WorldWideScience

Sample records for pinta

  1. PINTA: a web server for network-based gene prioritization from expression data

    DEFF Research Database (Denmark)

    Nitsch, Daniela; Tranchevent, Léon-Charles; Goncalves, Joana P.

    2011-01-01

    network. Our strategy is meant for biological and medical researchers aiming at identifying novel disease genes using disease specific expression data. PINTA supports both candidate gene prioritization (starting from a user defined set of candidate genes) as well as genome-wide gene prioritization...... and is available for five species (human, mouse, rat, worm and yeast). As input data, PINTA only requires disease specific expression data, whereas various platforms (e.g. Affymetrix) are supported. As a result, PINTA computes a gene ranking and presents the results as a table that can easily be browsed...

  2. Advances in the diagnosis of endemic treponematoses: yaws, bejel, and pinta.

    Directory of Open Access Journals (Sweden)

    Oriol Mitjà

    Full Text Available Improved understanding of the differential diagnosis of endemic treponematoses is needed to inform clinical practice and to ensure the best outcome for a new global initiative for the eradication of yaws, bejel, and pinta. Traditionally, the human treponematoses have been differentiated based upon their clinical manifestations and epidemiologic characteristics because the etiologic agents are indistinguishable in the laboratory. Serological tests are still considered standard laboratory methods for the diagnosis of endemic treponematoses and new rapid point-of-care treponemal tests have become available which are extremely useful in low-resource settings. In the past ten years, there has been an increasing effort to apply polymerase chain reaction to treponematoses and whole genome fingerprinting techniques have identified genetic signatures that can differentiate the existing treponemal strains; however, definitive diagnosis is also hampered by widespread unavailability of molecular diagnostics. We review the dilemmas in the diagnosis of endemic treponematoses, and advances in the discovery of new diagnostic tools.

  3. O puru-puru da Amazônia (Pinta, Carate, Mal del Pinto etc

    Directory of Open Access Journals (Sweden)

    F. Nery Guimarães

    1948-03-01

    Full Text Available 1 "Purú-purú" é uma palavra indígena que quer dizer "pintado" ou "manchado", peculiar à Amazonia Brasileira. Com êsse nome é designada uma dermatose referida entre os selvicolas desde 1774, por Ribeiro Sampaio. Certas tribus, com alta incidência da moléstia passaram a ser cahamadas também "Purú-purús", o mesmo acontecendo com o rio onde habitavam - Rio Purús. 2 A doença existe na bacia do Rio Solimões e seus principais afluentes: Javari, Juruá, Purús, Içá, Japurá, e Negro. Por esses rios, o fóco da dermatose se continua nos países limitrofes com o Brasil: Guianas, Venezuela, Colombia, Perú (Equador e Bolivia. 3 Desde 1890 essa dermatose foi relacionada à pinta (carate ou mal del pinto por P. S. de Magalhães, idéa essa depois defendida por Juliano Moreira, Carlos Chagas, Roquete Pinto, Wappeus, O. da Fonseca Filho, Da Matta, Brumpt e outros, baseados na semelhança clínica e na terapêutica. Recentemente (1945, essa provavel identidade das duas dermatoses, recebeu fundamento sorológico de Biocca (que verificou a positividade das reações de Kline e Kahn em doentes de purú-purú, e, pelo presente trabalho, recebe base clínico-epidemio-anatomo-patológica. 4 Sob o ponto de vista clínico, as lesões cutaneas discromicas da moléstia, são de 3 órdens: a lesões papulo-eritemato-escamosas, isoladas ou não, arredondadas, pruriginosas e de bordos nitidos; b lesões maculo-escamosas, maiores mais pálidas, ás vezes já mostrando alterações pigmentares na parte central; c máculas discromod´rmicas, lisas ou ligeiramente escamosas, com maior ou menor alteração pigmentar, as quais assumem diferentes aspéctos, consequentes à hipo - ou hiperpigmentação, variaveis também com a côr do paciente. As colorações predominantes nas manchas, são o branco, o preto e o vermelho, com tonalidades eminentemente variaveis. Embora raramente, nessas extensas dermodiscromias, observa-se superposição de lesões papulo

  4. Patometria, parâmetros genéticos e reação de progênies de mamoeiro à pinta-preta

    Directory of Open Access Journals (Sweden)

    Marcelo Vivas

    2012-01-01

    Full Text Available A resistência genética constitui-se em alternativa sustentável para o controle de doenças em culturas agrícolas, sendo esta, no entanto, dependente da avaliação de populações naturais ou tradicionais visando à ampliação da base genética. Este trabalho relata a avaliação fenotípica de 24 progênies de mamoeiro, oriundas de genótipos crioulos, cultivados por pequenos agricultores no sul do Estado do Espírito Santo. Avaliaram-se características associadas à resistência à pinta-preta, importante doença desta cultura, causada pelo fungo Asperisporium caricae. Para fins comparativos, foram incluídas uma variedade resistente ('Maradol' e uma suscetível ('Golden' à pinta-preta. Pelos parâmetros genéticos estimados, concluiu-se que na população estudada há variabilidade genética quanto à resistência à pinta-preta suficiente para indicar a seleção recorrente como método de melhoramento.

  5. Novos progenitores de batata imunes a PVY e PVX e resistentes à pinta-preta New potato progenitors immune to PVY and PVX, and resistant to early blight

    Directory of Open Access Journals (Sweden)

    Sieglinde Brune

    1999-07-01

    Full Text Available As viroses que ocorrem com muita frequência em plantas de batata no Brasil são responsáveis por queda na produtividade, principalmente quando provocados por uma combinação de vírus. Para PVY e PVX o tipo de resistência usada é a imunidade, controlada por genes simples e dominantes. A pinta-preta, causada pelo fungo Alternaria solani,é uma das principais doenças fúngicas da batata em condições de alta umidade e temperatura, podendo causar até 73% de perdas na produtividade. O uso da resistência genética é de grande interesse agronômico, uma vez que a eliminação ou redução do uso de agrotóxicos leva a menores custos de produção da lavoura, além de mitigar a poluição ambiental e os riscos ao ser humano. A Embrapa Hortaliças avalia anualmente, em seu programa de melhoramento da batata, a imunidade aos vírus PVY e PVX, a resistência à pinta-preta, além de observar as características agronômicas dos clones. Entre os genótipos avaliados em 1991 e 1992 destacaram-se os clones Embrapa/CIP-PP063 e Embrapa/CIP-PP084 com boas características agronômicas, imunidade a PVY e PVX e alto nível de resistência à pinta-preta. Ambos podem ser empregados como progenitores em programas de melhoramento que objetivem imunidade a esses vírus e resistência à pinta-preta. Os clones Embrapa/CIP-PP063 e o Embrapa/CIP-PP084 encontram-se à disposição de instituições interessadas em trabalhos cooperativos com a Embrapa Hortaliças, na forma de tubérculos ou plântulas in vitro.Viruses that occur frequently in potato crops in Brazil are responsible for crop yield losses, mainly when caused by a combination of viruses. For PVY and PVX the type of resistance used is immunity, controlled by single and dominant genes. Early blight caused by Alternaria solani is one of the most important potato diseases in Brazil, especially when high air humidity and warm weather conditions prevail. This disease can cause losses up to 73%. The use of

  6. Anisotropy of Magnetic Susceptibility (AMS) of the Neogene Volcanic Succession at the Sierra Juarez - Las PintasVolcanic Province, Northeastern Baja California, Mexico: Preliminary Results

    Science.gov (United States)

    Mendoza-Borunda, R.; Cañón-Tapia, E.; Suárez-Vidal, F.; Gradilla-Martínez, L.

    2010-12-01

    The Sierra Juarez-Las Pintas Volcanic Province is among the largest in northern Baja California. For this work, we focused on a bimodal volcanic succession of late Miocene age, composed of an extensive ignimbrite unit and few dispersed basaltic flows that crop out in central Sierra Juarez and northern Sierra Las Tinajas. The ignimbrite is zoned, composed by three distinctive members: a basal unwelded white tuff, a mid-section unwelded orange tuff, and an upper red welded tuff. The basaltic flows are olivine-rich. Samples were collected in five sites that define a NE-SW section across the Sierra Juarez Escarpment, in the western boundary of the so-called Gulf Extensional Province. In each of these sites a stratigraphic column composed of more than one geologic unit was sampled. The total number of analyzed cores is ca. 160. The preliminary results show vertical and lateral variations of the AMS of the ignimbrite that can be interpreted in terms of the local flow direction and processes of emplacement of these volcanic deposits. Such variations, in turn, are likely to reflect variations in the dynamics of the eruptive process that produced them. Although the AMS of all the rocks in this province display a complex set of orientations, in this work is shown that when examined in detail important clues concerning the geological evolution of the province can be obtained from these data.

  7. Seleção de acessos de tomateiro resistentes à pinta-preta pela análise de agrupamento das curvas de progresso da doença

    Directory of Open Access Journals (Sweden)

    Bruno Soares Laurindo

    2015-02-01

    Full Text Available O objetivo deste trabalho foi selecionar acessos resistentes à pinta-preta (Alternaria tomatophila por meio da análise de agrupamento das curvas de progresso da doença em tomateiro (Solanum lycopersicum. Foram avaliados 134 acessos de tomateiro do Banco de Germoplasma de Hortaliças da Universidade Federal de Viçosa (BGH-UFV, no delineamento de blocos ao acaso, além das testemunhas suscetíveis 'Débora' e 'Santa Clara'. As plantas foram inoculadas com uma mistura de conídios de diferentes isolados de Alternaria spp. e avaliadas regularmente quanto à severidade da doença a cada três dias após a inoculação, no total de seis avaliações. Ajustou-se o modelo logístico aos dados de severidade da pinta-preta, e as estimativas obtidas para a incidência final da doença (B1 e a taxa de progresso da doença (B3 foram submetidas à análise de variância multivariada (Manova. As médias dessas estimativas, para cada acesso, foram submetidas à análise de agrupamento. Foram formados 24 grupos distintos com base no agrupamento das curvas de progresso da doença, o que possibilitou identificar os acessos BGH-2143, BGH-2235, BGH-2270 e BGH-2118 de tomateiro como potenciais fontes de resistência à pinta-preta.

  8. Rafael Pinta el Nuevo Mundo

    OpenAIRE

    Arginiegas, German

    1995-01-01

    En el cuatrocientos, el encuentro entre naciones era el tradicional enfrentamiento de fanatismo religioso. El guerrero siempre ha tratado de dar aire sagrado a sus empresas y los turcos, bélicos por naturaleza, avanzaban sobre Europa con las banderas de Mahoma desplegadas. Los cristianos reyes de occidente, junto con su corona, defendían la iglesia de cristo amenazaba. Una vez más, Jerusalén estaba en manos de los infieles. América se descubre buscando el camino para burlar a los turcos. En e...

  9. Effect of fungicides and alternative products in control of anthracnose and black spot of guavaEfeito de fungicidas e produtos alternativos no controle da antracnose e da pinta preta da goiaba

    Directory of Open Access Journals (Sweden)

    Ivan Herman Fischer

    2012-12-01

    Full Text Available This work aimed to evaluate the efficiency of fungicides in controlling in vitro and in vivo the causal agents of anthracnose (Colletotrichum gloeosporioides and C. acutatum and black spot (Guignardia psidii and evaluate the effect of alternative products to control these diseases. Inhibition of mycelial growth of the pathogens was evaluated for ten fungicides at concentrations of 1, 10 and 100 mg L-1 of active ingredient in potato-dextrose-agar medium. The effectiveness of the fungicides azoxystrobin + difenoconazole, cyproconazole, pyraclostrobin, tebuconazole and tebuconazole + trifloxystrobin in controlling disease incidence and severity of anthracnose, through applications in the field, was measured in fruits collected at three stages of maturation, according to the skin color (dark green, light green and yellowish green. In postharvest dipping of fruits, the products evaluated were citric acid, peracetic acid, salicylic acid, sodium bicarbonate, chlorine dioxide, Ecolife® and chitosan. The fungicides azoxystrobin + difenoconazole, pyraclostrobin, tebuconazole and trifloxystrobin + tebuconazole were highly effective in inhibiting the in vitro mycelial growth of G. psidii and moderately to highly effective in inhibiting C. acutatum and C. gloeosporioides. In field conditions, the fungicide azoxystrobin + difenoconazole was effective in controlling anthracnose and black spot in fruit at three maturity stage (skin color yellowish green. The alternative products tested were ineffective in the curative control of anthracnose and early blight at postharvest of guava. Os objetivos deste trabalho foram avaliar a eficiência de fungicidas no controle in vitro e in vivo dos agentes causais da antracnose (Colletotrichum gloeosporioides e C. acutatum e da pinta preta (Guignardia psidii da goiaba e avaliar o efeito de produtos alternativos no controle pós-colheita destas doenças. A inibição do crescimento micelial dos patógenos foi avaliada para

  10. BRS Eliza: cultivar de batata para mesa, com película lisa e resistência à pinta-preta e à requeima BRS Eliza: a fresh market potato cultivar, with smooth skin and early and late blight resistance

    Directory of Open Access Journals (Sweden)

    Arione S. Pereira

    2001-11-01

    Full Text Available BRS Eliza é uma cultivar de batata para consumo de mesa liberada em 2001, pela Embrapa Clima Temperado, Pelotas (RS. É mais adequada ao preparo de purê e salada (cremosa. O ciclo é médio. Os tubérculos têm formato oval, película lisa e amarela, pouca sensibilidade ao esverdeamento, polpa amarelo-clara e olhos superficiais. Não mostrou defeitos fisiológicos nos tubérculos. Tem boa resistência de campo à requeima (Phytophthora infestans e à pinta- preta (Alternaria solani e mediana a viroses. BRS Eliza é suscetível à canela-preta (Erwinia carotovara. Produz alta percentagem de tubérculos de tamanho comercial. Deve ser comercialisada imediatamente após a colheita, requerendo manejo cuidadoso da semente no armazenamentoBRS Eliza is a tablestock potato cultivar released in 2001, by Embrapa Clima Temperado, Pelotas, Brazil. It is adequate for purée and salad. Maturity is medium early. Tubers are oval shaped, yellow and smooth skin, low sensitivity to greening, yellow clear flesh and shallow eyes. BRS Eliza did not show physiological defects on the tubers. Has a good field resistance to late (Phytophthora infestans and early blight (Alternaria solani, and medium resistance to main viroses. BRS Eliza is susceptible to black leg (Erwinia carotovora. It produces a high percentage of commercial tubers. Must be marketed immediately after harvesting. It requires accurate seed management in storage.

