on the fourth instar larvae of Aedes aegypti L. However, chlorfenapyr was the most toxic insecticide (LC50 = 193, 102, and 48 ng/ml, after 24, 48, and 72 h exposure, respectively) tested. Further, PBO synergized all insecticides and the most toxic combinatorial insecticide was nitenpyram even after 48 and 72 h exposure. In addition, OR agonists significantly synergized most of the selected insecticides especially after 48 and 72 h exposure. The results imply that the synergistic effects of amitraz are a promising approach in increasing the potency of certain insecticides in controlling the dengue vector Ae. aegypti mosquito. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Atividade inseticida das plantas e aplicações: revisão Insecticidal activities of plants and applications: a review

    Directory of Open Access Journals (Sweden)

    J.C.R. Corrêa

    2011-01-01

    Full Text Available A utilização de agrotóxicos tem contribuído para o aumento da produção agrícola, entretanto, o uso incorreto e indiscriminado durante várias décadas levou à acumulação de resíduos tóxicos em alimentos, contaminação da água e do solo, intoxicação de produtores rurais, seleção de pragas resistentes, entre muitos outros problemas. Ultimamente tem crescido o interesse por substâncias que apresentem menor risco à saúde humana e ao ambiente, além da demanda crescente por produtos alimentícios saudáveis e isentos de resíduos de agrotóxicos. Felizmente são inúmeras as plantas que apresentam atividade inseticida, devendo ser estudadas e introduzidas, quando possível, nas propriedades agrícolas como forma alternativa de controle de pragas. Neste trabalho, é apresentada revisão sobre o uso de plantas com propriedades inseticidas e repelentes, evidenciando o potencial dessa ferramenta no manejo de pragas. Para a inserção definitiva e segura de produtos botânicos no mercado, mais estudos ainda são necessários.The use of pesticides has contributed to the increased agricultural production; however, the incorrect and indiscriminate use over several decades has led to the accumulation of toxic residues in food, contamination of water and soil, poisoning of farmers, selection of resistant pests, besides several other problems. Lately, the interest for substances posing lower risk to the human health and the environment has increased, in addition to the increasing demand for healthy food products free from pesticide residues. Fortunately a large number of plants have insecticidal activity and should be studied and introduced, whenever possible, into farms as an alternative means to control pests. In this study, a review of the use of plants with insecticidal or repellent potential is presented, evidencing the potential of this tool in pest management. For a definitive and safe insertion of botanical products into the market

  5. Identification of insecticidal principals from cucumber seed oil against the yellow fever mosquito, Aedes aegypti

    Science.gov (United States)

    The yellow fever mosquito, Aedes aegypti, is one of the most medically important mosquito species due to its ability to spread viruses of yellow fever, dengue fever and Zika in humans. In this study, the insecticidal activity of seventeen plant essential oils were evaluated to toxicity by topical a...

  6. Volatile aldehydes are promising broad-spectrum postharvest insecticides.

    Science.gov (United States)

    Hammond, D G; Rangel, S; Kubo, I

    2000-09-01

    A variety of naturally occurring aldehydes common in plants have been evaluated for their insecticidal activity and for phytotoxicity to postharvest fruits, vegetables, and grains. Twenty-nine compounds were initially screened for their activity against aphids on fava bean leaf disks. Application under reduced pressure (partial vacuum) for the first quarter of fumigation increased insecticidal activity severalfold. The 11 best aldehydes were assayed against aphids placed under the third leaf of whole heads of iceberg lettuce using the same two-tier reduced-pressure regime, which caused no additional detriment to the commodity over fumigation at atmospheric pressure. Phytotoxicity to naked and wrapped iceburg lettuce, green and red table grapes, lemon, grapefruit, orange, broccoli, avocado, cabbage, pinto bean, and rice at doses that killed 100% of aphids was recorded for three promising fumigants: propanal, (E)-2-pentenal, and 2-methyl-(E)-2-butenal. These three compounds have excellent potential as affordable postharvest insect control agents, killing 100% of the aphids with little or no detectable harm to a majority of the commodities tested. Preliminary assays indicate that similar doses are also effective against mealybugs, thrips, and whitefly.

  7. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  8. L-Py: an L-System simulation framework for modeling plant development based on a dynamic language

    Directory of Open Access Journals (Sweden)

    Frederic eBoudon

    2012-05-01

    Full Text Available The study of plant development requires increasingly powerful modeling tools to help understand and simulate the growth and functioning of plants. In the last decade, the formalism of L-systems has emerged as a major paradigm for modeling plant development. Previous implementations of this formalism were made based on static languages, i.e. languages that require explicit definition of variable types before using them. These languages are often efficient but involve quite a lot of syntactic overhead, thus restricting the flexibility of use for modelers. In this work, we present an adaptation of L-systems to the Python language, a popular and powerful open-license dynamic language. We show that the use of dynamic language properties makes it possible to enhance the development of plant growth models: i by keeping a simple syntax while allowing for high-level programming constructs, ii by making code execution easy and avoiding compilation overhead iii allowing a high level of model reusability and the building of complex modular models iv and by providing powerful solutions to integrate MTG data-structures (that are a common way to represent plants at several scales into L-systems and thus enabling to use a wide spectrum of computer tools based on MTGs developed for plant architecture. We then illustrate the use of L-Py in real applications to build complex models or to teach plant modeling in the classroom.

  9. Insecticidal activity of two proteases against Spodoptera frugiperda larvae infected with recombinant baculoviruses

    Science.gov (United States)

    2010-01-01

    Background Baculovirus comprise the largest group of insect viruses most studied worldwide, mainly because they efficiently kill agricutural insect pests. In this study, two recombinant baculoviruses containing the ScathL gene from Sarcophaga peregrina (vSynScathL), and the Keratinase gene from the fungus Aspergillus fumigatus (vSynKerat), were constructed. and their insecticidal properties analysed against Spodoptera frugiperda larvae. Results Bioassays of third-instar and neonate S. frugiperda larvae with vSynScathL and vSynKerat showed a decrease in the time needed to kill the infected insects when compared to the wild type virus. We have also shown that both recombinants were able to increase phenoloxidase activity in the hemolymph of S. frugiperda larvae. The expression of proteases in infected larvae resulted in destruction of internal tissues late in infection, which could be the reason for the increased viral speed of kill. Conclusions Baculoviruses and their recombinant forms constitute viable alternatives to chemical insecticides. Recombinant baculoviruses containing protease genes can be added to the list of engineered baculoviruses with great potential to be used in integrated pest management programs. PMID:20587066

  10. Efficacy of Silk Channel Injections with Insecticides for Management of Lepidoptera Pests of Sweet Corn.

    Science.gov (United States)

    Sparks, A N; Gadal, L; Ni, X

    2015-08-01

    The primary Lepidoptera pests of sweet corn (Zea mays L. convar. saccharata) in Georgia are the corn earworm, Helicoverpa zea (Boddie), and the fall armyworm, Spodoptera frugiperda (J. E. Smith). Management of these pests typically requires multiple insecticide applications from first silking until harvest, with commercial growers frequently spraying daily. This level of insecticide use presents problems for small growers, particularly for "pick-your-own" operations. Injection of oil into the corn ear silk channel 5-8 days after silking initiation has been used to suppress damage by these insects. Initial work with this technique in Georgia provided poor results. Subsequently, a series of experiments was conducted to evaluate the efficacy of silk channel injections as an application methodology for insecticides. A single application of synthetic insecticide, at greatly reduced per acre rates compared with common foliar applications, provided excellent control of Lepidoptera insects attacking the ear tip and suppressed damage by sap beetles (Nitidulidae). While this methodology is labor-intensive, it requires a single application of insecticide at reduced rates applied ∼2 wk prior to harvest, compared with potential daily applications at full rates up to the day of harvest with foliar insecticide applications. This methodology is not likely to eliminate the need for foliar applications because of other insect pests which do not enter through the silk channel or are not affected by the specific selective insecticide used in the silk channel injection, but would greatly reduce the number of applications required. This methodology may prove particularly useful for small acreage growers. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Evaluation of Insecticides and Agril Polyester Cover against Whitefly (Bemisia Tabaci Gennadius in Tomato Crops

    Directory of Open Access Journals (Sweden)

    K.M. Azam

    1996-01-01

    Full Text Available Field experiments were conducted on tomato crops over a two year period to evaluate the efficacy of six insecticides, viz., triazophos, phosphamidon, dimethoate, buprofezin and Aflix (endosulfan + dimethoate each at 0.05% and Repelin (plant insecticide at 1% concentration along With a cultural treatment by covering the plants with Agril (a polyester material for the control of whitefly, Bemisia tabaci. The insecticides were applied eight times at weekly interval immediately after transplantation. The whitefly eggs,  nymphal population counts and the per cent incidence of tomato leaf curl virus (TLCV were recorded every week for eight weeks in all the treatments including untreated control. The incidence of whitefly was more severe in the second year (i.e, 1992-93 as compared to the previous season. Among the various treatments, the Agril cover, a newly introduced cultural practice, recorded the least incidence of whitefly and of TLCV. The average of counts of eggs were 0.0 and 5.47 and of nymphs 0.54 and 0.58 per 10 leaflets and TLCV were 4.32% and 4.76% in Agril cover treatment during the first and second year, respectively. Among the insecticides tested only Aflix recorded less incidence of the pest, being 3.46 and 30.4 eggs per 10 leaflets and 0.94 and 5.34 nymphs per 10 leaflets during the two years of study, respectively. The other treatments were less effective in reducing pest and disease incidence. The crop under Agril-cover recorded the maximum yield of 34.57 and 26.15 t/ha of tomatoes as compared to 16.48 and 10.82 t/ha in control during the first and second year, respectively.

  12. Effects of Soil Water Deficit on Insecticidal Protein Expression in Boll Shells of Transgenic Bt Cotton and the Mechanism

    Directory of Open Access Journals (Sweden)

    Xiang Zhang

    2017-12-01

    Full Text Available This study was conducted to investigate the effects of soil water deficit on insecticidal protein expression in boll shells of cotton transgenic for a Bt gene. In 2014, Bt cotton cultivars Sikang 1 (a conventional cultivar and Sikang 3 (a hybrid cultivar were planted in pots and five soil water content treatments were imposed at peak boll stage: 15% (G1, 35% (G2, 40% (G3, 60% (G4, and 75% field capacity (CK, respectively. Four treatments (G2, G3, G4, and CK were repeated in 2015 in the field. Results showed that the insecticidal protein content of boll shells decreased with increasing water deficit. Compared with CK, boll shell insecticidal protein content decreased significantly when soil water content was below 60% of maximum water holding capacity for Sikang 1 and Sikang 3. However, increased Bt gene expression was observed when boll shell insecticidal protein content was significantly reduced. Activity assays of key enzymes in nitrogen metabolism showed that boll shell protease and peptidase increased but nitrogen reductase and glutamic-pyruvic transaminase (GPT decreased. Insecticidal protein content exhibited significant positive correlation with nitrogen reductase and GPT activities; and significant negative correlation with protease and peptidase activities. These findings suggest that the decrease of insecticidal protein content associated with increasing water deficit was a net result of decreased synthesis and increased decomposition.

  13. New knowledge for yield, composition and insecticidal activity ofessential oils obtained from the aerial parts or seeds of fennel(Foeniculum vulgare Mill.)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda

    2016-01-01

    Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016

  14. Determination of the organochlorine insecticide residues in Lonicera japonica Thunb. By gas chromatography%气相色谱法测定金银花中有机氯杀虫剂残留量

    Institute of Scientific and Technical Information of China (English)

    向增旭; 赵维佳; 高山林

    2005-01-01

    Using gas chromatography (GC), the organochlorine insecticide residues were determined in Lonicera japonica Thunb. flowers. The results showed that the amount of organochlorine insecticide in L. japonica flowers collected from Fengqiu in He' nan Province, Pingyi in Shandong Province was less than 0.01 mg·kg-1. The average recoveries added in samples were 93.54% -98.85%, RSD≤6.8%. It shows that the amount of organochlorine insecticide in L. japonica flowers accords with the demands of traditional Chinese medicine production.

  15. Lectin cDNA and transgenic plants derived therefrom

    Science.gov (United States)

    Raikhel, Natasha V.

    2000-10-03

    Transgenic plants containing cDNA encoding Gramineae lectin are described. The plants preferably contain cDNA coding for barley lectin and store the lectin in the leaves. The transgenic plants, particularly the leaves exhibit insecticidal and fungicidal properties.

  16. Residual Efficacy of Field-Applied Permethrin, d-Phenothrin, and Resmethrin on Plant Foliage Against Adult Mosquitoes

    Science.gov (United States)

    2008-01-01

    the American Mosquito Control Association, 24(4):543–549, 2008 Copyright E 2008 by The American Mosquito Control Association, Inc. 543 Report...southern red cedar (Juniperus silicicola J. Silba), beauty berry (Callicarpa americana L.), and bay trees ( Persea spp.). Insecticides Permethrin...plant foliage to adult 544 JOURNAL OF THE AMERICAN MOSQUITO CONTROL ASSOCIATION VOL. 24, NO. 4 Cx. quinquefasciatus. A single leaf was exposed to 10–15

  17. Creams formulated with Ocimum gratissimum L. and Lantana camara L. crude extracts and fractions as mosquito repellents against Aedes aegypti L. (Diptera: Culicidae).