  11. Bactérias endofíticas no controle e inibição in vitro de Pseudomonas syringae pv tomato, agente da pinta bacteriana do tomateiro Control with endophytic bacteria and in vitro inhibition of Pseudomonas syringae pv tomato, agent of bacterial speck of tomato

    Directory of Open Access Journals (Sweden)

    Juliana Resende Campos Silva

    2008-08-01

    Full Text Available Para avaliar o potencial de 53 isolados de bactérias endofíticas no controle da pinta bacteriana do tomateiro (Lycopersicum esculentum Mill., realizaram-se seleções massais em casa-de-vegetação e a seguir foi avaliado, in vitro, o antagonismo desses isolados sobre a bactéria desafiante Pseudomonas syringae pv. tomato (Pst. A inoculação das bactérias endofíticas foi feita por microbiolização das sementes de tomate cv. Santa Clara e da desafiante (Pst por pulverização. Aos 7, 14 e 21 dias após a inoculação da Pst, foram realizadas as avaliações da severidade da pinta bacteriana, bem como da altura das plantas. As espécies e os isolados bacterianos mais eficazes na redução da severidade da pinta bacteriana foram: Acinetobacter johnsonii (isolado 10, Bacillus pumilus (isolados 3, 12, 20, 39, 51, Paenibacillus macerans (isolados 37 e 47, PIM 11, Bacillus sphaericus (isolado 45, B. amyloliquefaciens (isolado 50, TOM 2, TOM 24 e Staphylococcus aureus (isolado 18. Mais de 50% dos isolados eficazes na redução da severidade foram da espécie Bacillus pumilus. Das espécies endofíticas mais eficazes na redução da severidade da pinta bacteriana, Bacillus pumilus e B. amyloliquefaciens inibiram também o crescimento da Pst in vitro.Vários dos isolados promoveram também o crescimento das plantas.To asses the potential of fifty three isolates of endophytic bacteria on the control of Pseudomonas syringae pv. tomato (Pst in tomato (Lycopersicum esculentum Mill., several screening were done in greenhouse followed by in vitro studies on antagonism of those isolates to Pst. The inoculation of endophytic bacteria was done by microbiolization of tomato cv Santa Clara seeds. The challenging bacterium (Pst inoculation was done by spraying. At 7, 14 and 21 days after Pst inoculation the assessment of bacterial speck severity was done, and height of plants was also measured. The most efficient endophytic species and isolates in reducing

  12. EPIDEMIA DE PINTA-PRETA DA BATATA E COMPARAÇÃO DE MÉTODOS PARA DETERMINAR O INÍCIO DOS SINTOMAS DA DOENÇA NA CULTURA DE BATATA EM CAMPO POTATO EARLY BLIGHT EPIDEMICS AND COMPARISON OF METHODS TO DETERMINE ITS INITIAL SYMPTOMS IN A POTATO FIELD

    Directory of Open Access Journals (Sweden)

    Rodrigo Orlando Campo Arana

    2007-12-01

    Full Text Available Três experimentos foram montados entre os anos de 2000 e 2002, em condições de campo, de Viçosa, estado de Minas Gerais, com a finalidade de avaliar o efeito de epidemias de pinta-preta (Alternaria solani na produção de batata (Solanum tuberosum e determinar o inicio de sintomas da pinta preta na cultura de batata. Usando o método de gradiente de severidade da doença, foram obtidas em cada experimento quatro epidemias da doença, com diferentes severidades, desde D1 até D4, em ordem decrescente, o que permitiu comparar o efeito das epidemias no crescimento da planta e na produção de tubérculos, bem como determinar o momento de se iniciar o controle da doença. Tendo como base o tempo desde o plantio até o aparecimento dos primeiros sintomas da epidemia, foram avaliados os seguintes métodos para previsão da doença: dias acumulados (DA; graus-dia acumulados (GD, tendo como temperatura-base 7ºC; e dias fisiológicos acumulados (DF, tendo como temperatura mínima 7ºC, máxima de 30ºC e ótima de 21ºC. O estabelecimento do gradiente da doença mostrou diferenças significativas na produção em cada experimento. As maiores reduções na produção dos tubérculos ocorreram na parcela não tratada com fungicida D1, com 49,6% em 2000; 52,7% em 2001; e 58,2% em 2002. A previsão da epidemia utilizando-se os métodos DA e GD não indicou o momento certo para iniciar o controle da epidemia. O método DF foi o mais adequado, estabelecendo-se o primeiro sintoma entre 240 e 333 DF. Conclui-se que a pinta-preta, dependendo da severidade, afeta a área foliar e a produção de tubérculos. Dos métodos para determinar o estabelecimento da pinta-preta, o DF apresentou o maior potencial, recomendando-se seu uso para iniciar o manejo da doença aos 250 DF após o plantio, sempre e quando as condições ambientais favorecem o estabelecimento do patógeno.The influence of an early blight epidemic on potato tuber yield was evaluated in three

  13. Comentarios sobre la distribución de la langosta pinta Panulirus inflatus y la langosta roja P. interruptus (Crustacea: Palinuridae en el Pacífico mexicano Remarks on the distribution of the pinto lobster Panulirus inflatus and the red lobster P. interruptus (Crustacea: Palinuridae in the Mexican Pacific

    Directory of Open Access Journals (Sweden)

    Ernesto Campos

    2007-06-01

    Full Text Available El trabajo de campo sobre la costa oeste de la península de Baja California entre los años 2000 y 2005 dio como resultado la ampliación del ámbito geográfico norteño, desde la Bahía de Santa María hasta Punta Eugenia y sus zonas aledañas, para una población permanente de la langosta pinta Panulirus inflatus (Bouvier, 1895. Registros de esta especie para Bahía de Los Ángeles (golfo de California e isla Guadalupe, México y San Diego, California, en Estados Unidos de América están considerados extralímite y se relacionan con el incremento en la temperatura promedio en el golfo, la condición de calentamiento del agua marina en el Pacifico oriental o el evento El Niño. Adicionalmente, un análisis histórico detallado sobre la distribución de la langosta roja P. interruptus (Randall, 1893 sugiere que los registros al sur de Bahía Magdalena, Baja California Sur y aquellos de la parte sur del Golfo de California son extralímite. Sin embargo, los individuos de Bahía de Los Ángeles y sus áreas aledañas (incluyendo Isla Tiburón y Guaymas, Sonora parecen representar una población que quedó aislada de aquella de la costa oeste de la península de Baja California después de que el corredor marino medio-peninsular, presente en el período Terciario neógeno, se cerró al emerger completamente la península.Fieldwork along the west coast of the Baja California peninsula has resulted in a northern range extension, from Bahía Santa María to Punta Eugenia and vicinity, Baja California Sur, Mexico, for a permanent population of the pinto lobster Panulirus inflatus (Bouvier, 1895. Records of this species from Ángel de la Guarda Island (within the Gulf of California and Guadalupe Island, Mexico and San Diego, California, USA are considered extralimital and related to annual water warming in the Gulf and the Eastern Pacific warm water condition or El Niño event, respectively. In addition, an historic analysis of the red lobster

  14. Sistem Keamanan Berlapis pada Ruangan Menggunakan RFID (Radio Frequency Identification dan Keypad untuk Membuka Pinta Secara Otomatis

    Directory of Open Access Journals (Sweden)

    Muhammad Chamdun

    2014-10-01

    Full Text Available This final project aims to design a door security device using RFID technology (Radio Frequency Identification and the keypad as a method of access into the room. The system will automatically give warning when the code is entered incorrectly or burglars entered by breaking the door. The microcontroller that is used as the central data processing is ATMega 16 microcontroller ATMEL production and security sensors are used PIR (Passive Infra Red and magnetic switches. The design begins with a schematic device hardware and software design using CodeVisionAVR programming. Implementation phase includes the implementation of the physical tools, programs, and sensors. The testing phase is done by testing the input sensors and exit switches, siren output devices, DC motor, LCD (Liquid Crystal Display, the RFID reader, keypad, and system controller. The results of room layered security system works according to design. PIR sensors can detect human activities and turn the LED lamp indicator on. Magnetic switch sensors will provide input to the microcontroller to enable or disable the DC motor as the room locking system. Admin menu that is accessed from the keypad is to add users, remove users, see registered users and change the password. User menu which is also accessed using the keypad, work as the room access using a username and password. This study resulted in the layered security. Room access is done using RFIDTag and password. The room piercing detection is done by sensor PIR (Passive Infra Red and magnetic switches. Alarm used as a piercing action warning. This layered room safety device produces a better security system.

  15. Beyond La Nina, La Pinta, and La Santa Maria: The Invention and Mental Mapping of the New World

    Science.gov (United States)

    Fernandez, Luis Martinez

    2013-01-01

    The topics of Columbus's voyages of exploration, the first encounters between Amerindians and Europeans, and the ensuing collision of their respective worlds provide ample opportunities for creative and stimulating pedagogical approaches that go beyond the stale memorization of dates, places, and names. This essay and accompanying classroom…

  16. Beyond La Nina, La Pinta, and La Santa Maria: The Invention and Mental Mapping of the New World

    Science.gov (United States)

    Fernandez, Luis Martinez

    2013-01-01

    The topics of Columbus's voyages of exploration, the first encounters between Amerindians and Europeans, and the ensuing collision of their respective worlds provide ample opportunities for creative and stimulating pedagogical approaches that go beyond the stale memorization of dates, places, and names. This essay and accompanying classroom…

  17. Sistem Keamanan Berlapis pada Ruangan Menggunakan RFID (Radio Frequency Identification) dan Keypad untuk Membuka Pinta Secara Otomatis

    OpenAIRE

    Muhammad Chamdun; Adian Fatchur Rochim; Eko Didik Widianto

    2014-01-01

    This final project aims to design a door security device using RFID technology (Radio Frequency Identification) and the keypad as a method of access into the room. The system will automatically give warning when the code is entered incorrectly or burglars entered by breaking the door. The microcontroller that is used as the central data processing is ATMega 16 microcontroller ATMEL production and security sensors are used PIR (Passive Infra Red) and magnetic switches. The design begins wi...

  18. Embellecer lo que el más allá hace presente: Pintura, pinta o visión y el Valle de Sibundoy

    Directory of Open Access Journals (Sweden)

    Carlos Avellaneda Escudero

    2014-04-01

    Full Text Available La experiencia con plantas sagradas de conexión es, en cierto modo, una experiencia artística,un esfuerzo espiritual que influye en el comportamiento, que inspira y estimula la creatividad,pues crea otras formas de percibir, pensar e interpretar el mundo, y permite comprender losfenómenos internos de cada ser-ahí. El uso y conocimiento mismos de este tipo plantas seremonta a un pasado remoto. El presente texto acerca su mirada al suroccidente de Colombiapara describir las pinturas visionarias-chamánicas de dos indígenas del Valle de Sibundoy. Susformas y colores, que son fruto de la revelación y los conocimientos de lo invisible o lo sagradodados por el brebaje-maestro, el yagé, son clave para entender que en su contexto cultural estas(representaciones son un medio que embellece (agradece y presenta la vida y el pensamiento.

  19. Las pintas de la sirvienta: El tifo y el temor a los pobres en la ciudad de México, 1874-1877 The servant's spots typhus and fear of the poor in Mexico City, 1874-1877

    Directory of Open Access Journals (Sweden)

    Daniel Herrera Rangel

    2011-06-01

    Full Text Available Tomando como objeto de estudio el brote epidémico de tifo exantemático que conmocionó la vida de la ciudad de México entre 1874 y 1877, el artículo parte desde el enfoque de la historia sociocultural de la enfermedad, para aventurar una mirada a la manera en que eran percibidas las clases bajas por las elites hacia las décadas finales del siglo XIX. Los médicos y la opinión pública, en su lucha por combatir el tifo, un mal culturalmente asociado a la miseria y a la suciedad, focalizarán su temor y su atención sobre los pobres, haciéndolos responsables de la epidemia y estigmatizándolos por su supuesta ignorancia, su falta de aseo y su inmoralidad, lo que alentará severas medidas en su contra.Taking the epidemic outbreak of exanthematic typhus that caused an upheaval in Mexico City life between 1874 and 1877 as its object of study, the article begins by exploring the socio-cultural history of the disease before focusing on the way the lower classes were perceived by the elite towards the end of the nineteenth century. Doctors and public opinion, in their fight to combat typhus, a disease culturally associated with poverty and dirt, focused their fear and attention on the poor, making them responsible for the epidemic and stigmatizing them for their supposed ignorance, lack of hygiene and immorality, which led to severe measures against them.

  20. Las pintas de la sirvienta: El tifo y el temor a los pobres en la ciudad de México, 1874-1877 The servant's spots typhus and fear of the poor in Mexico City, 1874-1877

    OpenAIRE

    Daniel Herrera Rangel

    2011-01-01

    Tomando como objeto de estudio el brote epidémico de tifo exantemático que conmocionó la vida de la ciudad de México entre 1874 y 1877, el artículo parte desde el enfoque de la historia sociocultural de la enfermedad, para aventurar una mirada a la manera en que eran percibidas las clases bajas por las elites hacia las décadas finales del siglo XIX. Los médicos y la opinión pública, en su lucha por combatir el tifo, un mal culturalmente asociado a la miseria y a la suciedad, focalizarán su te...

  1. AcEST: BP916598 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=P... 140 4e-32 tr...LESFLDAFNSMFSGENVGKPVIHL 346 >tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=Pinus taeda PE=

  2. Syphilis and the endemic treponematoses : clinical, (histo-) pathological and laboratory studies

    NARCIS (Netherlands)

    H.J.H. Engelkens (Herman)

    1993-01-01

    textabstractTreponemal diseases important to mankind are sexually transmitted syphilis and the endemic nonvenereally transmitted treponematoses (yaws, pinta, and endemic syphilis). Historically, the most important disease caused by treponemes is syphilis. During the last few decades, yaws, endemic s

  3. AcEST: DK959761 [AcEST

    Lifescience Database Archive (English)

    Full Text Available la paten... 84 4e-20 tr|Q0PIN2|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=P... 89 2e-18 tr|B8LKL3|...L KVD VP SY+LGVLG+ G TAW Sbjct: 119 KGQDLIKVDASQVPASYYLGVLGMPGLTAW 148 >tr|Q0PIN2...|Q0PIN2_PINTA Phenylpropenal double-bond reductase OS=Pinus taeda PE=2 SV=1 Length = 351 Score = 88.6 bits (

  4. O arquipélago “literopintado”: escritura literária de autoria feminina em Cabo Verde

    Directory of Open Access Journals (Sweden)

    Simone Caputo Gomes

    2010-12-01

    Full Text Available Este artigo tem por objetivo estudar a representação de Cabo Verde pela literatura de autoria feminina, que retrata – lê, pinta, desenha, esculpe, escreve, imagina – suas belas paisagens, seu cotidiano popular, seus perfis de mulher, sua riqueza cultural.Palavras-chave: Literatura feminina; Cabo Verde; Representação cultural.

  5. ¿Cómo era la "Santa María"?

    Directory of Open Access Journals (Sweden)

    Boletín Cultural y Bibliográfico Banco de la República

    1968-02-01

    Full Text Available No puedo dar a mis lectores una descripción auténtica de los tres famosos barcos... porque no hay datos ni documentos sobre los que honradamente se puedan describir. Nadie sabe cómo eran exactamente Niña, Pinta y Santa María... Los mejores modelos, que representan investigaciones a fondo son: (1 Los planos de Ernesto D' Albertis, de 1892, de los que se hicieron los modelos del Museo Marino de Pegli, cerca de Génova; (2 Niña 11, Pinta 11 y Santa María 11, construídos según planos de Fernández Duro y Monleón para la Exposición de Chicago, de 1893; (3 La Santa María 111, de D. Julio Guillén, construída en 1927 para la Exposición de Sevilla".

  6. Geothermal Energy in the Pacific Region

    Science.gov (United States)

    1975-05-01

    San Salvador 6 pA/hA/D 0 Islas Quemadas 7 pA 49 San Vicente 8 oB 8 Tecana 9 a Chinameca 10 oB 0 San Miguel 11 pA a Conchagua 12 B3 0 Conchaguita...Negra 6 0 Cerro Azul 7 oB 0 Isla Pinta Isla Pinta 8 B 0 Isla Marchena Isla Marchena 9 oB/A 0 Isla San Salvador isla San Salvador 10 opB 0 Isla Santa Maria...14 pJ’/oB 0 Tupungatito 15 pA 0 San Jose’ 16 T 9 Tinguiririca 17 pA 0 Peteroa 18 T & Descabezado Grande 19 A * Cerro Azul 20 oB 0 Nevados de

  7. Jüri Kasel on väljas kaks suurt näitust : ...

    Index Scriptorium Estoniae

    2005-01-01

    Kuni 6. I 2006 saab Belgias Liege'i kaasaegse kunsti keskuses vaadata Jüri Kase suuri maale, paarisadat joonistust ning objekti ja kuni 12. XII Inglismaal Oxfordi Jacqueline du Pre muusikahoones maale. Liege'i näitusel on väljas ka Jaanus Miku tehtud video "Pinta pilte". 22.-26. XI Eesti kultuuripäevadel Oxfordis esines Weekend Guitar Trio, Kristiina Ehin luges luulet, näidati Priit Tenderi ja Ülo Pikkovi animafilme

  8. Pintores contemporáneos: Ficha para Noé León

    Directory of Open Access Journals (Sweden)

    Mario Rivero

    1968-09-01

    Full Text Available Todo transcurre exactamente como si nada pudiera suceder: Noé León, anónimo, desconocido trabajador de colores y de líneas, trabaja a gusto. Pinta cuadros "bonitos": el Barranquilla de los turistas, el paisaje, el cielo azúl-bandera y las nubes de algodón y de pasta dentífrica.

  9. Internal acetylene unit as a cross-link site for polyimides

    Energy Technology Data Exchange (ETDEWEB)

    Takeichi, T.; Tanikawa, M. [Toyohashi Univ. of Technology (Japan)

    1995-12-01

    We have been studying on the cross-linking behavior of internal acetylenes linked meta-meta to aromatic connecting units which were introduced into the polyimide backbone utilizing 3,3`-diaminodiphenylacetylene (m-intA). In this study, we studied on the cross-linking behavior of internal acetylenes linked para-para to aromatic connecting units. The internal acetylene units were introduced into the polyimide backbone by the reaction of 4,4`-diaminodiphenylacetylene (p-intA) with such acid anhydrides as biphenyltetracarboxylic dianhydride (BPDA), pyromellitic dianhydride (PMDA), and 2,2-bis(3,4-dicarboxyphenyl)hexafluoropropane dianhydride (6FDA). The polyimides showed exotherm on DSC: The onset of the exotherm of p-intA appeared at around 330-390{degrees}C, which is 10-50{degrees}C higher than that of m-intA. The exotherm disappeared after thermal treatment at 400{degrees}C, suggesting the progress of crosslinking between acetylene units. The polyimides cured at 350{degrees}C or 400{degrees}C showed increased Tg and improved physical properties at high temperatures as confirmed by viscoelastic analyses. It was also made clear that polyimides containing p-intA showed higher modulus compared with polyimides containing m-intA, especially when coupled with BPDA and PMDA.

  10. Equivalency of Galápagos giant tortoises used as ecological replacement species to restore ecosystem functions.

    Science.gov (United States)

    Hunter, Elizabeth A; Gibbs, James P; Cayot, Linda J; Tapia, Washington

    2013-08-01

    Loss of key plant-animal interactions (e.g., disturbance, seed dispersal, and herbivory) due to extinctions of large herbivores has diminished ecosystem functioning nearly worldwide. Mitigating for the ecological consequences of large herbivore losses through the use of ecological replacements to fill extinct species' niches and thereby replicate missing ecological functions has been proposed. It is unknown how different morphologically and ecologically a replacement can be from the extinct species and still provide similar functions. We studied niche equivalency between 2 phenotypes of Galápagos giant tortoises (domed and saddlebacked) that were translocated to Pinta Island in the Galápagos Archipelago as ecological replacements for the extinct saddlebacked giant tortoise (Chelonoidis abingdonii). Thirty-nine adult, nonreproductive tortoises were introduced to Pinta Island in May 2010, and we observed tortoise resource use in relation to phenotype during the first year following release. Domed tortoises settled in higher, moister elevations than saddlebacked tortoises, which favored lower elevation arid zones. The areas where the tortoises settled are consistent with the ecological conditions each phenotype occupies in its native range. Saddlebacked tortoises selected areas with high densities of the arboreal prickly pear cactus (Opuntia galapageia) and mostly foraged on the cactus, which likely relied on the extinct saddlebacked Pinta tortoise for seed dispersal. In contrast, domed tortoises did not select areas with cactus and therefore would not provide the same seed-dispersal functions for the cactus as the introduced or the original, now extinct, saddlebacked tortoises. Interchangeability of extant megaherbivores as replacements for extinct forms therefore should be scrutinized given the lack of equivalency we observed in closely related forms of giant tortoises. Our results also demonstrate the value of trial introductions of sterilized individuals to test

  11. Vastuskertoimen määrittäminen

    OpenAIRE

    Kinnunen, Teemu

    2011-01-01

    Tämän insinöörityön tarkoituksena oli luoda katsaus virtauksessa olevaan kappaleeseen kohdistuvan vastusvoiman vastuskertoimen määrittämiseen. Vastusvoiman suuruus riippuu kappaleen pinta-alasta, dynaamisesta paineesta ja vastuskertoimesta. Vastuskerroin riippuu virtauksen luonteesta, kappaleen pinnankarheudesta ja kappaleen muodosta. Insinöörityön teoriaosuudessa perehdyttiin pääasiassa Frank M. Whiten ja Yunus A. Çengelin teoksiin vastuskertoimen teoriasta, kooten niistä yhtenäinen suo...

  12. Pesu- ja desinfiointikoneen höyrynlauhduttimen suunnittelu

    OpenAIRE

    Klemettilä, Markus

    2010-01-01

    Tämän insinöörityön aiheena oli suunnitella Franke Finland Oy:n Deko D32SC -pesu- ja desinfiointikoneeseen höyrynlauhdutin. Pesukone on tarkoitettu sairaala- ja laboratoriovälineistön pesuun. Lauhduttimen tehtävä on lauhduttaa lämpödesinfioinnin aikainen alle 100-asteinen vesihöyry. Työssä on tutkittu höyrynlauhtumisen termodynamiikkaa sekä pinta- ja kontaktilauh-duttamista. Kirjallisuustutkimuksen ja aikaisempien kokemusten pohjalta rakennettiin testauksia varten kaksi prototyyppiä Naara...

  13. Nauhakuusenkadun alueen hulevesiselvitys

    OpenAIRE

    Jormalainen, Janne

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää Imatran kaupungille Nauhakuusenkadun alueen hulevesimäärät nykytilassa sekä kaavamuutoksen jälkeen ja suositella sopivaa hulevesienkäsittelymenetelmää. Käytin 3D-win- ja Autocad-ohjelmistoja pinta-alojen arviointiin. Valumakertoimia arvioin ilmakuvista sekä paikalla käymällä. Opinnäytetyössä käsitellään hulevesien syntymiseen ja laatuun vaikuttavia tekijöitä ja erilaisia hallinta- ja käsittelymenetelmiä. Hulevesirakenteiden mitoitus va...

  14. Notas para la biografía de una carabela

    Directory of Open Access Journals (Sweden)

    Uriel Ospina

    1964-04-01

    Full Text Available Es curioso observar cómo en sus "Relaciones" Cristóbal Colon no hace referencia a la "Santa María" como una carabela sino como una nao. Que carabelas hayan sido, por ejemplo, la Pinta y la Niña, es cosa fuera de duda. Por lo que hace relación a la Santa María, sus dimensiones, su estructura y su misma apariencia la ponían en un plano de superioridad náutica con respecto al tipo tradicional de carabelas conocido en Europa en los últimos años del siglo XV.

  15. Procesos escriturales e identidad en la novelística de Albalucía Ángel Marulanda

    Directory of Open Access Journals (Sweden)

    Graciela Uribe Álvarez

    2001-01-01

    Full Text Available Este ensayo no pretende ser conclusivo; al contrario, es sólo un paso en la búsqueda de singularidades que permitan hablar de una estética de la escritora pereirana Albalucía Ángel Marulanda (1939, al menos en lo que hace referencia a sus cinco novelas: Los girasoles en invierno (1970, Dos veces Alicia (1972, Estaba la pájara pinta sentada en el verde limón (1975, Misiá señora (1982 y Las andariegas (1984.

  16. Brecht y la música

    OpenAIRE

    Paraskevaídis,Graciela

    2008-01-01

    El activista social, hombre de teatro y cantautor Bertolt Brecht define claramente la función que la música debe asumir en el teatro épico, contraponiendo éste al de ópera dramática: la música no es servidora sino mediadora, pone de manifiesto el texto, lo interpreta, toma posición y marca una conducta. La música no ilustra, no pinta situaciones psicologizantes, sino que actúa sobre la sociedad, estimula al oyente y lo obliga a una actitud crítica. Deja de ser sólo un medio de place...

  17. Vastuskertoimen määrittäminen

    OpenAIRE

    Kinnunen, Teemu

    2011-01-01

    Tämän insinöörityön tarkoituksena oli luoda katsaus virtauksessa olevaan kappaleeseen kohdistuvan vastusvoiman vastuskertoimen määrittämiseen. Vastusvoiman suuruus riippuu kappaleen pinta-alasta, dynaamisesta paineesta ja vastuskertoimesta. Vastuskerroin riippuu virtauksen luonteesta, kappaleen pinnankarheudesta ja kappaleen muodosta. Insinöörityön teoriaosuudessa perehdyttiin pääasiassa Frank M. Whiten ja Yunus A. Çengelin teoksiin vastuskertoimen teoriasta, kooten niistä yhtenäinen suo...

  18. Laboratorio de arte y creatividad: propuesta alternativa para los 5 años

    OpenAIRE

    Martínez-Giménez, María Jesús

    2015-01-01

    ¿Qué actividades de artes plásticas se recuerdan de aquella etapa de colegio? ¿Copia, pinta y recorta? ¿El cielo es azul, y los árboles marrones y verdes? El aprendizaje, para que suceda, debe trabajar sobre contenidos motivadores, que permitan se genere un deseo de más conocimiento. El presente Trabajo Fin de Grado formula una propuesta de intervención enfocada a fomentar y estimular la creatividad en niños de 5 años. Pretende ser un impulso para los maestros en el modo de plante...

  19. Molecular evolution and expression of the CRAL_TRIO protein family in insects.

    Science.gov (United States)

    Smith, Gilbert; Briscoe, Adriana D

    2015-07-01

    CRAL_TRIO domain proteins are known to bind small lipophilic molecules such as retinal, inositol and Vitamin E and include such gene family members as PINTA, α-tocopherol transfer (ATT) proteins, retinoid binding proteins, and clavesins. In insects, very little is known about either the molecular evolution of this family of proteins or their ligand specificity. Here we characterize insect CRAL_TRIO domain proteins and present the first insect CRAL_TRIO protein phylogeny constructed by performing reciprocal BLAST searches of the reference genomes of Drosophila melanogaster, Anopheles gambiae, Apis mellifera, Tribolium castaneum, Bombyx mori, Manduca sexta and Danaus plexippus. We find several highly conserved amino acid residues in the CRAL_TRIO domain-containing genes across insects and a gene expansion resulting in more than twice as many gene family members in lepidopterans than in other surveyed insect species, but no lepidopteran homolog of the PINTA gene in Drosophila. In addition, we examined the expression pattern of CRAL_TRIO domain genes in Manduca sexta heads using RNA-Seq data. Of the 42 gene family members found in the M. sexta reference genome, we found 30 expressed in the head tissue with similar expression profiles between males and females. Our results suggest this gene family underwent a large expansion in lepidopteran, making the lepidopteran CRAL_TRIO domain family distinct from other holometabolous insect lineages.