    Science.gov (United States)

    Keziah, Ezeike Amarachi; Nukenine, Elias Nchiwan; Danga, Simon Pierre Yinyang; Younoussa, Lame; Esimone, Charles Okechukwu

    2015-01-01

    Mosquitoes are the most deadly vectors of parasites that cause diseases such as malaria, yellow fever, and filariasis. In view of the recent increased interest in developing plant origin insecticides as an alternative to chemical insecticides, the objective of this study was to determine the repellent activity of creams formulated with methanol crude extract (MCE), hexane fraction (HF), and ethyl acetate fractions (EAFs) of Ocimum gratissimum and Lantana camara leaves in single and combined actions against female Aedes aegypti. Evaluation was carried out in the net cages (30 by 30 by 30 cm) containing 60 blood-starved female mosquitoes each and were assayed in the laboratory condition following World Health Organization 2009 protocol. All formulations (single and mixture) were applied at 2, 4, 6, and 8 mg/cm(2) in the exposed area of human hands. Only acetone + white soft paraffin served as negative control and odomos (12% DEET) as positive control. All the formulations presented good protection against mosquito bites without any allergic reaction by the human volunteers. The repellent activity was dependent on the strength of the extracts and fractions. Among the tested formulations, the maximum protection time was observed in MCE (120 min) and EAF (150 min) of O. gratissimum; MCE:MCE (150 min) and HF:HF (120 min) mixtures of both plants. In addition, MCE:MCE and HF:HF mixtures from both plants showed possible synergistic effect. From the results, the combination of O. gratissimum and L. camara to formulate natural mosquito repellent using small amount of extracts can be encouraging to be an alternative to conventional DEET. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  18. Influences of aquatic plants on the fate of the pyrethroid insecticide lambda-cyhalothrin in aquatic environments.

    Science.gov (United States)

    Hand, L H; Kuet, S F; Lane, M C; Maund, S J; Warinton, J S; Hill, I R

    2001-08-01

    Aquatic exposure assessments for pesticides are generally based on laboratory studies performed in water alone or water sediment systems. Although aquatic macrophytes, which include a variety of bryophytes, macroalgae, and angiosperms, can be a significant component of many aquatic ecosystems, their impact on pesticide fate is generally not included in exposure assessments. To investigate the influence of aquatic plants on the fate and behavior of the pyrethroid insecticide lambda (lambda)-cyhalothrin, two laboratory experiments (to assess adsorption and degradation) and an indoor microcosm study (to assess fate under semirealistic conditions) were conducted. In the laboratory studies, adsorption to macrophytes was extensive and essentially irreversible, and degradation occurred rapidly by cleavage of the ester bond. In the indoor microcosm, which contained water, sediment, and macrophytes from a pond, degradation was also rapid, with DT50 and DT90 values of less than 3 and 19 h, respectively, for dissipation from the water column and of less than 3 and 56 h, respectively, for the whole system. For adsorptive and readily degraded pesticides like lambda-cyhalothrin, we conclude that macrophytes have considerable influence on fate and behavior in surface waters.

  19. Chemical Compositions and Insecticidal Activities of Alpinia kwangsiensis Essential Oil against Lasioderma serricorne

    Directory of Open Access Journals (Sweden)

    Yan Wu

    2015-12-01

    Full Text Available The essential oil obtained by hydrodistillation from Alpinia kwangsiensis rhizomes was investigated by GC-MS. A total of 31 components representing 92.45% of the oil were identified and the main compounds in the oil were found to be camphor (17.59%, eucalyptol (15.16%, β-pinene (11.15% and α-pinene (10.50%. These four compounds were subsequently isolated and the essential oil and four isolated compounds exhibited potent insecticidal activity against Lasioderma serricorne adults. During the assay, it was shown that the essential oil exhibited both potential contact (LD50 = of 24.59 μg/adult and fumigant (LC50 = of 9.91 mg/L air toxicity against Lasioderma serricorne. The study revealed that the insecticidal activity of the essential oil can be attributed to the synergistic effects of its diverse major components, which indicates that oil of Alpinia kwangsiensis and its isolated compounds have potential to be developed into natural insecticides to control insects in stored grains and traditional Chinese medicinal materials.

  20. Systemic insecticides (neonicotinoids and fipronil): trends, uses, mode of action and metabolites : Environmental Science and Pollution Research

    NARCIS (Netherlands)

    Simon-Delso, N.; Amaral-Rogers, V.; Belzunces, L.P.; Bonmatin, J.M.; Chagnon, M.; Downs, C.; Furlan, L.; Gibbons, D.W.; Giorio, C.; Girolami, V.; Goulson, D.; Kreutzweiser, D.P.; Krupke, C.H.; Liess, M.; Long, E.; McField, M.; Mineau, P.; Mitchell, E.A.D.; Morrissey, C.A.; Noome, D.A.; Pisa, L.; Settele, J.; Stark, J.D.; Tapparo, A.; Van Dyck, H.; Van Praagh, J.; Van der Sluijs, J.P.; Whitehorn, P.R.; Wiemers, M.

    2015-01-01

    Since their discovery in the late 1980s, neonicotinoid pesticides have become the most widely used class of insecticides worldwide, with large-scale applications ranging from plant protection (crops, vegetables, fruits), veterinary products, and biocides to invertebrate pest control in fish farming.

  1. Cry64Ba and Cry64Ca, Two ETX/MTX2-Type Bacillus thuringiensis Insecticidal Proteins Active against Hemipteran Pests.

    Science.gov (United States)

    Liu, Yonglei; Wang, Yinglong; Shu, Changlong; Lin, Kejian; Song, Fuping; Bravo, Alejandra; Soberón, Mario; Zhang, Jie

    2018-02-01

    Genetically modified crops that express insecticidal Bacillus thuringiensis (Bt) proteins have become a primary approach for control of lepidopteran (moth) and coleopteran (beetle) pests that feed by chewing the plants. However, the sap-sucking insects (Hemiptera) are not particularly susceptible to Bt toxins. In this study, we describe two Cry toxins (Cry64Ba and Cry64Ca) from Bt strain 1012 that showed toxicity against two important hemipteran rice pests, Laodelphax striatellus and Sogatella furcifera Both of these proteins contain an ETX/MTX2 domain and share common sequence features with the β-pore-forming toxins. Coexpression of cry64Ba and cry64Ca genes in the acrystalliferous Bt strain HD73 - resulted in high insecticidal activity against both hemipteran pests. No toxicity was observed on other pests such as Ostrinia furnacalis , Plutella xylostella , or Colaphellus bowringi Also, no hemolytic activity or toxicity against cancer cells was detected. Binding assays showed specific binding of the Cry64Ba/Cry64Ca toxin complex to brush border membrane vesicles isolated from L. striatellus Cry64Ba and Cry64Ca are Bt Cry toxins highly effective against hemipteran pests and could provide a novel strategy for the environmentally friendly biological control of rice planthoppers in transgenic plants. IMPORTANCE In Asia, rice is an important staple food, whose production is threatened by rice planthoppers. To date, no effective Bacillus thuringiensis (Bt) protein has been shown to have activity against rice planthoppers. We cloned two Bt toxin genes from Bt strain 1012 that showed toxicity against small brown planthoppers ( Laodelphax striatellus ) and white-backed planthoppers ( Sogatella furcifera ). To our knowledge, the proteins encoded by the cry64Ba and cry64Ca genes are the most efficient insecticidal Bt Cry proteins with activity against hemipteran insects reported so far. Cry64Ba and Cry64Ca showed no toxicity against some lepidopteran or coleopteran pests

  2. The larvicidal effects of black pepper (Piper nigrum L.) and piperine against insecticide resistant and susceptible strains of Anopheles malaria vector mosquitoes.

    Science.gov (United States)

    Samuel, Michael; Oliver, Shüné V; Coetzee, Maureen; Brooke, Basil D

    2016-04-26

    Insecticide resistance carries the potential to undermine the efficacy of insecticide based malaria vector control strategies. Therefore, there is an urgent need for new insecticidal compounds. Black pepper (dried fruit from the vine, Piper nigrum), used as a food additive and spice, and its principal alkaloid piperine, have previously been shown to have larvicidal properties. The aim of this study was to investigate the larvicidal effects of ground black pepper and piperine against third and fourth instar Anopheles larvae drawn from several laboratory-reared insecticide resistant and susceptible strains of Anopheles arabiensis, An. coluzzii, An. gambiae, An. quadriannulatus and An. funestus. Larvae were fed with mixtures of standard larval food and either ground black pepper or piperine in different proportions. Mortality was recorded 24 h after black pepper and 48 h after piperine were applied to the larval bowls. Black pepper and piperine mixtures caused high mortality in the An. gambiae complex strains, with black pepper proving significantly more toxic than piperine. The An. funestus strains were substantially less sensitive to black pepper and piperine which may reflect a marked difference in the feeding habits of this species compared to that of the Gambiae complex or a difference in food metabolism as a consequence of differences in breeding habitat between species. Insecticide resistant and susceptible strains by species proved equally susceptible to black pepper and piperine. It is concluded that black pepper shows potential as a larvicide for the control of certain malaria vector species.

  3. Neonicotinoid insecticide removal by prairie strips in row-cropped watersheds with historical seed coating use

    Science.gov (United States)

    Hladik, Michelle L.; Bradbury, Steven; Schulte, Lisa A.; Helmers, Matthew; Witte, Christopher; Kolpin, Dana W.; Garrett, Jessica D.; Harris, Mary

    2017-01-01

    Neonicotinoids are a widely used class of insecticides that are commonly applied as seed coatings for agricultural crops. Such neonicotinoid use may pose a risk to non-target insects, including pollinators and natural enemies of crop pests, and ecosystems. This study assessed neonicotinoid residues in groundwater, surface runoff water, soil, and native plants adjacent to corn and soybean crop fields with a history of being planted with neonicotinoid-treated seeds from 2008-2013. Data from six sites with the same crop management history, three with and three without in-field prairie strips, were collected in 2015-2016, 2-3 years after neonicotinoid (clothianidin and imidacloprid) seed treatments were last used. Three of the six neonicotinoids analyzed were detected in at least one environmental matrix: the two applied as seed coatings on the fields (clothianidin and imidacloprid) and another widely used neonicotinoid (thiamethoxam). Sites with prairie strips generally had lower concentrations of neonicotinoids: groundwater and footslope soil neonicotinoid concentrations were significantly lower in the sites with prairie strips than those without; mean concentrations for groundwater were 11 and 20 ng/L (p = 0.048) and <1 and 6 ng/g (p = 0.0004) for soil, respectively. Surface runoff water concentrations were not significantly (p = 0.38) different for control sites (44 ng/L) or sites with prairie strips (140 ng/L). Consistent with the decreased inputs of neonicotinoids, concentrations tended to decrease over the sampling timeframe. Two sites recorded concentration increases, however, potentially due to disturbance of previous applications or influence from nearby fields where use of seed treatments continued. There were no detections (limit of detection: 1 ng/g) of neonicotinoids in the foliage or roots of plants comprising prairie strips, indicating a low likelihood of exposure to pollinators and other insects visiting these plants following the cessation of seed

  4. Seed priming with extracts of Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L.) plant parts in the control of root rot fungi and growth of plants

    International Nuclear Information System (INIS)

    Rafi, H.; Dawar, S.; Zaki, M.J.

    2015-01-01

    Seed priming with plant extracts and chemicals has been used as an important growth enhancement tool in crop plants. In this research, an attempt was made to understand the mechanism of various seed priming treatments on greenhouse-grown okra (Abelmoschus esculentus (L.) Moench.), sunflower (Helianthus annuus L.), peanut (Arachis hypogaea L.) and chickpea (Cicer arietinum L.) for the control of root infecting fungi like Rhizoctonia solani (Kn), Fusarium spp. and Macrophomina phaseolina (Tassi) Goid by plant parts extracts (stem, leaves and seeds) of Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L) at different time intervals (5, 10, 20, 40 minutes). Results showed significant suppression of root rot fungi and significantly enhanced the growth parameters like shoot length, root length, shoot weight and root weight. Seed-priming with A. nilotica and S. mukorossi leaves extract for 10 minutes time interval was found to be effective for the control of root rot fungi and growth of all tested leguminous and non-leguminous plants. (author)

  5. Fumigant toxicity of plant essential oils against Camptomyia corticalis (Diptera: Cecidomyiidae).

    Science.gov (United States)

    Kim, Jun-Ran; Haribalan, Perumalsamy; Son, Bong-Ki; Ahn, Young-Joon

    2012-08-01

    The toxicity of 98 plant essential oils against third instars of cecidomyiid gall midge Camptomyia corticalis (Loew) (Diptera: Cecidomyiidae) was examined using a vapor-phase mortality bioassay. Results were compared with that of a conventional insecticide dichlorvos. Based on 24-h LC50 values, all essential oils were less toxic than dichlorvos (LC50, 0.027 mg/cm3). The LC50 of caraway (Carum carvi L.) seed, armoise (Artemisia vulgaris L.), clary sage (Salvia sclarea L.), oregano (Origanum vulgare L.), lemongrass [Cymbopogon citratus (DC.) Stapf], niaouli (Melaleuca viridiflora Gaertner), spearmint (Mentha spicata L.), cassia especial (Cinnamomum cassia Nees ex Blume), Dalmatian sage (Salvia offcinalis L.), red thyme (Thymus vulgaris L.), bay [Pimenta racemosa (P. Mill.) J.W. Moore], garlic (Allium sativum L.), and pennyroyal (Mentha pulegium L.) oils is between 0.55 and 0.60 mg/cm3. The LC50 of cassia (C. cassia, pure and redistilled), white thyme (T. vulgaris), star anise (Illicium verum Hook.f.), peppermint (Mentha X piperita L.), wintergreen (Gaultheria procumbens L.), cinnamon (Cinnamomum zeylanicum Blume) bark, sweet marjoram (Origanum majorana L.), Roman chamomile [Chamaemelum nobile (L.) All.], eucalyptus (Eucalyptus globulus Labill.), rosemary (Rosmarinus officinalis L.),Virginian cedarwood (Juniperus virginiana L.), pimento berry [Pimenta dioica (L.) Merr.], summer savory (Satureja hortensis L.), lavender (Lavandula angustifolia Mill.), and coriander (Coriandrum sativum L.) oils is between 0.61 and 0.99 mg/cm3. All other essential oils tested exhibited low toxicity to the cecidomyiid larvae (LC50, >0.99 mg/cm3). Global efforts to reduce the level of highly toxic synthetic insecticides in the agricultural environment justify further studies on the active essential oils as potential larvicides for the control of C. corticalis populations as fumigants with contact action.