  20. Prediction of genetic gain from selection indices for disease resistance in papaya hybrids Predição de ganhos genéticos para resistência a doenças por índices de seleção em híbridos de mamoeiro

    Directory of Open Access Journals (Sweden)

    Marcelo Vivas

    2012-12-01

    Full Text Available In order to select superior hybrids for the concentration of favorable alleles for resistance to papaya black spot, powdery mildew and phoma spot, 67 hybrids were evaluated in two seasons, in 2007, in a randomized block design with two replications. Genetic gains were estimated from the selection indices of Smith & Hazel, Pesek & Baker, Williams, Mulamba & Mock, with selection intensity of 22.39%, corresponding to 15 hybrids. The index of Mulamba & Mock showed gains more suitable for the five traits assessed when it was used the criterion of economic weight tentatively assigned. Together, severity of black spot on leaves and on fruits, characteristics considered most relevant to the selection of resistant materials, expressed percentage gain of -44.15%. In addition, there were gains for other characteristics, with negative predicted selective percentage gain. The results showed that the index of Mulamba & Mock is the most efficient procedure for simultaneous selection of papaya hybrid resistant to black spot, powdery mildew and phoma spot.Com a finalidade de selecionar híbridos superiores para concentração de alelos favoráveis à resistência de mamoeiro à pinta-preta, oídio e mancha de phoma, foram avaliados, em duas épocas, em 2007, 67 híbridos simples, em delineamento de blocos casualizados com duas repetições. Os ganhos genéticos foram estimados a partir dos índices de seleção de Smith & Hazel, Pesek & Baker, Williams e Mulamba & Mock, com intensidade de seleção de 22,39%, correspondendo a 15 híbridos. O índice de Mulamba & Mock evidenciou ganhos mais adequados para as cinco características avaliadas, quando utilizado o critério de peso econômico atribuído por tentativas. Em conjunto, as severidades da pinta-preta em folhas e em frutos, características consideradas de maior interesse para a seleção de materiais resistentes, expressaram ganho percentual de -44,15%. Além disso, registraram-se ganhos para as demais

  1. Avaliação do extrato etanólico de Ottonia martiana Miq. para o controle de duas doenças florestais Evaluation of Ottonia martiana Miq. alcoholic extract to control two forest diseases

    Directory of Open Access Journals (Sweden)

    M.M. Cunico

    2012-01-01

    Full Text Available Metabólitos secundários presentes em plantas medicinais apresentam várias propriedades biológicas incluindo a atividade antifúngica. Esse estudo avaliou o potencial antifúngico da planta medicinal Ottonia martiana no controle da pinta-preta em erva-mate (Ilex paraguariensis e do mofo-cinzento em eucalipto (Eucalyptus dunnii. Extrato etanólico (EBEtOH dos órgãos totais (raízes, caules, folhas e frutos foi preparado e testado na concentração de 1000 μg mL-1 contra os patógenos Cylindrocladium spathulatum (pinta-preta e Botrytis cinerea (mofo-cinzento. Bioensaios in vitro (germinação de esporos e bioautografia direta e in vivo (teste de patogenicidade em mudas mostraram que o EBEtOH reduziu o crescimento micelial dos patógenos testados e a germinação dos esporos de C. spathulatum e estimulou a germinação de esporos de B. cinerea. O teste de patogenicidade mostrou que o controle da pinta-preta em erva-mate e do mofo cinzento em eucalipto não é viável usando-se a concentração testada de EBEtOH de O. martiana. Na bioautografia direta, foram detectadas zonas de inibição de crescimento micelial dos fungos e que foram relacionadas com a presença de piperovatina.Secondary metabolites from medicinal plants have several biological properties, including antifungal activity. This study evaluated the antifungal potential of the medicinal plant Ottonia martiana to control maté leaf spot (Ilex paraguariensis and eucalypt gray mould (Eucalyptus dunnii. Ethanol extract (EBEtOH of the total parts (roots, stems, leaves and fruits was prepared at the concentration of 1000 μg mL-1 and tested against Cylindrocladium spathulatum (maté leaf spot and Botrytis cinerea (eucalypt gray mould. In vitro bioassays (spore germination and direct bioautography and in vivo bioassays (pathogenicity test in seedlings showed that EBEtOH reduced the mycelial growth of the tested pathogens and the germination of C. spathulatum spores and stimulated the

  2. Genetic diversity in Treponema pallidum: implications for pathogenesis, evolution and molecular diagnostics of syphilis and yaws.

    Science.gov (United States)

    Smajs, David; Norris, Steven J; Weinstock, George M

    2012-03-01

    Pathogenic uncultivable treponemes, similar to syphilis-causing Treponema pallidum subspecies pallidum, include T. pallidum ssp. pertenue, T. pallidum ssp. endemicum and Treponema carateum, which cause yaws, bejel and pinta, respectively. Genetic analyses of these pathogens revealed striking similarity among these bacteria and also a high degree of similarity to the rabbit pathogen, Treponema paraluiscuniculi, a treponeme not infectious to humans. Genome comparisons between pallidum and non-pallidum treponemes revealed genes with potential involvement in human infectivity, whereas comparisons between pallidum and pertenue treponemes identified genes possibly involved in the high invasivity of syphilis treponemes. Genetic variability within syphilis strains is considered as the basis of syphilis molecular epidemiology with potential to detect more virulent strains, whereas genetic variability within a single strain is related to its ability to elude the immune system of the host. Genome analyses also shed light on treponemal evolution and on chromosomal targets for molecular diagnostics of treponemal infections.

  3. AcEST: DK958984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3-O-methyltransferase OS=Clar... 99 2e-20 sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Po...... 99 3e-20 sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Po... 97 7e-20 sp|O81646|COMT1_CAPC...|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Po... 92 2e-18 sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-m...ethyltransferase OS=Rosa... 92 2e-18 sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Po....0|Q5IDE0_PINTA Caffeate O-methyltransferase (Fragment) O... 92 3e-17 tr|Q1JUZ8|Q1JUZ8_IPONI Caffeic acid 3-O

  4. Cuando esas nuevas ramas crezcan yo también habré sanado

    Directory of Open Access Journals (Sweden)

    Ruysen Flores

    2014-09-01

    Full Text Available Ruysen Flores narra sobre cómo superó una enfermedad espiritual que lo aquejaba, siguiendo el ejemplo de las plantas que le había enseñado su maestro Pablo Amaringo. Así como las plantas al podarlas se renuevan, así su espíritu se sanó. Su inspiración es la mitología, la costumbre y las plantas. En su pintura hay un espíritu femenino acuático, cuyos hijos son los delfines. Ruysen pinta a los espíritus protectores que aparecen en los rituales de los chamanes y los espíritus de las plantas y los elementos. Utiliza figuras que vienen en perspectiva, también muy utilizadas por Pablo Amaringo, a las que llamaba “tingunas”. 

  5. AcEST: DK953240 [AcEST

    Lifescience Database Archive (English)

    Full Text Available se 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9AR74 Definition sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta...ns-cinnamate 4-monooxygenase OS=Ruta gra... 124 4e-28 sp|Q43054|TCMO_POPKI Trans-...e-12 >sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 Length = ...tr|Q5IDB4|Q5IDB4_PINTA Cinnamate 4-hydroxylase (Fragment) OS=Pin... 130 6e-29 tr|Q8H6A1|Q8H6A1_RUTGR Cinnamate 4-hydroxylase OS=Ruta...RTRNVVFDIFTGKGQDMVFTVY 129 >tr|Q8H6A1|Q8H6A1_RUTGR Cinnamate 4-hydroxylase OS=Ruta

  6. Hulevesien hallintavaihtoehtojen mallinnus tiiviissä taajamassa

    OpenAIRE

    Raudaskoski, Outi

    2016-01-01

    Vettä läpäisemättömän pinnan määrä on lisääntynyt kaupungistumisen myötä. Läpäisemätön pinta vaikuttaa veden luonnolliseen kiertokulkuun vähentämällä imeytymistä ja haihduntaa ja lisäämällä pintavaluntaa. Tämän työn tavoitteena oli arvioida erilaisten hulevesien hallintarakenteiden vaikutuksia rankkasadetapahtumien aiheuttamaan valuntaan tiiviisti rakennetussa kaupunkiympäristössä. Tutkimusalueena työssä oli Vallikallion alue Espoossa. Alueen hydrologiaa mallinnettiin SWMM (Storm Water Manage...

  7. AcEST: DK945226 [AcEST

    Lifescience Database Archive (English)

    Full Text Available icea... 46 0.001 tr|Q38JD0|Q38JD0_PINTA Temperature-induced lipocalin OS=Pinus ta... 45 0.001 tr|Q38JE2|Q38JE2_SORBI Temperature...-induced lipocalin-2 OS=Sorghu... 45 0.002 tr|Q38JD4|Q38JD4_SOLLC Temperature...-induced lipocalin OS=Solanum ... 44 0.003 tr|Q38JC7|Q38JC7_SOLTU Temperature-induced lipoca...lin OS=Solanum ... 44 0.003 tr|Q8S9H0|Q8S9H0_WHEAT Temperature stress-induced lipocalin OS=T... 44 0.004 tr|Q38JB1|Q38JB1_TORRU Tempe...rature-induced lipocalin OS=Tortula ... 44 0.005 tr|Q38JE7|Q38JE7_MAIZE Temperatu

  8. Grabados Rupestres de Carros y Ruedas en Vegas de Coria (Cáceres

    Directory of Open Access Journals (Sweden)

    María Carmen SEVILLANO SAN JOSÉ

    2009-10-01

    Full Text Available Presentamos un nuevo petroglifo inédito aparecido en la localidad de Vegas de Coria en la provincia de Cáceres. Interesada en el tema de estas piedras con grabados, y siguiendo las indicaciones de mis compañeros Fernando Alonso y Javier Fortea, que habían visto personalmente este nuevo petroglifo, nos presentamos en la localidad de Vegas de Coria acompañada del primero de ellos. Al llegar al citado pueblo, los naturales dieron muestras enseguida de conocer el petroglifo, que ellos denominan «la piedra pinta». Nos lo describieron diciendo que tenía soles y estrellas pintados y que muchas veces se habían sentado encima de él.

  9. Productivity of semi-domesticated reindeer in Finland

    Directory of Open Access Journals (Sweden)

    Ilpo Kojola

    1991-10-01

    Full Text Available In spite of a twofold increase in the density of reindeer in Finland from 1974 to 1987, meat production per reindeer increased during this period. This was possible due to calf harvesting and supplemental feeding. Results from multiple regression models indicated that calf harvesting influenced both per unit area and per capita production more than supplemental feeding. Correlation between meat production and animal density decreased with increased supplemental feeding. Traditionally, southern and central herds of reindeer fed mainly on arboreal lichens in late winter; however, due to large-scale logging, woodlands rich of arboreal lichens had been greatly reduced. Economic carrying capacity of the winter range apparently has been exceeded in the south; a heavy crash in the number of reindeer is likely if supplemental feeding ceases. In northern herds, intensive calf harvesting enabled satisfactory yield without supplemental feeding. In northern herds, yield increased mainly per unit area (i.e. by increases in herd size; in the south yield per reindeer increased.Lithantuotantoon vaikuttavat tekijat Suomen poron-hoidossa.Abstract in Finnish / Tiivistelmd: Huolimatta Suomessa vuosien 1974 ja 1987 valilla tapahtuneesta porotiheyden kaksinkertaistumisesta, lihantuotto poroa kohti kasvoi jakson aikana. Tama johtui oletettavasti vasateurastuksesta ja lisaruokinnasta. Monimu-uttujaregressiomallien tulosten perusteella vasateurastuksella nayttaisi olevan lisaruokintaa suurempi vaikutus seka poroa etta pinta-alaa kohti laskettuun tuottoon. Ruokinnan tehostuessa pienentyi lihantuoton ja porotiheyden valinen riippuvuus. Etelaosan ja keskiosan porot syovat perinteisesti puussa kasvavia jakalia kevattalvella. Hakkuista johtuen luppometsien osuus on suuresti vahentynyt. Talvilaidunten ekonomien kantokyky on ilmeisesti ylitetty etela- ja keski-osassa; syva romahdus poromaarissa on todennakoista, jos ruokinta lopetettaisiin. Pohjoisosassa voima-perainen vasate

  10. Marcação individual de triatomíneos para estudos comportamentais e ecologicos Individual marking of tiratominea for behavioral and ecological studies

    Directory of Open Access Journals (Sweden)

    José Roberto Mac Cord

    1983-12-01

    Full Text Available Idealizou-se uma técnica de marcação de insetos adultos, visando principalmente à identificação individual de triatomineos, que consiste na elaboração de códigos correspondentes a números, através de cinco cores basicas (vermelho, branco, azul, verde e amarelo representadas por pintas coloridas feitas com tinta esmalte e depositadas do pronoto ao escutelo do inseto manualmente, com um fino pincel de seda. As pintas não devem se estender às asas sobrepostas, porque estas mudam constantemente de posição, encobrindo assim a marcação. A tinta é indelével e, por não apresentar toxicidade, não afeta a longevidade e o comportamento dos insetos. A técnica pode ser utilizada tanto para insetos no laboratório quanto no campo principalmente em trabalhos relacionados à Ecologia e ao Comportamento.A technique for marking adult insects was worked out, aiming at the individual identification of triatomine bugs. It consists on the development of codes corresponding to numbers (units, tens and hundreds by means of five basic colours (red, white, blue, green and yellow, represented by colored spots hand-made with enamel paint from the pronotum to the scutellum of the insect, with a fine silk paint-brush. The spots should not reach the overlapped wings, for these often change position, therefore covering the marks. Being the paint indelible and nontoxic, the life-span and the behaviour of the bugs is not affected. The technique may be applied to insects in the laboratory as well as in the field, specially in studies related to Ecology and Behaviour.

  11. A new species of Pimelodus LaCépède, 1803 (Siluriformes: Pimelodidae from the rio São Francisco drainage, Brazil

    Directory of Open Access Journals (Sweden)

    Frank Raynner V. Ribeiro

    2006-12-01

    Full Text Available Pimelodus pohli, new species, is described from the rio São Francisco drainage. It differs from congeners by the following characters in combination: adults with dark spots on anterodorsal region of body and young specimens (up to 100 mm SL with three rows of dark spots laterally on body; comparatively long adipose fin, more than one third of the distance between posterior end of dorsal fin base and the vertical through posterior end of anal-fin base (21.8-26.2% SL; lips poorly developed; 20-25 gill rakers; and maxillary barbels slightly surpassing the caudal-fin base. A key to the species of Pimelodus of the rio São Francisco drainage is presented.Pimelodus pohli, nova espécie, é descrita da bacia do rio São Francisco. Difere de suas congêneres pela seguinte combinação de caracteres: presença, em exemplares adultos, de pintas escuras na região ântero-lateral do corpo e, em exemplares jovens, de três fileiras de pintas nos lados do corpo (até 100 mm CP; nadadeira adiposa comparativamente longa, ocupando mais de um terço da distância entre o fim da base da nadadeira dorsal e a vertical que passa pelo fim da base da nadadeira anal (21,8-26,2% CP; lábios não desenvolvidos; 20 a 25 rastros branquiais e barbilhões maxilares indo pouco além da base da nadadeira caudal. Uma chave para as espécies de Pimelodus da bacia do rio São Francisco é apresentada.

  12. Disease Gene Prioritization Using Network and Feature

    Science.gov (United States)

    Agam, Gady; Balasubramanian, Sandhya; Xu, Jinbo; Gilliam, T. Conrad; Maltsev, Natalia; Börnigen, Daniela

    2015-01-01

    Abstract Identifying high-confidence candidate genes that are causative for disease phenotypes, from the large lists of variations produced by high-throughput genomics, can be both time-consuming and costly. The development of novel computational approaches, utilizing existing biological knowledge for the prioritization of such candidate genes, can improve the efficiency and accuracy of the biomedical data analysis. It can also reduce the cost of such studies by avoiding experimental validations of irrelevant candidates. In this study, we address this challenge by proposing a novel gene prioritization approach that ranks promising candidate genes that are likely to be involved in a disease or phenotype under study. This algorithm is based on the modified conditional random field (CRF) model that simultaneously makes use of both gene annotations and gene interactions, while preserving their original representation. We validated our approach on two independent disease benchmark studies by ranking candidate genes using network and feature information. Our results showed both high area under the curve (AUC) value (0.86), and more importantly high partial AUC (pAUC) value (0.1296), and revealed higher accuracy and precision at the top predictions as compared with other well-performed gene prioritization tools, such as Endeavour (AUC-0.82, pAUC-0.083) and PINTA (AUC-0.76, pAUC-0.066). We were able to detect more target genes (9/18/19/27) on top positions (1/5/10/20) compared to Endeavour (3/11/14/23) and PINTA (6/10/13/18). To demonstrate its usability, we applied our method to a case study for the prediction of molecular mechanisms contributing to intellectual disability and autism. Our approach was able to correctly recover genes related to both disorders and provide suggestions for possible additional candidates based on their rankings and functional annotations. PMID:25844670

  13. Influência do sistema de condução do tomateiro sobre a incidência de doenças e insetos-praga Influence of the training systems of tomato plants on the incidence of diseases and insect-pests

    Directory of Open Access Journals (Sweden)

    Anderson Fernando Wamser

    2008-06-01

    Full Text Available Avaliou-se o efeito dos métodos de tutoramento e de condução de plantas de tomate sobre a severidade de doenças foliares e sobre a incidência de pragas em frutos em diferentes cultivares. Dois experimentos foram realizados em 2004/2005 e 2005/2006 em Caçador, SC. Os tratamentos consistiram da combinação de duas cultivares (Carmen e Débora Max, em 2004/2005, e Nemo Netta e San Vito, em 2005/2006; quatro métodos de tutoramento (cruzado, 'mexicano', vertical com bambu e vertical com fitilho e dois métodos de condução de plantas (com uma e duas hastes por planta mantendo o mesmo número de hastes por área em parcelas sub-subdivididas. Foram avaliadas as severidades de requeima, pinta-preta e mancha bacteriana nas folhas e a porcentagem de frutos com danos causados por doenças fisiológicas ou fitopatológicas e por brocas. Os métodos de tutoramento vertical proporcionaram menor severidade de requeima, pinta-preta e mancha bacteriana nas folhas e ataque de brocas nos frutos, em relação ao método de tutoramento cruzado. A severidade de doenças foliares e porcentagem de frutos com ataque de brocas não diferiram entre métodos de condução de plantas.The effect of different methods of staking and training tomato plants was investigated to determine the severity of leaf damage and the incidence of pests in fruits of different cultivars. Two experiments were carried out in 2004/2005 and 2005/2006, in Caçador, Santa Catarina State, Brazil. The treatments consisted of the combination of two cultivars, Carmen and Débora Max, in 2004/2005, and Nemo Netta and San Vito, in 2005/2006; four staking methods, crossed fence, 'Mexican', vertical staking with bamboo and vertical staking with polypropylene cord; and two training methods, one and two stems per plant keeping the same number of stems per area. Severities of late blight, early blight and bacterial spot in leaves and the percentage of fruits with physiological and phytopathological

  14. Trascendiendo al yo ensimismado. La ética de la atención de Iris Murdoch

    Directory of Open Access Journals (Sweden)

    Cuartango, Román

    2006-12-01

    Full Text Available Many of moral dilemmas would lose its intensity, thinks Iris Murdoch, if we left the confused idea of a sovereign will that chooses independently its courses of action. Paying attention to what constitutes the reality enables a sort of asceticism of the experience, that leads beyond the deliriums of an I absorbed. The exercise of estimating the details, the connections, the complexity, modifies the decision itself: it does not be a matter of electing, but of “seeing” the moral thing -the demand of the thing-, the same as an exact artist does not paint what “he likes” but “what it is there”.

    Muchos de los dilemas morales perderían su intensidad, piensa Iris Murdoch, si abandonáramos la idea de una voluntad soberana que elige autónomamente sus cursos de acción. Prestar atención a la constitución de la realidad posibilita una suerte de ascesis experiencial que conduce más allá del los devaneos de un yo ensimismado. El ejercicio de apreciación de los detalles, de las conexiones, de la complejidad, modifica la decisión misma: no se trata de elegir, sino de “ver” lo moral –la exigencia de la cosa–, igual que un artista cabal no pinta lo que “le gusta” sino “lo que está ahí”.

  15. Cryptic differentiation in the endemic micromoth Galagete darwini (Lepidoptera, Autostichidae) on Galápagos volcanoes.

    Science.gov (United States)

    Schmitz, Patrick; Cibois, Alice; Landry, Bernard

    2008-10-27

    To gain insight into the early stages of speciation, we reconstructed a DNA-based phylogeny, using combined mitochondrial (cytochrome c oxidase subunits I and II: 1008 bp) and nuclear (elongation factor 1-alpha and wingless: 1062 bp) markers of populations of the moth Galagete darwini endemic to the Galápagos, which belongs to an insular radiation similar in size to that of Darwin's finches. Adults of G. darwini were collected in the arid lowlands of 11 of the Galápagos Islands (Baltra, Española, Fernandina, Floreana, Isabela, Pinta, Pinzón, San Cristobal, Santa Cruz, Santiago and Seymour) and the humid highlands of a subset of 5 of them (Fernandina, Floreana, Isabela, Santa Cruz and Santiago). The combined phylogeographic analysis surprisingly revealed that G. darwini populations at higher elevation on the western islands (Fernandina, Isabela and Santiago) represent a distinct lineage from the one in the low arid zones of these same islands. This is the first reported case in the archipelago of genetic cryptic differentiation correlated with elevation on the western Galápagos volcanoes.

  16. ‘URSBRS HADA’: TANGOREIRO DE MATURAÇÃO TARDIA E DUPLO PROPÓSITO

    Directory of Open Access Journals (Sweden)

    MATEUS PEREIRA GONZATTO

    2015-06-01

    Full Text Available O presente trabalho tem como objetivo apresentar a caracterização hortícola básica da nova cultivar de tangoreiro ‘URSBRS Hada’. A partir de avaliações nas condições edafoclimáticas da região da Depressão Central do Rio Grande do Sul, a cultivar demonstra maturação tardia (outubro a dezembro e duplo propósito de uso dos frutos (consumo in natura e produção de suco, além de apresentar-se tolerante, em condições de campo, a doenças, como: cancro-cítrico, pinta-preta e mancha-marrom de alternária. Seus frutos possuem formato achatado, coloração de amarelada a amarelo-alaranjada e são bastante sucosos, com alto teor de sólidos solúveis (SS e elevada acidez (AT . Além disso, trata-se de cultivar bastante produtiva, podendo produzir 20-25 t ha-1 por ano. Em síntese, o tangoreiro ‘URSBRS Hada’ é mais uma opção varietal para a citricultura.

  17. On the origin of the treponematoses: a phylogenetic approach.

    Directory of Open Access Journals (Sweden)

    Kristin N Harper

    Full Text Available BACKGROUND: Since the first recorded epidemic of syphilis in 1495, controversy has surrounded the origins of the bacterium Treponema pallidum subsp. pallidum and its relationship to the pathogens responsible for the other treponemal diseases: yaws, endemic syphilis, and pinta. Some researchers have argued that the syphilis-causing bacterium, or its progenitor, was brought from the New World to Europe by Christopher Columbus and his men, while others maintain that the treponematoses, including syphilis, have a much longer history on the European continent. METHODOLOGY/PRINCIPAL FINDINGS: We applied phylogenetics to this problem, using data from 21 genetic regions examined in 26 geographically disparate strains of pathogenic Treponema. Of all the strains examined, the venereal syphilis-causing strains originated most recently and were more closely related to yaws-causing strains from South America than to other non-venereal strains. Old World yaws-causing strains occupied a basal position on the tree, indicating that they arose first in human history, and a simian strain of T. pallidum was found to be indistinguishable from them. CONCLUSIONS/SIGNIFICANCE: Our results lend support to the Columbian theory of syphilis's origin while suggesting that the non-sexually transmitted subspecies arose earlier in the Old World. This study represents the first attempt to address the problem of the origin of syphilis using molecular genetics, as well as the first source of information regarding the genetic make-up of non-venereal strains from the Western hemisphere.

  18. PERANAN KOMPETENSI INTI DALAM MERGER DAN AKUISISI

    Directory of Open Access Journals (Sweden)

    Dwi Sulistiani

    2013-11-01

    Full Text Available Dalam era globalisasi dan pedagangan  bebas dewasa ini strategi merger dan akuisisi  merupakan fenomena yang semakin marak dilakukan oleh para pelaku bisnis dan  semakin menarik untuk dicermati bersama. Untuk menjalankan perusahaan para manajemen perusahaan selalu dituntut menjaga pertumbuhan usahanya secara optimal. Penerapan strategi merger dan akuisisi merupakan jalan pintas untuk mewujudkan pertumbuhan usaha tanpa perusahaan perlu memulai dari awal suatu jenis usaha yang baru. Dalam suatu kondisi perusahaan yang kuat cenderung membeli perusahaan lain untuk meningkatkan daya saing dan penghematan biaya. Perusahaan yang terlibat dalam merger dan akuisisi akan dapat diperoleh pangsa pasar yang lebih besar dan efisiensi terhadap biaya. Perusahaan yang merasa tidak dapat bertahan hidup secara individual biasanya merelakan diri untuk menjadi target akuisisi. Merger dan akuisisi merupakan suatu realitas dan tantangan yang harus siap dihadapi oleh para pelaku usaha dalam era perdagangan bebas saat ini. Namun tingkat kesuksesan dalam melakukan kegiatan merger dan akuisisi juga sangat dipengaruhi oleh kondisi internal perusahaan meliputi sumber daya, kapabilitas dan kompetensi inti yang dimiliki oleh perusahaan. Tulisan ini akan mencoba memberikan pemahaman bahwa sumber daya, kapabilitas dan  kompetensi inti merupakan faktor penting dalam melakukan kegiatan penggabungan usaha yang pada akhirnya dapat menentukan tingkat keberhasilan proses merger dan akuisisi yang sedang dijalankan oleh perusahaan

  19. How Far into Europe Did Pikas (Lagomorpha: Ochotonidae) Go during the Pleistocene? New Evidence from Central Iberia

    Science.gov (United States)

    Laplana, César; Sevilla, Paloma; Arsuaga, Juan Luis; Arriaza, Mari Carmen; Baquedano, Enrique; Pérez-González, Alfredo

    2015-01-01

    This paper reports the first find of pika remains in the Iberian Peninsula, at a site in central Spain. A fragmented mandible of Ochotona cf. pusilla was unearthed from Layer 3 (deposited some 63.4±5.5 ka ago as determined by thermoluminescence) of the Buena Pinta Cave. This record establishes new limits for the genus geographic distribution during the Pleistocene, shifting the previous edge of its known range southwest by some 500 km. It also supports the idea that, even though Europe’s alpine mountain ranges represented a barrier that prevented the dispersal into the south to this and other taxa of small mammals from central and eastern Europe, they were crossed or circumvented at the coldest time intervals of the end of the Middle Pleistocene and of the Late Pleistocene. During those periods both the reduction of the forest cover and the emersion of large areas of the continental shelf due to the drop of the sea level probably provided these species a way to surpass this barrier. The pika mandible was found accompanying the remains of other small mammals adapted to cold climates, indicating the presence of steppe environments in central Iberia during the Late Pleistocene. PMID:26535576

  20. The European-American exchange.

    Science.gov (United States)

    Guerra, F

    1993-01-01

    The European-American exchange of infectious diseases was responsible for the demographic havoc of the native population in the New World after 1492. Prior to this date medical writers describe the presence in Spain of viral diseases like influenza, parotitis, smallpox, measles, poliomyelitis, and rabies; there were also rickettsiasis, diphtheria, salmonellosis, plague, tubercolosis, leprosy, malaria, scabies and tinea. In America, before European arrivals, there were no records of human viral diseases, though there were records of rickettsiasis, treponematosis--pinta, yaws and syphilis--leihsmaniasis, amibiasis and perhaps leprosy. With the discovery of America in 1492, Columbus's sailors were contaminated by yaws and spread this disease into Europe. In 1493 influenza, as a zoonosis, was introduced into Santo Domingo and was responsible for the annihilation of the natives of the Antilles in less than a quarter of a century; in 1518 smallpox was also introduced in Santo Domingo and then to the American continent by negro slaves: by the same means measles were introduced in 1531. The previous existence or introduction of other infectious diseases in America is also discussed.

  1. Growth rates and morphological measurements of Porcupine caribou calves

    Directory of Open Access Journals (Sweden)

    Katherine L. Parker

    1989-06-01

    Full Text Available Body weights, leg lengths, and surface area were monitored for bottle-raised barren-ground caribou calves (Rangifer tarandus granti from the Porcupine herd up to 1 year of age. Body weights were compared with maternally-raised calves from the same cohort in the wild and from the Delta herd. A successful feeding regime for bottle-raising caribou calves is presented.Veksthastigheter og morfologiske mål hos Porcupine karibu-kalver.Abstract in Norwegian / Sammendrag: Kroppsvekter, visse knokkel-lengder og kropps-overflate areal ble målt hos flaske-oppfødde kalver av barren-ground karibu (Rangifer tarandus granti fra Porcupine-stammen opp til 1 års alder. Kroppsvekter ble sammelignet med normalt oppfødde kalver av samme type i det fri og fra Delta-stam-men. Det presenteres et vellykket system for flaske-oppforing av karibu-kalver.Porcupine-lauman karibuvasojen kasvunopeus ja morfologiset mitat.Abstract in Finnish / Yhteenveto: Porcupine -lauman pulloruokinnalla olleiden tundrakaribuvasojen ruumiinpainot, jalanpituu-det ja ruumiin pinta-alat mitattiin 1 vuoden ikäään saakka. Ruumiinpainoja verrattiin vastaaviin luonnon-oloissa kasvaneisiin saman lauman ja Delta -lauman vasoihin. Tutkimus kuvaa toimivan vasojen pulloruo-kintamenetelmän.