  6. Baseline Susceptibility of Filarial Vector Culex quinquefasciatus (Diptera: Cu-licidae to Five Insecticides with Different Modes of Action in Southeast of Iran

    Directory of Open Access Journals (Sweden)

    Yaser Salim-Abadi

    2017-12-01

    Full Text Available Background: Culex quinquefasciatus (Diptera: Culicidae is an important vector for many human diseases. The aim of this study was to evaluate the susceptibility level of larval and adult stages of Cu. quinquefasciatus to different groups of WHO recommended insecticides for vector control.Methods: Larval stages of the Culex mosquitoes were collected from their natural habitats in Rafsanjan County at Kerman Province, southeast of Iran in 2016. Insecticide susceptibility status of adult female Cx. quinquefasciatus against DDT (4%, deltamethrin (0.05%, malathion 5%, and bendiocarb (0.1% were determined using WHO stand­ard insecticide susceptibility test. Additional test was carried out to determine the susceptibility status of larvae of Cx. quinquefasciatus to temephos. Bioassay data were analyzed by Probit program.Results: Cx. quinquefasciatus adults showed resistance to all four groups of the tested insecticides according to the WHO criteria for resistance evaluation. The lethal concentrations for 50% mortality (LC50 and 90% mortality (LC90 of temephos against Cx. quinquefasciatus larvae were 0.18mg/l and 0.78mg/l, respectively. This finding also con­firms resistance to temephos based on the WHO recommended instructions for resistance evaluation.Conclusion: Resistance to all groups of the tested insecticides should be considered for future vector control investi­gations in the study area.

  7. Systemic insecticides (neonicotinoids and fipronil): trends, uses, mode of action and metabolites

    OpenAIRE

    Simon-Delso, N.; Amaral-Rogers, V.; Belzunces, L. P.; Bonmatin, J. M.; Chagnon, M.; Downs, C.; Furlan, L.; Gibbons, D. W.; Giorio, C.; Girolami, V.; Goulson, D.; Kreutzweiser, D. P.; Krupke, C. H.; Liess, M.; Long, E.

    2014-01-01

    Since their discovery in the late 1980s, neonicotinoid pesticides have become the most widely used class of insecticides worldwide, with large-scale applications ranging from plant protection (crops, vegetables, fruits), veterinary products, and biocides to invertebrate pest control in fish farming. In this review, we address the phenyl-pyrazole fipronil together with neonicotinoids because of similarities in their toxicity, physicochemical profiles, and presence in the environment. Neonicoti...

  8. Effects of Botanical Insecticides on Hymenopteran Parasitoids: a Meta-analysis Approach.

    Science.gov (United States)

    Monsreal-Ceballos, R J; Ruiz-Sánchez, E; Ballina-Gómez, H S; Reyes-Ramírez, A; González-Moreno, A

    2018-02-10

    Botanical insecticides (BIs) are considered a valuable alternative for plant protection in sustainable agriculture. The use of both BIs and parasitoids are presumed to be mutually compatible pest management practices. However, there is controversy on this subject, as various studies have reported lethal and sublethal effects of BIs on hymenopteran parasitoids. To shed new light on this controversy, a meta-analytic approach of the effects of BIs on adult mortality, parasitism, and parasitoid emergence under laboratory conditions was performed. We show that BIs increased mortality, decreased parasitism, and decreased parasitoid emergence. Botanical insecticides derived from Nicotiana tabacum and Caceolaria andina were particulary lethal. Most of the parasitoid groups showed susceptibility to BIs, but the families Scelionidae and Ichneumonidae were not significantly affected. The negative effects of BIs were seen regardless of the type of exposure (topical, ingestion, or residual). In conclusion, this meta-analysis showed that under laboratory conditions, exposure of hymenopteran parasitoids to BIs had significant negative effects on adult mortality, parasitism, and parasitoid emergence.

  9. Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland.

    Science.gov (United States)

    Moore, M T; Cooper, C M; Smith, S; Cullum, R F; Knight, S S; Locke, M A; Bennett, E R

    2009-01-01

    Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides.

  10. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  11. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  12. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  13. Genomic adaptation to polyphagy and insecticides in a major East Asian noctuid pest.

    Science.gov (United States)

    Cheng, Tingcai; Wu, Jiaqi; Wu, Yuqian; Chilukuri, Rajendra V; Huang, Lihua; Yamamoto, Kohji; Feng, Li; Li, Wanshun; Chen, Zhiwei; Guo, Huizhen; Liu, Jianqiu; Li, Shenglong; Wang, Xiaoxiao; Peng, Li; Liu, Duolian; Guo, Youbing; Fu, Bohua; Li, Zhiqing; Liu, Chun; Chen, Yuhui; Tomar, Archana; Hilliou, Frederique; Montagné, Nicolas; Jacquin-Joly, Emmanuelle; d'Alençon, Emmanuelle; Seth, Rakesh K; Bhatnagar, Raj K; Jouraku, Akiya; Shiotsuki, Takahiro; Kadono-Okuda, Keiko; Promboon, Amornrat; Smagghe, Guy; Arunkumar, Kallare P; Kishino, Hirohisa; Goldsmith, Marian R; Feng, Qili; Xia, Qingyou; Mita, Kazuei

    2017-11-01

    The tobacco cutworm, Spodoptera litura, is among the most widespread and destructive agricultural pests, feeding on over 100 crops throughout tropical and subtropical Asia. By genome sequencing, physical mapping and transcriptome analysis, we found that the gene families encoding receptors for bitter or toxic substances and detoxification enzymes, such as cytochrome P450, carboxylesterase and glutathione-S-transferase, were massively expanded in this polyphagous species, enabling its extraordinary ability to detect and detoxify many plant secondary compounds. Larval exposure to insecticidal toxins induced expression of detoxification genes, and knockdown of representative genes using short interfering RNA (siRNA) reduced larval survival, consistent with their contribution to the insect's natural pesticide tolerance. A population genetics study indicated that this species expanded throughout southeast Asia by migrating along a South India-South China-Japan axis, adapting to wide-ranging ecological conditions with diverse host plants and insecticides, surviving and adapting with the aid of its expanded detoxification systems. The findings of this study will enable the development of new pest management strategies for the control of major agricultural pests such as S. litura.

  14. Chevilly Larue, L'Hay les Roses: twin geothermal plants

    International Nuclear Information System (INIS)

    Jeanson, E.

    1995-01-01

    The Chevilly Larue/L'Hay les Roses (Paris region, France) low energy geothermal plants are interconnected and thus represent the greatest geothermal heat network in Europe. The two plants are 2.5 km apart and supply 13000 collective lodgings in energy using a 60 km network with a 75 MW power. Gas or fuel auxiliary heating systems are used in winter to increase water temperature up to 105 C, but the part of energy released by geothermics remains of about 70 to 80%. The network will be extended in the next years to Fresnes and Villejuif neighbouring towns. In 1996, the SEMHACH company, which manage the two plants, will put into service a mixed electricity and heat production plant in L'Hay les Roses. (J.S.). 2 photos

  15. Identification of Insecticidal Constituents of the Essential Oil of Curcuma wenyujin Rhizomes Active against Liposcelis bostrychophila Badonnel

    Directory of Open Access Journals (Sweden)

    Shu Shan Du

    2012-10-01

    Full Text Available The aim of this research was to determine the chemical composition and insecticidal activity of the essential oil of Curcuma wenyujin Y.H. Chen et C. Ling rhizomes against the booklouse Liposcelis bostrychophila Badonnel and to isolate any insecticidal constituents from the essential oil. The essential oil of C. wenyujin rhizomes was obtained by hydrodistillation and analyzed by GC-MS. A total of 43 components of the essential oil were identified and the principal compounds in the essential oil were 1,8-cineole (15.26%, camphor (10.12%, germacrone (6.86%, β-elemene (6.33%, curzerene (6.70%, and β-elemenone (5.23%. followed by curzerenone (4.52%, curdione (4.45% and linalool (4.43%. Based on bioactivity-guided fractionation, the two main active constituents were isolated from the essential oil and identified as 1,8-cineole and camphor. The essential oil of C. wenyujin rhizomes exhibited contact toxicity against L. bostrychophila with an LD50 value of 208.85 µg/cm2. Camphor (LD50 = 207.26 µg/cm2 exhibited stronger contact toxicity than 1,8-cineole (LD50 = 1048.75 µg/cm2 against booklouse. The essential oil of C. wenyujin (LC50 = 2.76 mg/L air also possessed fumigant toxicity against L. bostrychophila, while the two constituents, camphor and 1,8-cineole had LC50 values of 1.03 mg/L air and 1.13 mg/L air, respectively. The results indicate that the essential oil of C. wenyujin rhizomes and its constituent compounds have potential for development as natural insecticides or fumigants for control of insects in stored grains.

  16. Eco-Friendly Insecticide Discovery via Peptidomimetics: Design, Synthesis, and Aphicidal Activity of Novel Insect Kinin Analogues.

    Science.gov (United States)

    Zhang, Chuanliang; Qu, Yanyan; Wu, Xiaoqing; Song, Dunlun; Ling, Yun; Yang, Xinling

    2015-05-13

    Insect kinin neuropeptides are pleiotropic peptides that are involved in the regulation of hindgut contraction, diuresis, and digestive enzyme release. They share a common C-terminal pentapeptide sequence of Phe(1)-Xaa(2)-Yaa(3)-Trp(4)-Gly(5)-NH2 (where Xaa(2) = His, Asn, Phe, Ser, or Tyr; Yaa(3) = Pro, Ser, or Ala). Recently, the aphicidal activity of insect kinin analogues has attracted the attention of researchers. Our previous work demonstrated that the sequence-simplified insect kinin pentapeptide analogue Phe-Phe-[Aib]-Trp-Gly-NH2 could retain good aphicidal activity and be the lead compound for the further discovery of eco-friendly insecticides which encompassed a broad array of biochemicals derived from micro-organisms and other natural sources. Using the peptidomimetics strategy, we chose Phe-Phe-[Aib]-Trp-Gly-NH2 as the lead compound, and we designed and synthesized three series, including 31 novel insect kinin analogues. The aphicidal activity of the new analogues against soybean aphid was determined. The results showed that all of the analogues exhibited aphicidal activity. Of particular interest was the analogue II-1, which exhibited improved aphicidal activity with an LC50 of 0.019 mmol/L compared with the lead compound (LC50 = 0.045 mmol/L) or the commercial insecticide pymetrozine (LC50 = 0.034 mmol/L). This suggests that the analogue II-1 could be used as a new lead for the discovery of potential eco-friendly insecticides.