  2. Céu como pintura? Sobre o emprego de διαζωγράφω no passo 55c do Timeu de Platão

    Directory of Open Access Journals (Sweden)

    Lethicia Ouro Oliveira

    2015-04-01

    Full Text Available No mito cosmogônico do diálogo Timeu de Platão, o personagem homônimo narra como um deus artesão confecciona o universo. Dentre outras artes empregadas, o artesão do mundo utiliza-se da pictórica. Platão emprega o verbo διαζωγράφω, que pode significar tanto “configurar” quanto “pintar”, quando fala da formação do céu. O artesão do mundo o configura na forma de um poliedro regular, o dodecaedro, e pinta nele as constelações. Em nosso texto buscaremos primeiramente esclarecer o sentido geral desta “configuração pictórica”. O que Platão quer dizer nesta passagem do mito? Buscando tal esclarecimento, teremos o embasamento para pesquisar por que quando trata da formação das constelações, do céu, ele usa a imagem da pintura, objetivo central desta investigação. Por meio da análise de algumas hipóteses interpretativas, indicaremos direcionamentos de leitura que transparecem seu pensamento sobre o caráter da μίμησις pictórica e, além disso, de sua própria cosmologia.

  3. Do delirante ao ficcional: um estudo sobre a situação psicanalítica em um caso de paranóia

    Directory of Open Access Journals (Sweden)

    Joyce Marly Gonçalves Freire

    Full Text Available Este ensaio é um estudo psicanalítico a respeito de Lia, paranóica, artista em tempo integral, que, ao tecer suas estórias, viu a linha que separa a ficção da realidade ser esfumaçada em seu ato de escrita. Escritora de romances e poesias, Lia também pinta sobre quaisquer suportes que se lhe apresentam. Consideraremos que sua paranóia não pode ser separada de sua produção literária e gráfica, pois elas estão entranhadas umas nas outras. Assim, o tratamento psicanalítico realizado com essa paciente decorreu precisamente daquilo que constitui sua paranóia: sua produção escrita e artística. No desenrolar da situação analítica sua escrita é transformada pela leitura de um outro fora dela e, nesse nicho, Lia pôde construir uma forma diferente de subjetivação.

  4. Visualization and volumetric structures from MR images of the brain

    Energy Technology Data Exchange (ETDEWEB)

    Parvin, B.; Johnston, W.; Robertson, D.

    1994-03-01

    Pinta is a system for segmentation and visualization of anatomical structures obtained from serial sections reconstructed from magnetic resonance imaging. The system approaches the segmentation problem by assigning each volumetric region to an anatomical structure. This is accomplished by satisfying constraints at the pixel level, slice level, and volumetric level. Each slice is represented by an attributed graph, where nodes correspond to regions and links correspond to the relations between regions. These regions are obtained by grouping pixels based on similarity and proximity. The slice level attributed graphs are then coerced to form a volumetric attributed graph, where volumetric consistency can be verified. The main novelty of our approach is in the use of the volumetric graph to ensure consistency from symbolic representations obtained from individual slices. In this fashion, the system allows errors to be made at the slice level, yet removes them when the volumetric consistency cannot be verified. Once the segmentation is complete, the 3D surfaces of the brain can be constructed and visualized.

  5. Polyphenol content and antioxidant activity of maqui (Aristotelia chilensis Molina Stuntz during fruit development and maturation in Central Chile Contenidos de polifenoles y actividad antioxidante de maqui (Aristotelia chilensis Molina Stuntz durante el desarrollo y maduración de frutos en Chile Central

    Directory of Open Access Journals (Sweden)

    Carolina Fredes

    2012-12-01

    determinar el contenido de fenoles totales, antocianos totales y la actividad antioxidante (método FRAP habilidad del plasma para reducir el hierro férrico de frutos de maqui cosechados en diferentes estados de madurez de dos poblaciones silvestres ubicadas en Chile Central. Cada estado de madurez fue caracterizado de acuerdo a los días desde la cuaja de frutos, tamaño y sólidos solubles. El contenido de fenoles totales disminuyó mientras que el contenido de antocianos totales aumentó desde fruto verde hasta fruto en pinta; sin embargo, los valores de ambas variables aumentaron desde pinta hasta fruto purpura oscuro. La mayor capacidad antioxidante se observó en los frutos del Ultimo estado de maduez analizado (purpura oscuro. Los resultados demostraron que la madurez de consumo en frutos de maqui puede ser esperada con 1100 grados día de crecimiento (91 d después de cuaja en Chile Central. En este momento de cosecha, frutos con sólidos solubles entre 18 y 19 °Brix tienen los mayores contenidos de antocianos y actividad antioxidante (FRAP. Este estudio constituye los primeros avances en el entendimiento de la maduración de frutos de maqui y su correspondiente actividad antioxidante.

  6. CONTROLE DE ALTERNARIA SOLANI COM FUNGICIDAS NA CULTURA DO TOMATEIRO CONTROL OF ALTERNARIA SOLANI WITH FUNGICIDES IN TOMATO PLANTS

    Directory of Open Access Journals (Sweden)

    Fabrício Silva Coelho

    2011-06-01

    Full Text Available A pinta-preta, causada pelo fungo Alternaria solani, caracteriza-se por ser uma importante e destrutiva doença da cultura do tomate, sob condições de alta temperatura e umidade. Objetivou-se avaliar a eficiência de diferentes fungicidas no controle da Alternaria solani na cultura do tomateiro na região de Lavras (MG. O experimento foi desenvolvido na Universidade Federal de Lavras - Departamento de Agricultura, no período de novembro de 2004 a janeiro de 2005. O delineamento experimental foi o de blocos casualizados com 10 tratamentos e quatro repetições. Cada parcela composta por 12 plantas. As aplicações foram realizadas com um pulverizador costal manual (45 lbf/pol2, volume de aplicação de 800 L•ha-1, totalizando sete aplicações, com intervalos de sete dias. Foram realizadas cinco avaliações para a severidade foliar da doença com o uso de escala diagramática. Todos os fungicidas apresentaram potencial de controle da pinta-preta dentro das características inerentes ao seu grupo químico. Os melhores níveis de controle foram obtidos com os tratamentos Chlorothalonil 500 g•L-1 + Tetraconazole 20 g•L-1 (dosagem 200 mL•100 L-1, Chlorothalonil 400 g•L-1+ Oxicloreto de Cobre 420 g•kg-1 e Chlorothalonil 750 g•kg-1 + Tetraconazole 20 g•kg-1 (dosagem 150 g•100 L-1. Tetraconazole 100 g•L-1 proporcionou os menores níveis de controle.The early blight disease on tomato, caused by the fungus Alternaria solani, is referred to in importance due its destructive power, under conditions of high temperature and humidity. This study aimed to evaluate the effectiveness of various fungicides in your control in the region of Lavras-MG, Brazil. The experiment was conducted at the Federal University of Lavras, Department of Agriculture in the period from November 2004 to January 2005. The experimental design was randomized blocks with 10 treatments and four replications, each plot comprise 12 plants. The applications were made

  7. [Typical dishes consumed in Sonora: regionalization and nutrient contribution].

    Science.gov (United States)

    Jardines, R P; Bermúdez, M C; Wong, P; León, G

    1985-12-01

    This study deals with the development of a method to identify typical food dishes, successfully applied in the State of Sonora, Mexico. The State was divided into six regions considering the size of the territory and existence of different physical, economic and sociocultural conditions, and how they influence the consumption patterns. A list of 66 regional food dishes was prepared by interviewing housewives from different parts of Sonora who now lived in the city of Hermosillo. From this list, 47 dishes were identified as regionally consumed, and a State-wide survey was performed to determine their frequency of consumption. Based on the categories of "very frequently", "frequently" and "less frequently", a group of 15 dishes (2 per region, plus 3 dishes throughout the State) was selected. A questionnaire was used to obtain the different ways they had of preparing them. The "typical recipe" for each dish was also determined, using the mode as statistical parameter. Samples of these food dishes were prepared at the laboratory following the selected home recipes for proximal analysis and determination of their vitamin A, thiamine, riboflavin, niacin, calcium, phosphorus and iron content. The results showed that a portion of "gallina pinta" contributed more than 25% of the daily recommended intake established by the National Institute of Nutrition "Salvador Zubirán" (INNSZ) for an adult man for energy, protein, iron, niacin and 24.3% thiamine and 21.0% calcium. The "chivichangas de queso", for example, contributed 45.2% of the calcium requirement, and the "tamales de carne", 36% iron.(ABSTRACT TRUNCATED AT 250 WORDS)

  8. Emprêgo de desfolhantes na cultura da batatinha The use of potato vine killers

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1962-01-01

    Full Text Available Uma das medidas que se impõem para a melhoria do estado de sanidade dos tubérculos de batatinha (Solanum tuberosum L., tanto para o consumo como principalmente para o plantio, é a destruição da folhagem com alguma antecedência à colheita normal Além dessa melhoria, tal prática permite colocar o produto no mercado antes das épocas das maiores safras obtendo-se maiores lucros. Neste trabalho são apresentados resultados obtidos com o emprêgo de desfolhantes físicos, químicos e mecânicos, para determinação dos mais eficientes nas condições locais. Tal prática, em relação ao estado de sanidade, principalmente quanto às moléstias de vírus e apodrecimentos devidos à requeima (Phytophthora infestans e pinta preta (Alternaria solani, será objeto de novos experimentos, utilizando-se como desfolhante aquêles que, neste trabalho, se mostraram mais eficientes e econômicos, como foi o casododinitro-orto-secundário-butil-fenol e do dínitro-cresol.This paper discusses the results of preliminary tests for determining the best way to kill the potato vine under the conditions of the State of São Paulo. Of the methods compared (cutting or flaming the vines, or spraying them with sodium chlorate, sodium arsenite, dinitro cresol or dinitro-o-sec-butyl phenol, spraying with the dinitro derivatives seemed to be the best. Further experiments are needed to observe the incidence of virus diseases and rots caused by Phytophthora infstans and Alternaria solani in the seed potatoes coming from fields treated with the latter products.

  9. Le roi, la reine, et le nègre d’or

    Directory of Open Access Journals (Sweden)

    Narjess Outreligne-Saidi.

    2007-02-01

    Full Text Available Pour perpétuer une « tradition » littéraire, Michel Georges Michel invente un nouveau rôle à Shéhérazade, l’héroïne des Mille et Une Nuit. Il s’agit d’une transposition du conte-cadre dans laquelle le poète, qui est aussi peintre et dessinateur, nous peint un tableau d’un Orient paradisiaque qui se transforme rapidement en une scène tragique, en un massacre. Il s’agit aussi d’une interrogation sur la relation du couple homme-femme.In order to perpetuate a so-called literary tradition, Michel George Michel invents a new role for Shehrezed, the heroine of A Thousand and One Night. The poet, who also paints and draws, transposes the framing tale in order to depict a picture of a paradisical Orient, which quickly turns, however, into a tragic scene of a massacre. The story also interrogates the relationship between men and women.Para perpetuar una « tradición » literaria, Michel Georges Michel crea un nuevo papel para Scherezada, heroína de las Mil y Una noches. Se trata de una transposición del cuento original en la que el poeta, poeta y dibujante, nos pinta el cuadro de un Oriente paradisíaco que se transforma rápidamente en una escena trágica, en una masacre. Además, el poeta interroga la relación del binomio hombre-mujer.

  10. Lack of premating isolation at the base of a phylogenetic tree.

    Science.gov (United States)

    Grant, B Rosemary; Grant, Peter R

    2002-07-01

    Darwin's finches in the Galápagos archipelago are an unusual example of adaptive radiation in that the basal split separates two lineages of warbler finches (Certhidea olivacea and Certhidea fusca) believed until recently to be only one species. The large genetic difference between them contrasts with their similarity in plumage, size, shape, and courtship behavior. They differ in song, which is a key factor in premating isolation of other sympatric Darwin's finches. We conducted playback experiments to see whether members of the population of C. olivacea on Santa Cruz Island would respond to songs of C. fusca from two islands, Genovesa and Pinta, and songs of C. olivacea from another island (Isabela). Another set of experiments was performed, using the same playback tapes, with C. fusca on Genovesa. Some members of both populations responded to all playbacks; therefore, the hypothesis of complete premating isolation on the basis of song is rejected. Discrimination between songs of the two lineages was inconsistent. We conclude that premating barriers to interbreeding among the tested populations have not arisen in the 1.5-2.0 m.yr. of their geographical isolation on different islands. This contrasts with strong premating barriers between more recently derived sympatric species. Early learning of song associated with morphology is later used in mate recognition. This explains why sympatric species that are vocally and morphologically distinct yet genetically less differentiated than Certhidea do not interbreed, whereas the Certhidea lineages that are genetically well differentiated but vocally and morphologically similar have no apparent premating barrier. We discuss this unusual situation in terms of the forces that have produced similarities and differences in song, morphology, and ecology and their relevance to phylogenetic and biological species concepts. Neither principles nor details are unique to Darwin's finches, and we conclude by pointing out strong

  11. Moléstias em tomateiro cultivado em estufas plásticas em quatro municípios da região central do Rio Grande do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Blume Elena

    2004-01-01

    Full Text Available Moléstias podem atacar severamente hortaliças cultivadas em cultivos protegidos e, para o manejo integrado dessas moléstias, o conhecimento das condições climáticas que favorecem sua incidência nesses cultivos é fundamental. O trabalho teve o objetivo de identificar as moléstias em tomateiro cultivado em estufas plásticas em quatro municípios na região central do Rio Grande do Sul e as condições de temperatura e umidade relativa (UR do ar nas quais elas ocorrem. O estudo foi realizado nos municípios de São Pedro do Sul, São Sepé, Ivorá e Santa Maria (RS, no período de março a outubro de 1998. A temperatura e umidade relativa do ar foram medidas diariamente com um psicrômetro. As moléstias observadas e sua incidência máxima foram: requeima (Phytophthora infestans: 100,0%, pinta-preta (Alternaria solani: 98,1%, mofo cinzento (Botrytis cinerea: 55,4%, cladosporiose (Cladosporuim fulvum: 48,9%, septoriose (Septoria lycopersici: 37,5%, talo-oco (Erwinia spp.: 33,0%, murcha de fusarium (Fusarium oxysporum f. sp. lycopersici: 8,4% e podridão de esclerotínia (Sclerotinia sclerotiorum: 1,3%. Valores de UR superiores a 80%, de maneira geral, aumentaram a incidência das moléstias, em sua maioria de origem fúngica. A incidência de moléstias varia entre municípios de uma mesma região climática de acordo com os fatores meteorológicos e práticas de manejo da cultura.

  12. A Retrospective Study on Genetic Heterogeneity within Treponema Strains: Subpopulations Are Genetically Distinct in a Limited Number of Positions.

    Directory of Open Access Journals (Sweden)

    Darina Čejková

    Full Text Available Pathogenic uncultivable treponemes comprise human and animal pathogens including agents of syphilis, yaws, bejel, pinta, and venereal spirochetosis in rabbits and hares. A set of 10 treponemal genome sequences including those of 4 Treponema pallidum ssp. pallidum (TPA strains (Nichols, DAL-1, Mexico A, SS14, 4 T. p. ssp. pertenue (TPE strains (CDC-2, Gauthier, Samoa D, Fribourg-Blanc, 1 T. p. ssp. endemicum (TEN strain (Bosnia A and one strain (Cuniculi A of Treponema paraluisleporidarum ecovar Cuniculus (TPLC were examined with respect to the presence of nucleotide intrastrain heterogeneous sites.The number of identified intrastrain heterogeneous sites in individual genomes ranged between 0 and 7. Altogether, 23 intrastrain heterogeneous sites (in 17 genes were found in 5 out of 10 investigated treponemal genomes including TPA strains Nichols (n = 5, DAL-1 (n = 4, and SS14 (n = 7, TPE strain Samoa D (n = 1, and TEN strain Bosnia A (n = 5. Although only one heterogeneous site was identified among 4 tested TPE strains, 16 such sites were identified among 4 TPA strains. Heterogeneous sites were mostly strain-specific and were identified in four tpr genes (tprC, GI, I, K, in genes involved in bacterial motility and chemotaxis (fliI, cheC-fliY, in genes involved in cell structure (murC, translation (prfA, general and DNA metabolism (putative SAM dependent methyltransferase, topA, and in seven hypothetical genes.Heterogeneous sites likely represent both the selection of adaptive changes during infection of the host as well as an ongoing diversifying evolutionary process.

  13. Anatomía comparada del sistema digestivo de las rayas Urotrygon chilensis y Dasyatis sabina (Myliobatiformes Comparative anatomy of the digestive system of the skates, Urotrygon chilensis and Dasyatis sabina (Myliobatiformes

    Directory of Open Access Journals (Sweden)

    ABRAHAM KOBELKOWSKY

    2010-01-01

    Full Text Available La organización general del sistema digestivo de la raya pinta Urotrygon chilensis y la raya de espina Dasyatis sabina corresponde al patrón morfológico general de los Myliobatiformes. La dentición de estas especies muestra un dimorfismo sexual, consistente en dientes planos en las hembras y dientes puntiagudos en los machos. Entre los músculos mandibulares, el adductor mandibulae es el más complejo. Las cavidades bucofaríngea y visceral son aplanadas dorsoventralmente. El esófago es relativamente largo, el estómago tiene forma de U, el intestino está regionalizado en duodeno, intestino valvular y recto. El mesenterio dorsal está restringido al recto y la glándula rectal. Los caracteres morfológicos más notables que diferencian el sistema digestivo de las dos especies son: la presencia de esfínter cardiaco y la forma en S del recto en U. chilensis, la presencia de escotaduras en las mandíbulas y el mayor número de vueltas de la válvula espiral en D. sabina.The general organization of the digestive system of the rays Urotrygon chilensis and Dasyatis sabina fits with the general morphological pattern of the Myliobatiformes. Dentition of both species shows sexual dimorphism, having the females flattened teeth whereas pointed teeth the males. Among the mandibular muscles, the adductor mandibulae is the most complex. Both the buccopharyngeal and the visceral cavities are dorsoventrally flattened. The esophagus is long, the stomach is U shaped, and the intestine is formed by the duodene, valvular intestine and rectum. The dorsal mesentery is restricted to the rectum and rectal gland. The main morphological characters differentiating both species are: the presence in U. chilensis of the cardiac sphincter and the S shape of the rectum, and the presence in D. sabina of mandibular notches and a higher number of coils of the valvular fold of the intestine.

  14. L'œuvre d'art en tant que témoignage: les artistes confrontés à la guerre La obra de arte como testimonio: los artistas frente a la guerra Art work as a testimony: artists facing the war

    Directory of Open Access Journals (Sweden)

    Dolores Fernández Martínez

    2009-01-01

    Full Text Available Este artículo surge como respuesta a la pregunta de si el arte puede ser considerado fuente testimonial como lo son los documentos escritos que habitualmente tienen en cuenta los historiadores para sus estudios. Pero este tema en arte es complejo. Tenemos el ejemplo universal de Goya, dando testimonio de lo que vio durante la guerra de la independencia, y tenemos distintos dibujos realizados por judíos en los campos de exterminio nazis o de artistas españoles republicanos en los campos de concentración franceses. Pero también está el ejemplo de Picasso cuando pinta « Guernica ». ¿Hasta qué punto este ejemplo, que responde a los anhelos de un pueblo, puede considerarse testimonio? Es indudable que el tema es interesante tratarlo en estos momentos en que asistimos a un gran debate en torno a la memoria histórica, tanto en España como en otros países europeos, y surgen artistas jóvenes que tratan la guerra civil española o el franquismo sin haberlo vividoThis article springs off as an answer to the question of whether we can consider art, as a testimonial source like the written documents that historians use to manage for their studies? But this issue, related to art, is rather complex. We have the universal example of Goya, giving testimony of what he saw during independence war, and we have several drawings made by jews at the Nazis extermination camps or those of republican Spanish artists at the French concentration camps. But there is also the example of Picasso painting « Guernica ». To what extent this example, that portraits the yearnings of people, can be considered testimonial? Undoubtedly this is an interesting subject nowadays, with the ongoing debate about historical memory that is tacking place in Spain and in some other European countries, and the new young artists that make the Spanish civil war or Franco’s regime their subject without having lived them

  15. Lourenço de Salzedo en Roma. Influencias del Manierismo romano en la obra del pintor de la reina Catarina de Portugal

    Directory of Open Access Journals (Sweden)

    Serrao, Vitor

    2003-09-01

    Full Text Available Only in recent years have the works of Lourenço de Salzedo, a quite interesting painter from Seville who worked at the Portuguese court for queen Catherine of Austria (widow of king Joao III, from approximately 1564 to 1577 (year of his death, begun to be regarded in a new light. The recently restored panels that he painted between 1570 and 1572 for the main altarpiece of the Jeronymite Monastery of Lisbon display a profound knowledge of Italian culture, possible only for one who had studied in Rome. In effect, Salzedo was in the city of the Popes toward the middle of the sixteenth century - as were Gaspar Becerra, Pedro Roviale or the Portuguese artist Antonio Campelo - assimilating echos of Roman Bella Maniera painting in the works of the followers of Michelangelo - Girolamo Siciolante da Sermoneta, Daniele da Volterra, Francesco Salviati and Pellegrino Tibaldi.

    Sólo en fecha reciente la Historia del Arte evaluó desde otro punto de vista la obra de Lourenço de Salzedo, un pintor bastante interesante de origen sevillano que pasó a la corte portuguesa, donde, desde 1564, por lo menos, hasta 1577, fecha de su muerte, será pintor de la Reina Catarina de Austria, viuda de D. Joao III. Las recién restauradas tablas que pinta entre 1570-1572 para el retablo mayor del Monasterio de los Jerónimos en Lisboa, después de frustradas diligencias junto a Felipe II para que otros viniesen a pintarlas (Gaspar Becerra, Franz Floris y Francisco de Urbina fueron algunos de los nombres propuestos muestran una profunda cultura italianizante sólo posible de adquirir con una práctica artística en Roma. Testimoniamos que, de hecho, Salzedo pasó por la ciudad papal en los años centrales del siglo XVI —tal como Gaspar Becerra, Pedro Roviale o el portugués Antonio Campelo—, asimilando ahí los ecos de la Bella Maniera romana junto a las obras miguelangelescas tanto de Girolamo Siciolante da Sermoneta como de Daniele da Volterra, Francesco

  16. Apariencia y realidad en Hamlet y Las Meninas

    Directory of Open Access Journals (Sweden)

    Antonio PRIETO MARTÍNEZ

    2009-11-01

    Full Text Available La obra de Shakespeare comenzó a ser estudiada en profundidad a finales del siglo XVII y, sobre todo, en el siglo XVIII. Desde ese siglo hasta el momento actual la investigación en torno a la obra shakesperiana se ha desarrollado hasta tal punto que resulta inabordable. De entre la obra de Shakespeare, Hamlet es probablemente la que suscita mayor interés a causa de su compleja estructura y su contenido ambiguo. Del mismo modo, la obra de Velázquez comenzó a estudiarse con rigor en el siglo XVIII, aunque hasta el siglo XX no se investigan sus características e influencias. Como en el caso de Shakespeare, la bibliografía existente en la actualidad sobre su obra resulta inaccesible para el investigador. De entre todas sus pinturas, Las Meninas, del mismo modo que Hamlet, es la que despierta mayor interés y tiene una proyección universal. Haciendo un recorrido por las investigaciones más importantes realizadas sobre ambas obras en los tres últimos siglos, intento encontrar semejanzas entre ellas, basándome fundamentalmente en su estructura. Apoyando mi investigación en la teoría deconstructivista, según la propuesta de J. Derrida, y siguiendo el esquema formal de ambas obras, propongo el tema general de apariencia y realidad como núcleo de sus semejanzas. Los puntos de analogía entre Hamlet y Las Meninas son, en síntesis, los siguientes: - Texto (expresado en el ser o no ser y el reverso del lienzo sobre el que pinta Velázquez. - El personaje del espectro en Hamlet y el personaje invisible en el cuadro (María Teresa de Austria o el espectador. - Velázquez significante representado en el cuadro y la obra dentro de la obra que representan los cómicos. - El personaje de Claudio, como símbolo del tirano y los reyes representados en el espejo. - Finalmente considero la vigencia y proyección que tienen ambas obras en el mundo actual.

  17. The African hind's (Cephalopholis taeniops, serranidae use of artificial reefs off sal island (Cape Verde: a preliminary study based on acoustic telemetry

    Directory of Open Access Journals (Sweden)

    Pedro G. Lino

    2011-01-01

    Full Text Available The African hind Cephalopholis taeniops (Valenciennes, 1828 is one of the most important commercial demersal species caught in the Cape Verde archipelago. The species is closely associated with hard substrate and is one of the main attractions for SCUBA divers. In January 2006 a former Soviet fishing vessel - the Kwarcit - was sunk off Santa Maria Bay (Sal Island. Young C. taeniops are commonly observed in this artificial reef (AR. In order to investigate the species' use of the AR, 4 specimens were captured and surgically implanted underwater with Vemco brand acoustic transmitters. The fish were monitored daily with an active telemetry receiver for one week after release. Simultaneously, an array of 3 passive VR2 / VR2W receivers was set for 63 days, registering data that allowed an analysis of spatial, daily and short term temporal activity patterns. The results showed site fidelity to the AR, with no migrations to the nearby natural reef. The method used allowed to register a consistent higher activity during daytime and a preference for the area opposite the dominant current.A garoupa-de-pintas Cephalopholis taeniops (Valenciennes, 1828 é uma das espécies demersais comerciais mais importantes no Arquipélago de Cabo Verde. Esta espécie está fortemente associada ao substrato rígido e constitui uma das principais atracções para os mergulhadores. Em Janeiro de 2006 um antigo navio de pesca soviético - Kwarcit - foi afundado ao largo da Baía de Santa Maria (Ilha do Sal. É comum observar juvenis de C. taeniops neste recife artificial (AR. Para investigar a utilização dos AR por esta espécie, foram capturados 4 exemplares nos quais foi implantado um transmissor acústico da marca Vemco, através de cirurgia realizada debaixo de água. Os peixes foram monitorizados através de um receptor de telemetria activo na semana após libertação. Simultaneamente foi instalada uma rede de 3 receptores passivos tipo VR2 / VR2W que registou dados

  18. The Oxidation State of Fe in Glasses from the Galapagos Archipelago: Variable Oxygen Fugacity as a Function of Mantle Source

    Science.gov (United States)

    Peterson, M. E.; Kelley, K. A.; Cottrell, E.; Saal, A. E.; Kurz, M. D.

    2015-12-01

    The oxidation state of the mantle plays an intrinsic role in the magmatic evolution of the Earth. Here we present new μ-XANES measurements of Fe3+/ΣFe ratios (a proxy for ƒO2) in a suite of submarine glasses from the Galapagos Archipelago. Using previously presented major, trace, and volatile elements and isotopic data for 4 groups of glass that come from distinct mantle sources (depleted upper mantle, 2 recycled, and a primitive mantle source) we show that Fe3+/ΣFe ratios vary both with the influence of shallow level processes and with variations in mantle source. Fe3+/ΣFe ratios increase with differentiation (i.e. decreasing MgO), but show a large variation at a given MgO. Progressive degassing of sulfur accompanies decreasing Fe3+/ΣFe ratios, while assimilation of hydrothermally altered crust (as indicated by increasing Sr/Sr*) is shown to increase Fe3+/ΣFe ratios. After taking these processes into account, there is still variability in the Fe3+/ΣFe ratios of the isotopically distinct sample suites studied, yielding a magmatic ƒO2 that ranges from ΔQFM = +0.16 to +0.74 (error < 0.5 log units) and showing that oxidation state varies as a function of mantle source composition in the Galapagos hotspot system. After correcting back to a common MgO content = 8.0 wt%, the trace element depleted group similar to MORB (ITD), and the group similar to Pinta (WD = high Th/La, Δ7/4, Δ8/4 ratios) show Fe3+/ΣFe ratios within the range of MORB (average ITD = 0.162 ± 0.003 and WD = 0.164 ± 0.006). Another trace element enriched group similar to Sierra Negra and Cerro Azul (ITE = enriched Sr and Pb isotopes) shows evidence of mixing between oxidized and reduced sources (ITE oxidized end-member = 0.177). This suggests that mantle sources in the Galapagos that are thought to contain recycled components (i.e., WD and ITE groups) have distinct oxidation states. The high 3He/4He Fernandina samples (HHe group) are shown to be the most oxidized (ave. 0.175 ± 0

  19. Picasso. L’ombre du récit portée sur le tableau (L’Ombre sur la femme et L’Ombre, 1953

    Directory of Open Access Journals (Sweden)

    Jacques Terrasa

    2009-05-01

    Full Text Available En 1927-29, puis de nouveau en 1953, Pablo Picasso représente l’ombre portée du peintre sur la toile. C’est d’abord le profil de son visage, inspiré d’un autoportrait photographique de 1927, qui semble esquiver, dans une dizaine de tableaux, les monstrueuses mâchoires qui caractérisent les visages féminins qu’il peint à cette époque. Vingt-cinq ans plus tard, l’ombre d’un corps que l’on imagine debout devant la scène, interfère avec un nu couché, dans un micro-récit pictural seulement composé de deux toiles, datées du 29 décembre. Mais si l’ombre semble bien impliquer un corps présent dans le contre-champ de l’image, celui de la femme n’est devenu, en cette fin de 1953, que la représentation d’une absence, une enveloppe vide que la peinture n’arrive plus à combler.En 1927-29, y luego en 1953, Pablo Picasso representa la sombra del pintor proyectada sobre el lienzo. Será primero el perfil de su rostro, inspirado en un autorretrato fotográfico de 1927, que parece esquivar, en una decena de cuadros, las monstruosas mandíbulas que caracterizan los rostros femeninos que pinta en este período. Veinticinco años después, la sombra de un cuerpo que uno imagina de pie delante de la escena, interfiere con un desnudo tendido, en un micro relato pictórico compuesto sólo de dos telas, fechadas del 29 de diciembre. Pero si la sombra bien parece implicar a un cuerpo presente en el contracampo de la imagen, el de la mujer se ha convertido, en ese final de 1953, en la representación de una ausencia, una envoltura vacía que la pintura ya no puede colmar.