  17. Mesoionic Pyrido[1,2-a]pyrimidinone Insecticides: From Discovery to Triflumezopyrim and Dicloromezotiaz.

    Science.gov (United States)

    Zhang, Wenming

    2017-09-19

    One of the greatest global challenges is to feed the ever-increasing world population. The agrochemical tools growers currently utilize are also under continuous pressure, due to a number of factors that contribute to the loss of existing products. Mesoionic pyrido[1,2-a]pyrimidinones are an unusual yet very intriguing class of compounds. Known for several decades, this class of compounds had not been systemically studied until we started our insecticide discovery program. This Account provides an overview of the efforts on mesoionic pyrido[1,2-a]pyridinone insecticide discovery, beginning from the initial high throughput screen (HTS) discovery to ultimate identification of triflumezopyrim (4, DuPont Pyraxalt) and dicloromezotiaz (5) for commercialization as novel insecticides. Mesoionic pyrido[1,2-a]pyrimidinones with a n-propyl group at the 1-position, such as compound 1, were initially isolated as undesired byproducts from reactions for a fungicide discovery program at DuPont Crop Protection. Such compounds showed interesting insecticidal activity in a follow-up screen and against an expanded insect species list. The area became an insecticide hit for exploration and then a lead area for optimization. At the lead optimization stage, variations at three regions of compound 1, i.e., side-chain (n-propyl group), substituents on the 3-phenyl group, and substitutions on the pyrido- moiety, were explored with many analogues prepared and evaluated. Breakthrough discoveries included replacing the n-propyl group with a 2,2,2-trifluoroethyl group to generate compound 2, and then with a 2-chlorothiazol-5-ylmethyl group to form compound 3. 3 possesses potent insecticidal activity not only against a group of hopper species, including corn planthopper (Peregrinus maidis (Ashmead), CPH) and potato leafhopper (Empoasca fabae (Harris), PLH), as well as two key rice hopper species, namely, brown planthopper (Nilaparvata lugens (Stål), BPH) and rice green leafhopper (Nephotettix

  18. EFICIÊNCIA DE NOVO INSETICIDA CARBAMATO NO CONTROLE QUÍMICO DA TRAÇA (Scrobipalpuloides absoluta Meyric1917 SOBRE TOMATEIRO (Lycopersicon esculentum, Mill THE EFFICIENCY OF NEW INSECTICIDE CARBAMATE IN CHEMICAL CONTROL OF TOMATO LEAFMINER (Scrobipalpuloides absoluta MEYRIC, 1917 IN TOMATO PLANTS (Lycopersicon esculentum, MILL

    Directory of Open Access Journals (Sweden)

    Leonardo Barros de Macêdo

    2007-09-01

    Full Text Available

    O experimento foi realizado na área de horticultura da Escola de Agronomia da Universidade Federal de Goiás, visando ao controle químico da traça do tomateiro (Scrobipalpuloides absoluta Meyric, 1917, no período de setembro a dezembro de 1995, para avaliar a eficiência do inseticida Onic 300 (Alanycarb nas dosagens de 1,0, 1,5 e 2,0 litros do produto formulado por ha, comparando-o com Cartap 500 BR (Cartap na dosagem de 2,4 kg/ha, Vertimec 18 CE (Abamectin na dosagem de 1,0 l/ha misturado a um óleo mineral e uma testemunha. Pelos resultados obtidos concluiu-se que todos os inseticidas utilizados controlaram eficientemente a traça em tomateiro até 8 dias após aplicação e que todos os tratamentos promoveram aumento de produtividade.

    PALAVRAS-CHAVE: Traça; Scrobipalpuloides absoluta; controle químico; tomateiro.

    The tomato leafminer (Scrobipalpuloides absoluta, a common pest of tomato plants, is known in many regions in Brazil. In order to determine the efficiency of new insecticide alanycarb, to control the tomato leafminer a field experiment was carried out in Goiânia, Goiás, Brazil. The treatments and dosage of the insecticides per hectare were: alanycarb 300: 1.0, 1.5 and 2.0 l; cartap 500 BR: 2.0 kg; abamectin 18 CE: 1.0 1 plus an untreated check. The results obtained in this experiment showed that all insecticides were efficient in controlling the tomato leafminer until 8 days after treatment application and they were able to increase productivity.

    KEY-WORDS: Scrobipalpuloides absoluta; tomato leafminer; chemical control.

  19. Anopheles coluzzii larval habitat and insecticide resistance in the island area of Manoka, Cameroon.

    Science.gov (United States)

    Etang, Josiane; Mbida Mbida, Arthur; Ntonga Akono, Patrick; Binyang, Jerome; Eboumbou Moukoko, Carole Else; Lehman, Leopold Gustave; Awono-Ambene, Parfait; Talipouo, Abdou; Ekoko Eyisab, Wolfgang; Tagne, Darus; Tchoffo, Romeo; Manga, Lucien; Mimpfoundi, Remy

    2016-05-20

    The effectiveness of Long-Lasting Insecticidal Nets and Indoor Residual Spraying in malaria vector control is threatened by vector resistance to insecticides. Knowledge of mosquito habitats and patterns of insecticide resistance would facilitate the development of appropriate vector control strategies. Therefore, we investigated An. coluzzii larval habitats and resistance to insecticides in the Manoka rural island area compared with the Youpwe suburban inland area, in Douala VI and II districts respectively. Anopheline larvae and pupae were collected from open water bodies in December 2013 and April 2014 and reared until adult emergence. Two to four day old emerging females were morphologically identified as belonging to the An. gambiae complex and used for WHO susceptibility tests with 4 % DDT, 0.75 % permethrin, and 0.05 % deltamethrin, with or without piperonyl butoxide (PBO) synergist. Control and surviving specimens were identified down to the species using a PCR-RFLP method. Survivors were genotyped for kdr L1014 mutations using Hot Oligonucleotide Ligation Assay. In both study sites, ponds, residual puddles, boats, and drains were identified as the major An. gambiae s.l. larval habitats. A total of 1397 females, including 784 specimens from Manoka and 613 from Youpwe, were used for resistance testing. The two mosquito populations displayed resistance to DDT, permethrin and deltamethrin, with variable mortality rates from 1 % to 90 %. The knock-down times were also significantly increased (at least 2.8 fold). Pre-exposure of mosquitoes to PBO did not impact on their mortality to DDT, conversely the mortality rates to permethrin and deltamethrin were significantly increased (7.56 ≤ X(2) ≤ 48.63, df = 1, p habitats have been identified, larval source management strategies may be trialed in this area as complementary vector control interventions.

  20. Chemical composition and insecticidal property of Myrsine stolonifera (Koidz.) walker (Family: Myrsinaceae) on Musca domestica (Diptera: Muscidae).

    Science.gov (United States)

    Wang, Xue Gui; Li, Qian; Jiang, Su Rong; Li, Pei; Yang, Ji Zhi

    2017-06-01

    Musca domestica is one of the most important pests of human health, and has developed strong resistance to many chemicals used for its control. One important approach for creating new pesticides is the exploration of novel compounds from plants. During a wide screening of plants with insecticidal properties that grow in southern China, we found that the methanolic extracts of Myrsine stolonifera had insecticidal activity against the adults of M. domestica. However, the insecticidal constituents and mechanisms of the M. stolonifera extracts remain unclear. The insecticidal components of the methanolic extracts of M. stolonifera were isolated with activity-guided fractionation. From the spectra of nuclear magnetic resonance (NMR) and mass spectrometry (MS), the compounds were identified as syringing (1), 2,6-dimethoxy-4-hydroxyphenol-1-O-β-d-glu (2), kaempferol-3-O-glu-rha-glu (3), and quercetin-3-O-glu-rha-glu (4). This study is the first to report the spectral data for compounds 3 and 4, and their LC 50 values were 0.52mg/g sugar and 0.36mg/g sugar 24h after treatment of the adults of M. domestica, respectively. Compounds 3 and 4 (LC 25 ) also inhibited the activities of the enzymes carboxylesterase, glutathione S-transferase, mixed function oxidase, and acetylcholine esterase of adult M. domestica, particularly mixed function oxidase and acetylcholine esterase. The cytotoxic effects of compounds 3 and 4 on cell proliferation, mitochondrial membrane potentials (MMP) and reactive oxygen species (ROS) were demonstrated on SL-1 cells. From the extracts of M. stolonifera, quercetin-3-O-glu-rha-glu and kaempferol-3-O-glu-rha-glu have displayed comparable toxicities to rotenone on M. domestica and also exhibited cytotoxic effects on SL-1 cells; therefore, the extracts of M. stolonifera and their compounds have potential as botanical insecticides to control M. domestica. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Identification of Repellent and Insecticidal Constituents from Artemisia mongolica Essential Oil against Lasioderma serricorne

    Directory of Open Access Journals (Sweden)

    Chunxue You

    2015-01-01

    Full Text Available The aims of this research were to determine the chemical composition and insecticidal and repellent activities of the Artemisia mongolica essential oil against Lasioderma serricorne and to isolate active constituents from the essential oil. The essential oil of A. mongolica was obtained by hydrodistillation and 36 components were identified with GC-MS. Eucalyptol (39.88%, (S-cis-verbenol (14.93%, 4-terpineol (7.20%, (−-camphor (6.02%, and α-terpineol (4.20% were found to be major components. With a further isolation process, five constituents obtained from the essential oil were identified as eucalyptol, verbenol, 4-terpineol, camphor, and α-terpineol. In the progress of assay, it showed that L. serricorne adults had different sensitivities to the crude essential oil and isolated constituents. 4-Terpineol exhibited strongest contact activity against L. serricorne, showing the LD50 value of 8.62 μg/adult. Moreover, camphor and α-terpineol showed stronger fumigant activity (LC50=2.91 and 3.27 mg/L air, resp. against L. serricorne than crude essential oil and other constituents. In addition, the essential oil, eucalyptol, verbenol, and α-terpineol showed comparable repellency against L. serricorne adults. The results indicate that the essential oil and isolated compounds have potential to provide more efficient and safer natural insecticides or repellents for control of insects in food and Chinese medicinal materials preservation.

  2. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  3. Activity of the Antioxidant Defense System in a Typical Bioinsecticide-and Synthetic Insecticide-treated Cowpea Storage Beetle F. (Coleoptera: Chrysomelidae

    Directory of Open Access Journals (Sweden)

    Ayodele O. Kolawole

    2014-01-01

    Full Text Available The non-enzymatic and enzymatic antioxidant defense systems play a major role in detoxification of pro-oxidant endobiotics and xenobiotics. The possible involvement of beetle non-enzymatic [α-tocopherol, glutathione (GSH, and ascorbic acid] and enzymatic [catalase (CAT, superoxide dismutase (SOD, peroxidase (POX, and polyphenol oxidase (PPO] antioxidant defense system on the insecticidal activity of synthetic insecticides (cypermethrin, 2,2-dicholorovinyl dimethyl phosphate, and λ-cyhalothrin and ethanolic plant extracts of Tithonia diversifolia, Cyperus rotundus, Hyptis suaveolens leaves , and Jatropha Curcas seeds was investigated. 2,2-Dicholorovinyl dimethyl phosphate (DDVP; 200 ppm, LC 50 = 13.24 ppm and T. diversifolia (20,000 ppm resulted in 100% beetle mortality at 96-hour post-treatment. The post-treatments significantly increased the beetle α-tocopherol and GSH contents. Activities of CAT, SOD, POX, and PPO were modulated by the synthetic insecticides and bioinsecticides to diminish the adverse effect of the chemical stresses. Quantitative and qualitative allelochemical compositions of bioinsecticides and chemical structure of synthetic insecticides possibly account and for modulation of their respective enzyme activities. Altogether, oxidative stress was enormous enough to cause maladaptation in insects. This study established that oxidative imbalance created could be the molecular basis of the efficacy of both insecticides and bio-insecticides. Two, there was development of functional but inadequate antioxidant defense mechanism in the beetle.

  4. Compatibility of chemical insecticides and entomopathogenic fungi for control of soybean defoliating pest, Rachiplusia nu.

    Science.gov (United States)

    Pelizza, Sebastian A; Schalamuk, Santiago; Simón, María R; Stenglein, Sebastian A; Pacheco-Marino, Suani G; Scorsetti, Ana C

    Rachiplusia nu (Guenée) (Lepidoptera: Noctuidae) is one of the major lepidopteran pests defoliating soybeans (Glycine max Merrill) in Argentina. The combined use of chemical insecticides and entomopathogenic fungi is a promising pest-control option to minimize adverse chemical effects. In this work, we evaluated the interactions between five insecticides-two being considered biorational-and five fungal entomopathogenic strains under laboratory conditions in order to determine the possible usefulness of combinations of these agents against R. nu. The insecticides were tested for compatibility at four doses by in vitro bioassay and for the lethality of R. nu by inoculations at three doses. Fungal strains were applied at 1×10 8 , 1×10 6 , and 1×10 4 conidia/ml. The combinations of those insecticides with Beauveria bassiana (LPSc 1067, LPSc 1082, LPSc 1098), Metarhizium anisopliae (LPSc 907), and Metarhizium robertsii (LPSc 963) caused higher R. nu-larval mortalities than any of the individual agents alone. We observed significant differences in the in vitro conidial viability, vegetative growth, and conidia production of the five strains of entomopathogenic fungi exposed to different doses of the chemical insecticides. The combination gamma-cyhalothrin-LPSc-1067 caused the highest percent mortality of R. nu larvae, with synergism occurring between the two agents at 50% and 25% of the maximum field doses. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  5. A chitin-binding lectin from Moringa oleifera seeds (WSMoL) impairs the digestive physiology of the Mediterranean flour larvae, Anagasta kuehniella.

    Science.gov (United States)

    de Oliveira, Caio Fernando Ramalho; de Moura, Maiara Celine; Napoleão, Thiago Henrique; Paiva, Patrícia Maria Guedes; Coelho, Luana Cassandra Breitenbach Barroso; Macedo, Maria Lígia Rodrigues

    2017-10-01

    Biotechnological techniques allow the investigation of alternatives to outdated chemical insecticides for crop protection; some investigations have focused on the identification of molecules tailored from nature for this purpose. We, herein, describe the negative effects of water-soluble lectin from Moringa oleifera seeds (WSMoL) on Anagasta kuehniella development. The chitin-binding lectin, WSMoL, impaired the larval weight gain by 50% and affected the activity of the pest's major digestive enzymes. The commitment of the digestive process became evident after controlled digestion studies, where the capacity of protein digestion was compromised by >90%. Upon acute exposure, the lectin was not resistant to digestion; however, chronic ingestion of WSMoL was able to reverse this feature. Thus, we show that resistance to digestion may not be a prerequisite for a lectin's ability to exert negative effects on larval physiology. The mechanism of action of WSMoL involves binding to chitin with possible disruption to the peritrophic membrane, causing disorder between the endo- and ectoperitrophic spaces. Additionally, results suggest that WSMoL may trigger apoptosis in gut cells, leading to the lower enzymatic activity observed in WSMoL-fed larvae. Although assays employing an artificial diet did not demonstrate effects of WSMoL on A. kuehniella mortality, this lectin may hold potential for exerting insecticide effects on other pest insects, as well for use in other experimental approaches, such as WSMoL-expressing plants. Moreover, the use of WSMoL with other biotechnological tools, such as 'pyramid' crops, may represent a strategy for delaying the evolution of pest resistance to transgenic crops, since its multiple site targets could act in synergism with other insecticide compounds. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Toxicity and sublethal effects of six insecticides to last instar larvae and adults of the biocontrol agents Chrysoperla carnea (Stephens) (Neuroptera: Chrysopidae) and Adalia bipunctata (L.) (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Garzón, A; Medina, P; Amor, F; Viñuela, E; Budia, F

    2015-08-01

    To further develop Integrated Pest Management (IPM) strategies against crop pests, it is important to evaluate the effects of insecticides on biological control agents. Therefore, we tested the toxicity and sublethal effects (fecundity and fertility) of flonicamid, flubendiamide, metaflumizone, spirotetramat, sulfoxaflor and deltamethrin on the natural enemies Chrysoperla carnea and Adalia bipunctata. The side effects of the active ingredients of the insecticides were evaluated with residual contact tests for the larvae and adults of these predators in the laboratory. Flonicamid, flubendiamide, metaflumizone and spirotetramat were innocuous to last instar larvae and adults of C. carnea and A. bipunctata. Sulfoxaflor was slightly toxic to adults of C. carnea and was highly toxic to the L4 larvae of A. bipunctata. For A. bipunctata, sulfoxaflor and deltamethrin were the most damaging compounds with a cumulative larval mortality of 100%. Deltamethrin was also the most toxic compound to larvae and adults of C. carnea. In accordance with the results obtained, the compounds flonicamid, flubendiamide, metaflumizone and spirotetramat might be incorporated into IPM programs in combination with these natural enemies for the control of particular greenhouse pests. Nevertheless, the use of sulfoxaflor and deltamethrin in IPM strategies should be taken into consideration when releasing either of these biological control agents, due to the toxic behavior observed under laboratory conditions. The need for developing sustainable approaches to combine the use of these insecticides and natural enemies within an IPM framework is discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  8. Antifungal activity of nettle (Urtica dioica L.), colocynth (Citrullus colocynthis L. Schrad), oleander (Nerium oleander L.) and konar (Ziziphus spina-christi L.) extracts on plants pathogenic fungi.

    Science.gov (United States)

    Hadizadeh, I; Peivastegan, B; Kolahi, M

    2009-01-01

    Anti-mycotic activity of the ethanol extracts from Nettle (Urtica dioica L.), Colocynth (Citrullus colocynthis L. Schrad), Konar (Ziziphus spina-christi L.) and Oleander (Nerium oleander L.) floral parts were screened in vitro against four important plant pathogenic fungi viz.; Alternaria alternate, Fusarium oxysporum, Fusarium solani and Rizoctonia solani using agar dilution bioassay. Extracts showed antifungal activity against all the tested fungi. Among the plants, Nettle and Colocynth were the most effective against A. alternate and R. solani while Oleander possesses the best inhibition on F. oxysporum and F. solani. Konar was the most effective extract by reducing the growth of Rizoctonia solani than other fungi. These results showed that extracts could be considered suitable alternatives to chemical additives for the control of fungal diseases in plants.

  9. Using mass-release of engineered insects to manage insecticide resistance

    International Nuclear Information System (INIS)

    Alphey, Nina; Coleman, Paul G.; Donnelly, Christl A.

    2006-01-01

    Transgenic crops expressing insecticidal toxins derived from Bacillus thuringiensis (Bt) are widely used to control insect pests. The benefits of such crops would be lost if resistance to the toxins spread to a significant proportion of the pest population. The main resistance management method, mandatory in the US, is the high-dose/refuge strategy, requiring nearby refuges of toxin-free crops, and the use of toxin doses sufficiently high to kill not only wild type insects but also insects heterozygous for a resistance allele, thereby rendering the resistance functionally recessive. We propose that mass-release of harmless toxin-sensitive insects could substantially delay or even reverse the spread of resistance. Mass-release of such insects is an integral part of RIDL, a genetics-based method of pest control related to the Sterile Insect Technique. We used a population genetic mathematical model to analyze the effects of releasing male insects homozygous for a female-specific dominant lethal genetic construct, and concluded that this RIDL strategy could form an effective component of a resistance management scheme for insecticidal plants and other toxins. (author)

  10. Using mass-release of engineered insects to manage insecticide resistance

    Energy Technology Data Exchange (ETDEWEB)

    Alphey, Nina [University of Oxford (United Kingdom). Dept. of Zoology; Alphey, Luke [Oxitec Limited, Oxford (United Kingdom); Coleman, Paul G [London School of Hygiene and Tropical Medicine (United Kingdom). Dept. of Infectious and Tropical Diseases; Donnelly, Christl A [Imperial College Faculty of Medicine, London (United Kingdom). Dept. of Infectious Disease Epidemiology

    2006-07-01

    Transgenic crops expressing insecticidal toxins derived from Bacillus thuringiensis (Bt) are widely used to control insect pests. The benefits of such crops would be lost if resistance to the toxins spread to a significant proportion of the pest population. The main resistance management method, mandatory in the US, is the high-dose/refuge strategy, requiring nearby refuges of toxin-free crops, and the use of toxin doses sufficiently high to kill not only wild type insects but also insects heterozygous for a resistance allele, thereby rendering the resistance functionally recessive. We propose that mass-release of harmless toxin-sensitive insects could substantially delay or even reverse the spread of resistance. Mass-release of such insects is an integral part of RIDL, a genetics-based method of pest control related to the Sterile Insect Technique. We used a population genetic mathematical model to analyze the effects of releasing male insects homozygous for a female-specific dominant lethal genetic construct, and concluded that this RIDL strategy could form an effective component of a resistance management scheme for insecticidal plants and other toxins. (author)

  11. L-py: an L-system simulation framework for modeling plant architecture development based on a dynamic language.

    Science.gov (United States)

    Boudon, Frédéric; Pradal, Christophe; Cokelaer, Thomas; Prusinkiewicz, Przemyslaw; Godin, Christophe

    2012-01-01

    The study of plant development requires increasingly powerful modeling tools to help understand and simulate the growth and functioning of plants. In the last decade, the formalism of L-systems has emerged as a major paradigm for modeling plant development. Previous implementations of this formalism were made based on static languages, i.e., languages that require explicit definition of variable types before using them. These languages are often efficient but involve quite a lot of syntactic overhead, thus restricting the flexibility of use for modelers. In this work, we present an adaptation of L-systems to the Python language, a popular and powerful open-license dynamic language. We show that the use of dynamic language properties makes it possible to enhance the development of plant growth models: (i) by keeping a simple syntax while allowing for high-level programming constructs, (ii) by making code execution easy and avoiding compilation overhead, (iii) by allowing a high-level of model reusability and the building of complex modular models, and (iv) by providing powerful solutions to integrate MTG data-structures (that are a common way to represent plants at several scales) into L-systems and thus enabling to use a wide spectrum of computer tools based on MTGs developed for plant architecture. We then illustrate the use of L-Py in real applications to build complex models or to teach plant modeling in the classroom.

  12. Appropriate analytical methods are necessary to assess nontarget effects of insecticidal proteins in GM crops through meta-analysis (Response to Andow et al. 2009)

    Czech Academy of Sciences Publication Activity Database

    Shelton, A. M.; Naranjo, S. E.; Romeis, J.; Hellmich, R. L.; Wolt, J. D.; Federici, B. A.; Albajes, R.; Bigler, F.; Burgess, E. P. J.; Dively, G. P.; Gatehouse, A. M. R.; Malone, L. A.; Roush, R.; Sears, M.; Sehnal, František; Ferry, N.; Bell, H. A.

    2009-01-01

    Roč. 38, č. 6 (2009), s. 1533-1538 ISSN 0046-225X Institutional research plan: CEZ:AV0Z50070508 Keywords : GM crops * insecticidal proteins * analytical methods Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.154, year: 2009

  13. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  14. Submerged macrophytes mitigate direct and indirect insecticide effects in freshwater communities.

    Science.gov (United States)

    Brogan, William R; Relyea, Rick A

    2015-01-01

    Understanding how ecological interactions mitigate the impacts of perturbations such as pesticides in biological communities is an important basic and applied question for ecologists. In aquatic ecosystems, new evidence from microcosm experiments suggests that submerged macrophytes can buffer cladocerans from pulse exposures to the widely used insecticide malathion, and that mitigation increases with macrophyte density. However, whether these results scale up to more complex aquatic communities where ecological interactions such as competition can alter toxicity is unknown. Further, macrophyte abilities to mitigate different insecticide exposure scenarios (i.e. single versus repeated pulses) have never been tested. To address these gaps, we performed a factorial mesocosm experiment examining the influence of four macrophyte treatments (0, 10, 50, or 100 Elodea Canadensis shoots planted per mesocosm) crossed with three malathion exposure scenarios (no insecticide, single pulse, repeated pulses) on aquatic communities containing zooplankton, phytoplankton, periphyton, two snail species, and larval amphibians. In the absence of macrophytes, single malathion pulses caused short-term declines in cladoceran abundance followed by their rapid recovery, which precluded any indirect effects (i.e. trophic cascades). However, repeated malathion pulses caused cladoceran extinctions, resulting in persistent phytoplankton blooms and reduced abundance of one snail species. In contrast, with macrophytes present, even at low density, malathion had no effect on any taxa. We also discovered novel effects of macrophytes on the benthic food web. In the two highest macrophyte treatments, we observed trends of reduced periphyton biomass, decreased abundance of one snail species, and decreased amphibian time to and mass at metamorphosis. To our knowledge, this is the first evidence of negative submerged macrophyte effects on amphibians, a taxa of global conservation concern. Our findings

  15. Submerged Macrophytes Mitigate Direct and Indirect Insecticide Effects in Freshwater Communities

    Science.gov (United States)

    Brogan, William R.; Relyea, Rick A.

    2015-01-01

    Understanding how ecological interactions mitigate the impacts of perturbations such as pesticides in biological communities is an important basic and applied question for ecologists. In aquatic ecosystems, new evidence from microcosm experiments suggests that submerged macrophytes can buffer cladocerans from pulse exposures to the widely used insecticide malathion, and that mitigation increases with macrophyte density. However, whether these results scale up to more complex aquatic communities where ecological interactions such as competition can alter toxicity is unknown. Further, macrophyte abilities to mitigate different insecticide exposure scenarios (i.e. single versus repeated pulses) have never been tested. To address these gaps, we performed a factorial mesocosm experiment examining the influence of four macrophyte treatments (0, 10, 50, or 100 Elodea Canadensis shoots planted per mesocosm) crossed with three malathion exposure scenarios (no insecticide, single pulse, repeated pulses) on aquatic communities containing zooplankton, phytoplankton, periphyton, two snail species, and larval amphibians. In the absence of macrophytes, single malathion pulses caused short-term declines in cladoceran abundance followed by their rapid recovery, which precluded any indirect effects (i.e. trophic cascades). However, repeated malathion pulses caused cladoceran extinctions, resulting in persistent phytoplankton blooms and reduced abundance of one snail species. In contrast, with macrophytes present, even at low density, malathion had no effect on any taxa. We also discovered novel effects of macrophytes on the benthic food web. In the two highest macrophyte treatments, we observed trends of reduced periphyton biomass, decreased abundance of one snail species, and decreased amphibian time to and mass at metamorphosis. To our knowledge, this is the first evidence of negative submerged macrophyte effects on amphibians, a taxa of global conservation concern. Our findings

  16. Submerged macrophytes mitigate direct and indirect insecticide effects in freshwater communities.

    Directory of Open Access Journals (Sweden)

    William R Brogan

    Full Text Available Understanding how ecological interactions mitigate the impacts of perturbations such as pesticides in biological communities is an important basic and applied question for ecologists. In aquatic ecosystems, new evidence from microcosm experiments suggests that submerged macrophytes can buffer cladocerans from pulse exposures to the widely used insecticide malathion, and that mitigation increases with macrophyte density. However, whether these results scale up to more complex aquatic communities where ecological interactions such as competition can alter toxicity is unknown. Further, macrophyte abilities to mitigate different insecticide exposure scenarios (i.e. single versus repeated pulses have never been tested. To address these gaps, we performed a factorial mesocosm experiment examining the influence of four macrophyte treatments (0, 10, 50, or 100 Elodea Canadensis shoots planted per mesocosm crossed with three malathion exposure scenarios (no insecticide, single pulse, repeated pulses on aquatic communities containing zooplankton, phytoplankton, periphyton, two snail species, and larval amphibians. In the absence of macrophytes, single malathion pulses caused short-term declines in cladoceran abundance followed by their rapid recovery, which precluded any indirect effects (i.e. trophic cascades. However, repeated malathion pulses caused cladoceran extinctions, resulting in persistent phytoplankton blooms and reduced abundance of one snail species. In contrast, with macrophytes present, even at low density, malathion had no effect on any taxa. We also discovered novel effects of macrophytes on the benthic food web. In the two highest macrophyte treatments, we observed trends of reduced periphyton biomass, decreased abundance of one snail species, and decreased amphibian time to and mass at metamorphosis. To our knowledge, this is the first evidence of negative submerged macrophyte effects on amphibians, a taxa of global conservation concern

  17. Effect of doses and of refuge on the insecticide selectivity to predators and parasitoids of soybean insect pests

    International Nuclear Information System (INIS)

    Corso, Ivan Carlos; Gazzoni, Decio Luiz; Nery, Manoel Eugenio

    1999-01-01

    A field experiment was conducted to evaluate seasonal effect of insecticides on predators and parasitoids of soybean insect pests. A randomized block design was used, with three replications, and the experiment was set up in the experimental station of the EMBRAPA-Centro Nacional de Pesquisa de Soja, located at Londrina, PR, Brazil. Treatments consisted of insecticide application to control the velvet bean caterpillar (1/21/1993) or the stink bug complex (3/4/1993). Insect population was sampled through the shock technique, consisting of an application of a broad spectrum insecticide over the plants to be sampled, being the insects collected on cloths placed on the ground, and transferred to the laboratory to be identified and counted. Statistical analysis revealed no differences on the populations of species of predators, diptera or himenoptera as a group. No effects of pest resurgence or secondary pest outbreaks were also observed. (author)

  18. Mercury exposure on potential plant Ludwigia octovalvis L. - Preliminary toxicological testing

    Science.gov (United States)

    Alrawiq, Huda S. M.; Mushrifah, I.

    2013-11-01

    The preliminary test in phytoremediation is necessaryto determine the ability of plant to survive in media with different concentrations of contaminant. It was conducted to determine the maximum concentration of the contaminant that isharmful to the plant and suppress the plant growth. This study showed the ability of Ludwigia octovalvisto resist mercury (Hg) contaminant in sand containing different concentrations of Hg (0, 0.5, 1, 2, 4, 6 and 8 mg/L). The experimental work wasperformed under greenhouse conditions for an observation period of 4 weeks. Throughout the 4 weeks duration, the resultsshowed that 66.66% of the plants withered for on exposure to Hg concentration of 4 mg/L and 100% withered at higher concentrations of 6 and 8 mg/L. The results of this study may serve as a basis for research that aims to study uptake and accumulation of Hg using potential phytoremediation plants.

  19. An Insecticide Further Enhances Experience-Dependent Increased Behavioural Responses to Sex Pheromone in a Pest Insect.

    Directory of Open Access Journals (Sweden)

    Antoine Abrieux

    Full Text Available Neonicotinoid insecticides are widely used to protect plants against pest insects, and insecticide residues remaining in the environment affect both target and non-target organisms. Whereas low doses of neonicotinoids have been shown to disturb the behaviour of pollinating insects, recent studies have revealed that a low dose of the neonicotinoid clothianidin can improve behavioural and neuronal sex pheromone responses in a pest insect, the male moth Agrotis ipsilon, and thus potentially improve reproduction. As male moth behaviour depends also on its physiological state and previous experience with sensory signals, we wondered if insecticide effects would be dependent on plasticity of olfactory-guided behaviour. We investigated, using wind tunnel experiments, whether a brief pre-exposure to the sex pheromone could enhance the behavioural response to this important signal in the moth A. ipsilon at different ages (sexually immature and mature males and after different delays (2 h and 24 h, and if the insecticide clothianidin would interfere with age effects or the potential pre-exposure-effects. Brief pre-exposure to the pheromone induced an age-independent significant increase of sex pheromone responses 24 h later, whereas sex pheromone responses did not increase significantly 2 h after exposure. However, response delays were significantly shorter compared to naïve males already two hours after exposure. Oral treatment with clothianidin increased sex pheromone responses in sexually mature males, confirming previous results, but did not influence responses in young immature males. Males treated with clothianidin after pre-exposure at day 4 responded significantly more to the sex pheromone at day 5 than males treated with clothianidin only and than males pre-exposed only, revealing an additive effect of experience and the insecticide. Plasticity of sensory systems has thus to be taken into account when investigating the effects of sublethal doses

  20. An Insecticide Further Enhances Experience-Dependent Increased Behavioural Responses to Sex Pheromone in a Pest Insect.

    Science.gov (United States)

    Abrieux, Antoine; Mhamdi, Amel; Rabhi, Kaouther K; Egon, Julie; Debernard, Stéphane; Duportets, Line; Tricoire-Leignel, Hélène; Anton, Sylvia; Gadenne, Christophe

    2016-01-01

    Neonicotinoid insecticides are widely used to protect plants against pest insects, and insecticide residues remaining in the environment affect both target and non-target organisms. Whereas low doses of neonicotinoids have been shown to disturb the behaviour of pollinating insects, recent studies have revealed that a low dose of the neonicotinoid clothianidin can improve behavioural and neuronal sex pheromone responses in a pest insect, the male moth Agrotis ipsilon, and thus potentially improve reproduction. As male moth behaviour depends also on its physiological state and previous experience with sensory signals, we wondered if insecticide effects would be dependent on plasticity of olfactory-guided behaviour. We investigated, using wind tunnel experiments, whether a brief pre-exposure to the sex pheromone could enhance the behavioural response to this important signal in the moth A. ipsilon at different ages (sexually immature and mature males) and after different delays (2 h and 24 h), and if the insecticide clothianidin would interfere with age effects or the potential pre-exposure-effects. Brief pre-exposure to the pheromone induced an age-independent significant increase of sex pheromone responses 24 h later, whereas sex pheromone responses did not increase significantly 2 h after exposure. However, response delays were significantly shorter compared to naïve males already two hours after exposure. Oral treatment with clothianidin increased sex pheromone responses in sexually mature males, confirming previous results, but did not influence responses in young immature males. Males treated with clothianidin after pre-exposure at day 4 responded significantly more to the sex pheromone at day 5 than males treated with clothianidin only and than males pre-exposed only, revealing an additive effect of experience and the insecticide. Plasticity of sensory systems has thus to be taken into account when investigating the effects of sublethal doses of insecticides

  1. Bacillus thuringiensis monogenic strains: screening and interactions with insecticides used against rice pests

    Science.gov (United States)

    Pinto, Laura M.N.; Dörr, Natália C.; Ribeiro, Ana Paula A.; de Salles, Silvia M.; de Oliveira, Jaime V.; Menezes, Valmir G.; Fiuza, Lidia M.

    2012-01-01

    The screening of Bacillus thuringiensis (Bt) Cry proteins with high potential to control insect pests has been the goal of numerous research groups. In this study, we evaluated six monogenic Bt strains (Bt dendrolimus HD-37, Bt kurstaki HD-1, Bt kurstaki HD-73, Bt thuringiensis 4412, Bt kurstaki NRD-12 and Bt entomocidus 60.5, which codify the cry1Aa, cry1Ab, cry1Ac, cry1Ba, cry1C, cry2A genes respectively) as potential insecticides for the most important insect pests of irrigated rice: Spodoptera frugiperda, Diatraea saccharalis, Oryzophagus oryzae, Oebalus poecilus and Tibraca limbativentris. We also analyzed their compatibility with chemical insecticides (thiamethoxam, labdacyhalothrin, malathion and fipronil), which are extensively used in rice crops. The bioassay results showed that Bt thuringiensis 4412 and Bt entomocidus 60.5 were the most toxic for the lepidopterans, with a 93% and 82% mortality rate for S. frugiperda and D. saccharalis, respectively. For O. oryzae, the Bt kurstaki NRD-12 (64%) and Bt dendrolimus HD-37 (62%) strains were the most toxic. The Bt dendrolimus HD-37 strain also caused high mortality (82%) to O. poecilus, however the strains assessed to T. limbativentris caused a maximum rate of 5%. The assays for the Bt strains interaction with insecticides revealed the compatibility of the six strains with the four insecticides tested. The results from this study showed the high potential of cry1Aa and cry1Ba genes for genetic engineering of rice plants or the strains to biopesticide formulations. PMID:24031872

  2. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  3. Insecticidal Activities of Bark, Leaf and Seed Extracts of Zanthoxylum heitzii against the African Malaria Vector Anopheles gambiae

    Directory of Open Access Journals (Sweden)

    Hans J. Overgaard

    2014-12-01

    Full Text Available The olon tree, Zanthoxylum heitzii (syn. Fagara heitzii is commonly found in the central-west African forests. In the Republic of Congo (Congo-Brazzaville its bark is anecdotally reported to provide human protection against fleas. Here we assess the insecticidal activities of Z. heitzii stem bark, seed and leaf extracts against Anopheles gambiae s.s, the main malaria vector in Africa. Extracts were obtained by Accelerated Solvent Extraction (ASE using solvents of different polarity and by classical Soxhlet extraction using hexane as solvent. The insecticidal effects of the crude extracts were evaluated using topical applications of insecticides on mosquitoes of a susceptible reference strain (Kisumu [Kis], a strain homozygous for the L1014F kdr mutation (kdrKis, and a strain homozygous for the G119S Ace1R allele (AcerKis. The insecticidal activities were measured using LD50 and LD95 and active extracts were characterized by NMR spectroscopy and HPLC chromatography. Results show that the ASE hexane stem bark extract was the most effective compound against An. gambiae (LD50 = 102 ng/mg female, but was not as effective as common synthetic insecticides. Overall, there was no significant difference between the responses of the three mosquito strains to Z. heitzii extracts, indicating no cross resistance with conventional pesticides.

  4. Impact of single and repeated applications of the insecticide chlorpyrifos on tropical freshwater plankton communities

    NARCIS (Netherlands)

    Daam, M.A.; Brink, van den P.J.; Nogueira, A.J.A.

    2008-01-01

    This paper describes the effects of a single and a repeated application of the organophosphorus insecticide chlorpyrifos on zooplankton and phytoplankton communities in outdoor microcosms in Thailand. Treatment levels of 1 mu g L-1 were applied once or twice with a 2-week interval. Both treatments

  5. Chemical composition, in vitro antioxidant, antimicrobial and insecticidal activities of essential oil from Cladanthus arabicus

    Science.gov (United States)

    The essential oil obtained from the aerial parts of Cladanthus arabicus (L.) Cass was studied for its chemical composition, antioxidant, antimicrobial and insecticidal activities. The essential oil (EO) was analyzed by GC-MS. Sixty seven compounds representing 94.2% of the oil were identified. The m...

  6. Exposure to pyrethroids insecticides and serum levels of thyroid-related measures in pregnant women

    International Nuclear Information System (INIS)

    Zhang, Jie; Hisada, Aya; Yoshinaga, Jun; Shiraishi, Hiroaki; Shimodaira, Kazuhisa; Okai, Takashi; Noda, Yumiko; Shirakawa, Miyako; Kato, Nobumasa

    2013-01-01

    Possible association between environmental exposure to pyrethroid insecticides and serum thyroid-related measures was explored in 231 pregnant women of 10–12 gestational weeks recruited at a university hospital in Tokyo during 2009–2011. Serum levels of free thyroxine (fT4), thyroid stimulating hormone (TSH) and thyroid biding globulin (TBG) and urinary pyrethroid insecticide metabolite (3-phenoxybenzoic acid, 3-PBA) were measured. Obstetrical information was obtained from medical records and dietary and lifestyle information was collected by self-administered questionnaire. Geometric mean concentration of creatinine-adjusted urinary 3-PBA was 0.363 (geometric standard deviation: 3.06) μg/g cre, which was consistent with the previously reported levels for non-exposed Japanese adult females. The range of serum fT4, TSH and TBG level was 0.83–3.41 ng/dL, 0.01–27.4 μIU/mL and 16.4–54.4 μg/mL, respectively. Multiple regression analysis was carried out by using either one of serum levels of thyroid-related measures as a dependent variable and urinary 3-PBA as well as other potential covariates (age, pre-pregnancy BMI, parity, urinary iodine, smoking and drinking status) as independent variables: 3-PBA was not found as a significant predictor of serum level of thyroid-related measures. Lack of association may be due to lower pyrethroid insecticide exposure level of the present subjects. Taking the ability of pyrethroid insecticides and their metabolite to bind to nuclear thyroid hormone (TH) receptor, as well as their ability of placental transfer, into consideration, it is warranted to investigate if pyrethroid pesticides do not have any effect on TH actions in fetus brain even though maternal circulating TH level is not affected. -- Highlights: • Pyrethroid exposure and thyroid hormone status was examined in pregnant women. • Urinary 3-phenoxybenzoic acid was used as a biomarker of exposure. • Iodine nutrition, age and other covariates were included

  7. Exposure to pyrethroids insecticides and serum levels of thyroid-related measures in pregnant women

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jie; Hisada, Aya [Department of Environmental Studies, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8563 (Japan); Yoshinaga, Jun, E-mail: junyosh@k.u-tokyo.ac.jp [Department of Environmental Studies, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8563 (Japan); Shiraishi, Hiroaki [National Institute for Environmental Studies, Onogawa 16-2, Tsukuba, Ibaraki 305-8563 (Japan); Shimodaira, Kazuhisa; Okai, Takashi [Department of Obstetrics and Gynecology, Showa University School of Medicine, 1-5-8 Hatanodai, Shinagawa, Tokyo 142-8555 (Japan); Noda, Yumiko; Shirakawa, Miyako; Kato, Nobumasa [Department of Psychiatry and Neurology, Showa University School of Medicine, 1-5-8 Hatanodai, Shinagawa, Tokyo 142-8555 (Japan)

    2013-11-15

    Possible association between environmental exposure to pyrethroid insecticides and serum thyroid-related measures was explored in 231 pregnant women of 10–12 gestational weeks recruited at a university hospital in Tokyo during 2009–2011. Serum levels of free thyroxine (fT4), thyroid stimulating hormone (TSH) and thyroid biding globulin (TBG) and urinary pyrethroid insecticide metabolite (3-phenoxybenzoic acid, 3-PBA) were measured. Obstetrical information was obtained from medical records and dietary and lifestyle information was collected by self-administered questionnaire. Geometric mean concentration of creatinine-adjusted urinary 3-PBA was 0.363 (geometric standard deviation: 3.06) μg/g cre, which was consistent with the previously reported levels for non-exposed Japanese adult females. The range of serum fT4, TSH and TBG level was 0.83–3.41 ng/dL, 0.01–27.4 μIU/mL and 16.4–54.4 μg/mL, respectively. Multiple regression analysis was carried out by using either one of serum levels of thyroid-related measures as a dependent variable and urinary 3-PBA as well as other potential covariates (age, pre-pregnancy BMI, parity, urinary iodine, smoking and drinking status) as independent variables: 3-PBA was not found as a significant predictor of serum level of thyroid-related measures. Lack of association may be due to lower pyrethroid insecticide exposure level of the present subjects. Taking the ability of pyrethroid insecticides and their metabolite to bind to nuclear thyroid hormone (TH) receptor, as well as their ability of placental transfer, into consideration, it is warranted to investigate if pyrethroid pesticides do not have any effect on TH actions in fetus brain even though maternal circulating TH level is not affected. -- Highlights: • Pyrethroid exposure and thyroid hormone status was examined in pregnant women. • Urinary 3-phenoxybenzoic acid was used as a biomarker of exposure. • Iodine nutrition, age and other covariates were included

  8. Radiotracer Approaches to Carbamate Insecticide Toxicology; Emploi des radio indicateurs pour l'etude de la toxicologie des insecticides a base de carbamates; Primenenie radioaktivnykh indikatorov dlya izucheniya toksikologii karbamatnykh insektitsidov; Estudio con radioindicadores de la toxico logia de los insecticidas a base de carbamatos

    Energy Technology Data Exchange (ETDEWEB)

    Casida, J. E. [University of Wisconsin, Madison, WI (United States)

    1963-09-15

    studies on the metabolism of radiolabelled Dimetilan (2-diraethylcarbamyl- 3-methylpyrazolyl-(5)-dimethylcarbamate) and a related compound in cockroaches also indicate that oxidative attack forms N-methyl N-methylol derivatives. Much remains to be done on the relationship of these detoxification reactions to the resistance mechanism, the action of synergists, the selective toxicity in this group of insecticides, and the nature and significance of residues. Metabolism of Sevin following injection into plants is probably also oxidative rather than hydrolytic, but the nature of the products and the enzymatic mechanism have not yet been established. (author) [French] Les methylcarbamates constituent l'un des principaux groupes d'insecticides. Les radioindicateurs permettent d'etudier facilement de nombreux problemes que pose leur toxicologie. On a prepare des dimethylcarbamates en marquant le groupe carbonyle par {sup 14}C, et des methylcaibamates en marquant par {sup 14}C les groupes methyle et carbonyle et le noyau. L'action pharmacologique de ces composes resulte vraisemblablement de l'inhibition de l'acetylcholinesterase et peut impliquer une carbamylation. La reaction, avec de la cholinesterase ou d'autres esterases purifiees, des carbamates dont on a marque les groupe carbonyle et methyle permettrait de faire une etude critique de cette carbamylation et de la facilite avec laquelle se produit la reactivation ou decarbamylation, spontanee ou induite, L'importance physiologique de l'inhibition de la cholinesterase peut etre etudiee en administrant de l'acetate marque par {sup 14}C et en analysant l'accumulation de l'acetylcholine marquee dans les tissus nerveux, ou bien en utilisant de l'acetyl-{sup 14}C-choline comme substrat pour determiner in vitro le degre d'inhibition de la cholinesterase dans les tissus d'animaux traites, avec une dilution minimum des inhibiteurs et des enzymes pendant l'analyse. Les produits marques ont permis certains progres dans l'etude du

  9. Monitoring of the insecticide trichlorfon by phosphorus-31 nuclear magnetic resonance (31P NMR) spectroscopy

    International Nuclear Information System (INIS)

    Talebpour, Zahra; Ghassempour, Alireza; Zendehzaban, Mehdi; Bijanzadeh, Hamid Reza; Mirjalili, Mohammad Hossein

    2006-01-01

    Trichlorfon is an organophosphorus insecticide, which is extensively being used for protection of fruit crops. Trichlorfon is a thermal labile compound, which cannot be easily determined by gas chromatography (GC) and has no suitable group for sensitive detection by high performance liquid chromatography (HPLC). In this study, a 31 P nuclear magnetic resonance ( 31 P NMR) has been described for monitoring of trichlorfon without any separation step. The quantitative works of 31 P NMR spectroscopy has been performed in the presence of an internal standard (hexamethylphosphoramide). Limit of detection (LOD) for this method has been found to be 55 mg L -1 , without any sample preparation, and the linear working range was 150-5500 mg L -1 . Relative standard deviation (R.S.D.%) of the method for three replicates within and between days was obtained ≤9%. The average recovery efficiency was approximately 99-112%. This method was applied for monitoring trichlorfon in a commercial insecticide sample and tomato sample

  10. Chromogenic platform based on recombinant Drosophila melanogaster acetylcholinesterase for visible unidirectional assay of organophosphate and carbamate insecticide residues

    Energy Technology Data Exchange (ETDEWEB)

    Han Zheng [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Chi Chensen [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Bai Bing; Liu Gang; Rao Qinxiong [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Peng Shaojie [Institute of Shanghai Food and Drug Supervision, 615 Liuzhou Road, Shanghai 200233 (China); Liu Hong [Shanghai Municipal Center for Disease Control and Prevention, 1380 Zhongshan West Road, Shanghai 200336 (China); Zhao Zhihui [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Zhang Dabing [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Wu Aibo, E-mail: wuaibo@saas.sh.cn [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China)

    2012-03-30

    Highlight: Black-Right-Pointing-Pointer A visible chromogenic platform for rapid analysis of OP and CM insecticide residues was developed. Black-Right-Pointing-Pointer The assay has the capabilities of both qualitative measurement and quantitative analysis. Black-Right-Pointing-Pointer The sensitivity, capabilities of resisting interferences and storage stability were desirable. Black-Right-Pointing-Pointer Matrix effects were acceptable and detection performance was satisfactory in real application. - Abstract: In this study we propose a chromogenic platform for rapid analysis of organophosphate (OP) and carbamate (CM) insecticide residues, based on recombinant Drosophila melanogaster acetylcholinesterase (R-DmAChE) as enzyme and indoxyl acetate as substrate. The visible chromogenic strip had the advantages identical to those of commonly used lateral flow assays (LFAs) with utmost simplicity in sample loading and result observation. After optimization, depending on the color intensity (CI) values, the well-established assay has the capabilities of both qualitative measurement via naked eyes and quantitative analysis by colorimetric reader with the desirable IC{sub 50} values against the tested six insecticides (0.06 {mu}g mL{sup -1} of carbofuran, 0.28 {mu}g mL{sup -1} of methomyl, 0.03 {mu}g mL{sup -1} of dichlorvos, 31.6 {mu}g mL{sup -1} of methamidophos, 2.0 {mu}g mL{sup -1} of monocrotophos, 6.3 {mu}g mL{sup -1} of omethoate). Acceptable matrix effects and satisfactory detection performance were confirmed by in-parallel LC-MS/MS analysis in different vegetable varieties at various spiked levels of 10{sup -3} to 10{sup 1} {mu}g g{sup -1}. Overall, the testified suitability and applicability of this novel platform meet the requirements for practical use in food safety management and environmental monitoring, especially in the developing world.

  11. Chromogenic platform based on recombinant Drosophila melanogaster acetylcholinesterase for visible unidirectional assay of organophosphate and carbamate insecticide residues

    International Nuclear Information System (INIS)

    Han Zheng; Chi Chensen; Bai Bing; Liu Gang; Rao Qinxiong; Peng Shaojie; Liu Hong; Zhao Zhihui; Zhang Dabing; Wu Aibo

    2012-01-01

    Highlight: ► A visible chromogenic platform for rapid analysis of OP and CM insecticide residues was developed. ► The assay has the capabilities of both qualitative measurement and quantitative analysis. ► The sensitivity, capabilities of resisting interferences and storage stability were desirable. ► Matrix effects were acceptable and detection performance was satisfactory in real application. - Abstract: In this study we propose a chromogenic platform for rapid analysis of organophosphate (OP) and carbamate (CM) insecticide residues, based on recombinant Drosophila melanogaster acetylcholinesterase (R-DmAChE) as enzyme and indoxyl acetate as substrate. The visible chromogenic strip had the advantages identical to those of commonly used lateral flow assays (LFAs) with utmost simplicity in sample loading and result observation. After optimization, depending on the color intensity (CI) values, the well-established assay has the capabilities of both qualitative measurement via naked eyes and quantitative analysis by colorimetric reader with the desirable IC 50 values against the tested six insecticides (0.06 μg mL −1 of carbofuran, 0.28 μg mL −1 of methomyl, 0.03 μg mL −1 of dichlorvos, 31.6 μg mL −1 of methamidophos, 2.0 μg mL −1 of monocrotophos, 6.3 μg mL −1 of omethoate). Acceptable matrix effects and satisfactory detection performance were confirmed by in-parallel LC–MS/MS analysis in different vegetable varieties at various spiked levels of 10 −3 to 10 1 μg g −1 . Overall, the testified suitability and applicability of this novel platform meet the requirements for practical use in food safety management and environmental monitoring, especially in the developing world.

  12. Entomopathogenic fungi as biological control agents of diamondback moth (Lepidoptera: Plutellidae)and compatibility with chemical insecticides

    Science.gov (United States)

    The objectives were to evaluate the efficiency of entomopathogenic fungi against Plutella xylostella (L.) and the compatibility of the most virulent isolates with some of the insecticides registered for use on cabbage crops. Pathogenicity tests used isolates of Beauveria bassiana, Metarhizium rileyi...

  13. Biological Activity of Essential Oils from Leaves and Fruits of Pepper Tree (Schinus molle L. to Control Rice Weevil (Sitophilus oryzae L. Bioactividad de aceites esenciales de hojas y frutos del aguaribay (Schinus molle L. en el gorgojo del arroz (Sitophilus oryzae L.

    Directory of Open Access Journals (Sweden)

    Verónica Benzi

    2009-06-01

    Full Text Available Rice weevil (Sitophilus oryzae L. is a primary insect pest of stored grain. The development of resistance resulted in the application of synthetic insecticides. In recent years many plant essential oils have provided potential alternatives to currently used insect control agents. The Brazilian pepper tree (Schinus molle L. var. areira (L. DC. (Anacardiaceae has different biological properties such as insecticidal activity. In this study, repellent, fumigant activity, nutritional indices, and feeding deterrent action were evaluated on S. oryzae adults. Filter paper impregnation was used to test fumigant toxicity, whereas treated whole wheat was used to evaluate repellent activity and a flour disk bioassay was done to evaluate feeding deterrent action and nutritional index alteration. Leaf essential oils showed repellent effects at both concentrations (0.04 and 0.4% w/w, while fruit essential oils lacked repellent activity. Both plant oils altered nutritional indices. Fruit essential oils had a strong feeding deterrent action (62% while leaves had a slight effect (40.6%. With respect to fumigant activity, neither of the essential oils was found to be toxic.El gorgojo del arroz (Sitophilus oryzae. L. es un insecto-plaga de infestación primaria de granos. El uso de insecticidas sintéticos ha desarrollado fenómenos de resistencia. En los últimos años los aceites esenciales se presentan como una alternativa en el control de insectos-plaga. El aguaribay (Schinus molle L. var. areira (L. DC. (Anacardiaceae es una planta con diferentes propiedades biológicas entre las que se destacan el uso como insecticida. El objetivo de este estudio fue evaluar la actividad fumigante, repelente, los índices nutricionales y la actividad antialimentaria de los aceites esenciales de hojas y frutos de S. molle var. areira en adultos de S. oryzae. Para la actividad fumigante se utilizó la técnica de impregnación de papeles de filtro; para la actividad repelente

  14. Alternatives to neonicotinoid insecticides for pest control: case studies in agriculture and forestry.

    Science.gov (United States)

    Furlan, Lorenzo; Kreutzweiser, David

    2015-01-01

    Neonicotinoid insecticides are widely used for control of insect pests around the world and are especially pervasive in agricultural pest management. There is a growing body of evidence indicating that the broad-scale and prophylactic uses of neonicotinoids pose serious risks of harm to beneficial organisms and their ecological function. This provides the impetus for exploring alternatives to neonicotinoid insecticides for controlling insect pests. We draw from examples of alternative pest control options in Italian maize production and Canadian forestry to illustrate the principles of applying alternatives to neonicotinoids under an integrated pest management (IPM) strategy. An IPM approach considers all relevant and available information to make informed management decisions, providing pest control options based on actual need. We explore the benefits and challenges of several options for management of three insect pests in maize crops and an invasive insect pest in forests, including diversifying crop rotations, altering the timing of planting, tillage and irrigation, using less sensitive crops in infested areas, applying biological control agents, and turning to alternative reduced risk insecticides. Continued research into alternatives is warranted, but equally pressing is the need for information transfer and training for farmers and pest managers and the need for policies and regulations to encourage the adoption of IPM strategies and their alternative pest control options.

  15. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  16. Sensitivity of Bemisia Tabaci (Hemiptera: Aleyrodidae) to Several New Insecticides in China: Effects of Insecticide Type and Whitefly Species, Strain, and Stage

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040

  17. Insecticide resistance of Anopheles sinensis and An. vagus in Hainan Island, a malaria-endemic area of China.

    Science.gov (United States)

    Qin, Qian; Li, Yiji; Zhong, Daibin; Zhou, Ning; Chang, Xuelian; Li, Chunyuan; Cui, Liwang; Yan, Guiyun; Chen, Xiao-Guang

    2014-03-03

    Malaria is one of the most important public health problems in Southeast Asia, including Hainan Island, China. Vector control is the main malaria control measure, and insecticide resistance is a major concern for the effectiveness of chemical insecticide control programs. The objective of this study is to determine the resistance status of the main malaria vector species to pyrethroids and other insecticides recommended by the World Health Organization (WHO) for indoor residual sprays. The larvae and pupae of Anopheles mosquitoes were sampled from multiple sites in Hainan Island, and five sites yielded sufficient mosquitoes for insecticide susceptibility bioassays. Bioassays of female adult mosquitoes three days after emergence were conducted in the two most abundant species, Anopheles sinensis and An. vagus, using three insecticides (0.05% deltamethrin, 4% DDT, and 5% malathion) and following the WHO standard tube assay procedure. P450 monooxygenase, glutathione S-transferase and carboxylesterase activities were measured. Mutations at the knockdown resistance (kdr) gene and the ace-1 gene were detected by DNA sequencing and PCR-RFLP analysis, respectively. An. sinensis and An. vagus were the predominant Anopheles mosquito species. An. sinensis was found to be resistant to DDT and deltamethrin. An. vagus was susceptible to deltamethrin but resistant to DDT and malathion. Low kdr mutation (L1014F) frequency (P450 monooxygenase and carboxylesterase activities were detected in deltamethrin-resistant An. sinensis, and significantly higher P450 monooxygenase, glutathione S-transferase and carboxylesterase activities were found in malathion-resistant An. vagus mosquitoes. Multiple insecticide resistance was found in An. sinensis and An. vagus in Hainan Island, a malaria-endemic area of China. Cost-effective integrated vector control programs that go beyond synthetic insecticides are urgently needed.

  18. Protective effect and economic impact of insecticide application methods on barley

    Directory of Open Access Journals (Sweden)

    Alfred Stoetzer

    2014-03-01

    Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.

  19. Isolation of Insecticidal Constituent from Ruta graveolens and Structure-Activity Relationship Studies against Stored-Food Pests (Coleoptera).

    Science.gov (United States)

    Jeon, Ju-Hyun; Lee, Sang-Guei; Lee, Hoi-Seon

    2015-08-01

    Isolates from essential oil extracted from the flowers and leaves of Ruta graveolens and commercial phenolic analogs were evaluated using fumigant and contact toxicity bioassays against adults of the stored-food pests Sitophilus zeamais, Sitophilus oryzae, and Lasioderma serricorne. The insecticidal activity of these compounds was then compared with that of the synthetic insecticide dichlorvos. To investigate the structure-activity relationships, the activity of 2-isopropyl-5-methylphenol and its analogs was examined against these stored-food pests. Based on the 50% lethal dose, the most toxic compound against S. zeamais was 3-isopropylephenol, followed by 2-isopropylphenol, 4-isopropylphenol, 5-isopropyl-2-methylphenol, 2-isopropyl-5-methylphenol, 3-methylphenol, and 2-methylphenol. Similar results were observed with phenolic compounds against S. oryzae. However, when 2-isopropyl-5-methylphenol isolated from R. graveolens oil and its structurally related analogs were used against L. serricorne, little or no insecticidal activity was found regardless of bioassay. These results indicate that introducing and changing the positions of functional groups in the phenol skeleton have an important effect on insecticidal activity of these compounds against stored-food pests.

  20. Insecticide toxicity to oriental fruit fly Bactrocera dorsalis (Diptera: Tephritidae) is influenced by environmental factors.

    Science.gov (United States)

    Lin, Yuying; Jin, Tao; Zeng, Ling; Lu, Yongyue

    2013-02-01

    In this study, we investigated the effects of environmental factors (temperature, dose, dietary source, and feeding density) on the insecticide tolerance of Bactrocera dorsalis (Hendel) (Diptera: Tephritidae). The results indicated that the toxicities of trichlorphon and abamectin to B. dorsalis increased with an increase in temperature. At 15-35 degrees C, the toxicity of beta-cypermethrin decreased with an increase in temperature at low doses (0.82 and 1.86 mg/L), but was similar at a high dose (4.18 mg/L). These results demonstrated that the temperature coefficient of beta-cypermethrin was related to both temperature and dosage. The insecticide sensitivity of B. dorsalis reared on different dietary sources was significantly different. Trichlorphon sensitivity of B. dorsalis fed on banana was the highest with an LC50 of 1.61 mg/L, followed by on apple, carambola, semiartificial diet, pear, mango, guava, orange, and papaya. With an increasing feeding density, the sensitivity of B. dorsalis adults to trichlorphon increased, while the sensitivities of B. dorsalis adults to abamectin and beta-cypermethrin decreased. The differences between LC50 values of insects reared at densities of 10 and 13 eggs/g of semiartificial diet to trichlorphon, abamectin and beta-cypermethrin were not significant. This result suggested that representative toxicity could be obtained by using adults developed at a feeding density between 10-13 eggs/g of semiartificial diet. Adult body weight was positively correlated with the LC50 value of trichlorphon, but was negatively correlated with the toxicities of abamectin and beta-cypermethrin. These results suggested that the effects of adult body weight on the toxicity of insecticides were different among different chemicals.

  1. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    OpenAIRE

    Tamrin Abdullah; Ahdin Gassa; Sri Nur Aminah Ngatimin; Nurariaty Agus And Abdul Fattah

    2015-01-01

    Abstract The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e neem seed extract together with rice planting neem seed extract on soybean 17 days after rice planting synthetic insecticides on 17 days after rice planting Delthametrin on soybean and Chlorpirifos on rice respectively. Research was conduc...

  2. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    OpenAIRE

    Abdullah, Tamrin; Gassa, Ahdin; Ngatimin, Sri Nur Aminah; Agus, Nurariaty; Fattah, Abdul

    2015-01-01

    The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e: neem seed extract together with rice planting, neem seed extract on soybean 17 days after rice planting, synthetic insecticides on 17 days after rice planting (Delthametrin on soybean and Chlorpirifos on rice), respectively. Research was conducted...

  3. Investigations on the Effects of Five Different Plant Extracts on the Two-Spotted Mite Tetranychus urticae Koch (Arachnida: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Pervin Erdogan

    2012-01-01

    Full Text Available Two-spotted mite, Tetranychus urticae Koch (Arac.: Tetranychidae, is an economic pest worldwide including Turkey, causing serious damage to vegetables, flowers, and fruit crops. In recent years, broad-spectrum insecticides/miticides have been used to control this pest in Turkey. Control is difficult mainly due to resistance to conventional pesticides. This study was conducted to determine efficacy of pesticides extracted from five different plants [i.e., Allium sativum L. (Amaryllidaceae, Rhododendron luteum S. (Ericaceae, Helichrysum arenarium L. (Asteraceae, Veratrum album L. (Liliaceae, and Tanacetum parthenium L. (Asteraceae] against this mite. Bioassays were tested by two different methods to determine the effects of varying concentrations. Experiments were performed using 3 cm diameter leaf disk from unsprayed bean plants (Phaseolus vulgaris L.. In addition, the effects of the extracts on reproduction and oviposition were investigated. The extract yielded high mortality. In the lowest-concentration bioassays, the adult mites laid lower numbers of eggs compared to the untreated control. No ovicidal effect was observed.

  4. Toxicity and Residual Activity of Insecticides Against Tamarixia triozae (Hymenoptera: Eulophidae), a Parasitoid of Bactericera cockerelli (Hemiptera: Triozidae).

    Science.gov (United States)

    Luna-Cruz, Alfonso; Rodríguez-Leyva, Esteban; Lomeli-Flores, J Refugio; Ortega-Arenas, Laura D; Bautista-Martínez, Néstor; Pineda, Samuel

    2015-10-01

    Bactericera cockerelli (Sulc) (Hemiptera: Triozidae) is one of the most economically important pests of potato, tomato, and peppers in Central America, Mexico, the United States, and New Zealand. Its control is based on the use of insecticides; however, recently, the potential of the eulophid parasitoid Tamarixia triozae (Burks) (Hymenoptera: Eulophidae) for population regulation has been studied. Because T. triozae is likely to be exposed to insecticides on crops, the objective of this study was to explore the compatibility of eight insecticides with this parasitoid. The toxicity and residual activity (persistence) of spirotetramat, spiromesifen, beta-cyfluthrin, pymetrozine, azadirachtin, imidacloprid, abamectin, and spinosad against T. triozae adults were assessed using a method based on the residual contact activity of each insecticide on tomato leaf discs collected from treated plants growing under greenhouse conditions. All eight insecticides were toxic to T. triozae. Following the classification of the International Organization of Biological Control, the most toxic were abamectin and spinosad, which could be placed in toxicity categories 3 and 4, respectively. The least toxic were azadirachtin, pymetrozine, spirotetramat, spiromesifen, imidacloprid, and beta-cyfluthrin, which could be placed in toxicity category 2. In terms of persistence, by day 5, 6, 9, 11, 13, 24, and 41 after application, spirotetramat, azadirachtin, spiromesifen, pymetrozine, imidacloprid, beta-cyfluthrin, abamectin, and spinosad could be considered harmless, that is, placed in toxicity category 1 (<25% mortality of adults). The toxicity and residual activity of some of these insecticides allow them to be considered within integrated pest management programs that include T. triozae. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. The Insecticidal Activity of Tanacetum parthenium (L.) Schultz Bip. Extracts Obtained by Supercritical Fluid Extraction and Hydrodistillation

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.; Karban, Jindřich

    2010-01-01

    Roč. 31, č. 3 (2010), s. 449-454 ISSN 0926-6690 R&D Projects: GA MŠk 2B06049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * spodoptera littoralis * tanacetum parthenium Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.507, year: 2010

  6. Sensitivity of Bemisia tabaci (Hemiptera: Aleyrodidae) to several new insecticides in China: effects of insecticide type and whitefly species, strain, and stage.

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC50 values were higher for Lab-Q than for Lab-B; avermectin LC50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  7. Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland

    Energy Technology Data Exchange (ETDEWEB)

    Moore, M.T. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)], E-mail: matt.moore@ars.usda.gov; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)

    2009-01-15

    Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field.

  8. Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland

    International Nuclear Information System (INIS)

    Moore, M.T.; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R.

    2009-01-01

    Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field

  9. The influence of insecticides and vegetation in structuring Formica mound ant communities (Hymenoptera: Formicidae) in Maine lowbush blueberry.

    Science.gov (United States)

    Choate, Beth; Drummond, Francis A

    2013-04-01

    Assessing the influence of new, reduced-risk insecticides on natural enemies within agroecosystems is essential to developing integrated pest management strategies. Three species of mound-building Formica ants are abundant throughout Maine lowbush blueberry fields (Formica exsectoides Forel, F. glacialis Wheeler, and F. ulkei Emery). All three species have been described in the literature as predaceous, with research demonstrating that F. exsectoides preys on major pest insects of lowbush blueberry. The objectives of this study were to determine the impact of common-use and newly introduced insecticides on Formica sp. ant communities in lowbush blueberry fields. Laboratory assays indicated that the commonly applied insecticide phosmet is toxic to F. exsectoides, even after 8 d of field weathering (P insecticides, such as acetamiprid, had little effect on survival of all three species. Abundance of each species in the field varied with lowbush blueberry pesticide-use strategy and amount of nonblueberry vegetation. Both F. exsectoides and F. glacialis were most abundant in organic fields; however, overall F. glacialis was the most abundant in fields of all management types. Field surveys support laboratory results suggesting that phosmet is highly toxic to these species and influences their spatial pattern. Manipulation of the crop to conserve natural enemies in lowbush blueberry is difficult because the crop is not planted; therefore, we must look closely at the incorporation of low toxicity insecticides with natural enemies to efficiently control pest insects.

  10. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  11. Target and non-target toxicity of botanical insecticide derived from Couroupita guianensis L. flower against generalist herbivore, Spodoptera litura Fab. and an earthworm, Eisenia foetida Savigny

    Science.gov (United States)

    Novel chemistries in botanical insecticides may provide alternatives to, or development of synthetic insecticides suitable for controlling the Lepidopteran pests, like Spodoptera litura (F.). Many botanical chemistries are biodegradable, and have lower mammalian toxicity.