  20. Potencialidade de um actinomiceto de rizosfera de tomateiro como agente de biocontrole de doenças Potenciality of an actinomycete from tomato rhizosphere as a biocontrol agent for tomato diseases

    Directory of Open Access Journals (Sweden)

    Renato Carrer Filho

    2009-09-01

    Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested

  1. Caraterización citogenética del pez tropical de agua dulce Parachromis managuensis (Pisces:Cichlidae

    Directory of Open Access Journals (Sweden)

    Lenin Arias-Rodriguez

    2006-03-01

    Full Text Available Para contribuir con el ordenamiento de las especies de la familia Cichlidae, se realizó el estudio citogenético de la mojarra pinta Parachromis managuensis. Fueron utilizados veintiún organismos, ocho machos y trece hembras,colectados en Villahermosa, Tabasco, México. Los especímenes se procesaron por técnicas citogenéticas convencionales (con ligeras modificaciones. Se obtuvieron campos mitóticos y meióticos de buena calidad, de los que fueron seleccionados catorce cariotipos para ser analizados merística y estadísticamente. Los especímenes presentaron número modal diploide de 2n=48 cromosomas, similar al reportado para otros cíclidos neotropicales. Cinco pares fueron cromosomas metacéntricos-submetacéntricos (birrámeos y 19 pares cromosomas subtelocéntricos-telocéntricos (monorrámeos,con número fundamental (NF de 58 brazos.El número haploide se ratificó por conteo de campos meióticos en metafase I. Los campos mitóticos observados y los cariotipos de machos y hembras no presentaron evidencias heteromórficas para identificar cromosomas sexuales.Citogenetic characterization of the tropical freshwater fish Parachromis managuensis (Pisces: Cichlidae. To describe the cytogenetics of the jaguar cichlid fish Parachromis managuensis, we collected eight males and 13 females in Villahermosa, Tabasco, México. The specimens were processed with standard cytogenetic techniques (slightly modified, and high quality fields of chromosomes in mitosis and meiosis were obtained; 14 of these fields were analyzed by meristics and statistics methods. The specimens presented a diploid modal number of 2n=48 chromosomes, which is similar to the number reported for others Central American cichlids; five pairs were submetacentric-metacentrics(biarmedand 19 were subtelocentric-telocentric (uni-armed,giving a fundamental number (NFof 58.The haploid number was confirmed by counting meiotic fields in metaphase I. There was not evidence of

  2. Qualidade de caqui 'Rama forte' após armazenamento refrigerado, influenciada pelos tratamentos 1-MCP e/ou CO2

    Directory of Open Access Journals (Sweden)

    João Peterson Pereira Gardin

    2012-12-01

    Full Text Available Avaliaram-se os efeitos dos tratamentos com CO2 e 1-MCP (1-metilciclopropeno sobre a adstringência (índice de tanino, firmeza da polpa e distúrbios da epiderme em caqui 'Rama Forte'. Frutos foram tratados com 1-MCP por 24 h, logo após a colheita e/ou com alto CO2 (70% por 24 ou 48 h, um dia após a colheita ou após o armazenamento refrigerado (AR. Os caquis foram armazenados sob atmosfera modificada a 0 ºC, por 45 dias, e a seguir mantidos a 23 ºC, por 9 dias. Frutos-controle (não tratados com 1-MCP nem com CO2 amoleceram em três dias e perderam aproximadamente 50% da adstringência em 6 dias após o AR. A exposição ao CO2 acelerou a redução da adstringência. Esse efeito do CO2 foi menor em frutos tratados com 1-MCP, especialmente quando o CO2 foi aplicado após o AR, por apenas 24 h. O tratamento com 1-MCP inibiu o amolecimento e a redução da adstringência, especialmente nos frutos não tratados com CO2. O amolecimento de frutos tratados com 1-MCP foi maior quando a exposição ao CO2 ocorreu antes do AR. A combinação dos tratamentos com 1-MCP e alto CO2 reduziu a incidência de podridões e manchas translúcidas, mas não alterou o desenvolvimento de pintas pretas ('estrias'. Os resultados indicam que é possível induzir perda da adstringência sem excessiva perda da firmeza da polpa de caquis 'Rama Forte' após o AR pela associação dos tratamentos com 1-MCP logo após a colheita e alto CO2 após o AR.

  3. Cultivares de batata para sistemas orgânicos de produção Potato cultivars for organic production systems

    Directory of Open Access Journals (Sweden)

    Fabrício Rossi

    2011-09-01

    Full Text Available Informações a respeito de cultivares adaptadas ao sistema de cultivo orgânico são escassas. O objetivo deste estudo foi avaliar, sob sistema de cultivo orgânico, genótipos nacionais e estrangeiros desenvolvidos para o cultivo convencional, quanto ao potencial produtivo, em condições de campo. O experimento foi conduzido em 2008, no Pólo APTA Leste Paulista, em Monte Alegre do Sul-SP. O delineamento experimental foi em blocos ao acaso, com 18 tratamentos e quatro repetições. Cada parcela foi constituída por 80 batatas-semente, dispostas em quatro linhas de 5 m de comprimento, espaçadas de 80 cm, com 25 cm entre tubérculos. Os genótipos avaliados foram Agata, Asterix, Caesar, Cupido, Éden, Melody, Novella e Vivaldi, de origem estrangeira; e Apuã, Aracy, Catucha, IAC Aracy Ruiva, Itararé, Monte Alegre 172, IAC 6090, APTA 16.5, APTA 15.20 e APTA 21.54, nacionais. Foram avaliadas as características de produtividade total e comercial de tubérculos, massa média total e comercial de tubérculos, teor de matéria seca e severidade da pinta-preta (Alternaria solani. Os clones APTA 16.5, APTA 21.54 e IAC 6090, e as cultivares Cupido, Apuã, Itararé e Monte Alegre 172 foram os mais produtivos. 'APTA 21.54' superou os demais em relação a produtividade comercial (18,07 t ha-1, sendo que 'APTA 16.5', 'Cupido', 'IAC 6090' e 'Itararé' formaram o segundo grupo. As maiores massas médias de tubérculos foram apresentadas pelas cultivares Itararé e Cupido. O clone IAC 6090 e as cultivares Aracy e Aracy Ruiva foram as que apresentaram maiores teores de matéria seca, com valor médio de 22,91%. 'APTA 16.5', 'Apuã', 'Aracy', 'Aracy Ruiva', 'Éden', 'Ibituaçú' e 'Monte Alegre 172' apresentaram alto nível de resistência à pinta-preta. As cultivares Itararé, Apuã e Cupido são adaptadas ao cultivo orgânico, e os clones avançados APTA 16.5, APTA 21.54 e IAC 6090 apresentam potencial de cultivo no sistema orgânico.Information regarding

  4. Picos de Europa National and Regional parks (Northern Spain): the karst underground landscape

    Science.gov (United States)

    Ballesteros, Daniel; Jiménez-Sánchez, Montserrat; Rodríguez-Rodríguez, Laura; José Domínguez-Cuesta, María; Meléndez-Asensio, Mónica; García-Sansegundo, Joaquín

    2015-04-01

    Karst caves represent an environmental with a high value from the Geoheritage and Geodiversity points of view given by hidden underground landscape practically reserved to the speleologists. Nevertheless, cave surveys, 3d models of caves and DEMs, and pictures can be used to approach the endokarst geoheritage characterization. The Picos de Europa National and Regional parks include the 14% of World's Deepest Caves (>1 km depth); moreover these parks shows a high environmental value related with seven protection figures: Biosphere Reserve, Special Protection Area, the Site of Community Importance, and four Natural Monument. The aim of this work is to present the Geoheritage values of the underground landscape of the Picos de Europa National and Regional parks. These parks involve several alpine karst massifs up to 700 km2 and 2,600 m asl, as the Picos de Europa mountains (declared Global Geosite by its geomorphological interest), the Mampodre Massif, and the Peñas Pintas and Yordas peaks (sited in Riaño dam area). The alpine karst involves a large underground landscape formed by more than 3,700 epigenic caves with 403 km of conduits. The 95 % of the cave conduits are located in the Picos de Europa mountains and correspond to caves up to 18.9 km length and 1.6 km depth; the 5 % of cave conduits are sited in other small karst areas and include caves up to 1.5 km length and 200 m depth. The karst caves present high natural, scientific and cultural values. The natural value corresponds to the singularity and the spectacular vertical development of the caves and a very high Geodiversity of cave features. The karst shows a high concentration of deep caves (81 caves deeper than 500 m) that is twice higher than the concentration of other karst areas, as Arabika Massif (Western Caucasus). The natural value is mainly related to the presence of geomorphological and hydrogeological features, highlighting high vadose canyons and shafts, old phreatic and epiphreatic conduits

  5. Ocorrência de doenças do tomateiro na região de Guanambi, BA

    Directory of Open Access Journals (Sweden)

    M. A. S. Guimarães

    2015-12-01

    Full Text Available As doenças do tomateiro são responsáveis por grandes prejuízos econômicos e a falta de conhecimento técnico no diagnóstico e controle dessas doenças onera os custos e limitam a sua produção. Esse trabalho tem como objetivo realizar um levantamento para identificação e registro de ocorrência de doenças do tomateiro na região de Guanambi, BA. O levantamento foi realizado nos Distritos de Morrinhos e Guirapá e nos Povoados de Brejos dos Padres e do Tanque. Para tanto, foram realizadas visitas nas áreas produtoras de tomate e para avaliação do histórico da área foi aplicado um questionário aos produtores. Amostras de plantas infectadas foram coletadas e levadas para análise no Laboratório de Fitopatologia do IFBaiano - Campus Guanambi ou enviadas para diagnóstico em Clinica Fitopatológica. Foram diagnosticadas nove doenças bióticas: vira cabeça do tomateiro (Tomato spotted wilt virus, oídio (Oidium sp., murcha de fusário (Fusarium oxysporum, requeima (Phytophthora infestans, mofo preto (Alternaria alternata, mancha de estenfílio (Stemphylium sp., mancha de cladospório (Fulvia fulva, pinta-preta (Alternaria solani e murcha bacteriana (Ralstonia solanacearum; e três doenças abióticas (podridão apical, deficiência de fósforo e murcha por asfixia nos cultivos de tomate. Dentre as doenças bióticas encontradas, o vira cabeça do tomateiro e o oídio foram as mais frequentes. Occurrence of diseases in tomato in the region of Guanambi, BahiaAbstract: The tomato diseases are responsible for great economic losses and the lack of technical knowledge in the diagnosis and control of these diseases onerous costs and limit their production. This work aims to conduct a survey to identify and record of the tomato diseases occurrence in the Guanambi region, Bahia state. The survey was conducted in Morrinhos, Guirapá, Brejo dos Padres and Tanque Districts. Therefore, visits were made in tomato producing areas and for the

  6. Qualidade de caqui 'Rama forte' após armazenamento refrigerado, influenciada pelos tratamentos 1-MCP e/ou CO2 Quality of 'Rama Forte' perssimon following cold torage influenced by 1-MCP and/or CO2treatments

    Directory of Open Access Journals (Sweden)

    João Peterson Pereira Gardin

    2012-12-01

    Full Text Available Avaliaram-se os efeitos dos tratamentos com CO2 e 1-MCP (1-metilciclopropeno sobre a adstringência (índice de tanino, firmeza da polpa e distúrbios da epiderme em caqui 'Rama Forte'. Frutos foram tratados com 1-MCP por 24 h, logo após a colheita e/ou com alto CO2 (70% por 24 ou 48 h, um dia após a colheita ou após o armazenamento refrigerado (AR. Os caquis foram armazenados sob atmosfera modificada a 0 ºC, por 45 dias, e a seguir mantidos a 23 ºC, por 9 dias. Frutos-controle (não tratados com 1-MCP nem com CO2 amoleceram em três dias e perderam aproximadamente 50% da adstringência em 6 dias após o AR. A exposição ao CO2 acelerou a redução da adstringência. Esse efeito do CO2 foi menor em frutos tratados com 1-MCP, especialmente quando o CO2 foi aplicado após o AR, por apenas 24 h. O tratamento com 1-MCP inibiu o amolecimento e a redução da adstringência, especialmente nos frutos não tratados com CO2. O amolecimento de frutos tratados com 1-MCP foi maior quando a exposição ao CO2 ocorreu antes do AR. A combinação dos tratamentos com 1-MCP e alto CO2 reduziu a incidência de podridões e manchas translúcidas, mas não alterou o desenvolvimento de pintas pretas ('estrias'. Os resultados indicam que é possível induzir perda da adstringência sem excessiva perda da firmeza da polpa de caquis 'Rama Forte' após o AR pela associação dos tratamentos com 1-MCP logo após a colheita e alto CO2 após o AR.This study evaluated the effects of CO2 and 1-MCP (1-methylcyclopropene treatments on astringency (tannin index, flesh firmness and skin disorders on 'Rama Forte' persimmon. Fruit were treated with 1-MCP for 24 h right after harvest and/or with high CO2 (70% CO2 balanced with air for 24 or 48 h, one day after harvest or after cold storage (CS. Fruit were stored in modified atmosphere for 45 days at 0ºC and then held at 23ºC for 9 days. Control fruit (untreated with neither 1-MCP nor CO2 softened in 3 days and lost about 50

  7. Marketing de banana: preferências do consumidor quanto aos atributos de qualidade dos frutos Marketing of banana: consumer preferences relating to fruit quality attributes

    Directory of Open Access Journals (Sweden)

    Fernando César Akira Urbano Matsuura

    2004-04-01

    Full Text Available O Brasil produz aproximadamente seis milhões de toneladas por ano de banana (Musa spp., com consumo médio da ordem de 35 kg/ habitante / ano. A aceitação da banana deve-se, principalmente, a seus aspectos sensoriais, valor nutricional e conveniência. A identificação das necessidades e desejos dos clientes consiste em uma atividade crítica do marketing. O objetivo deste trabalho foi o de pesquisar as preferências do consumidor de um mercado local (município de Cruz das Almas - Estado da Bahia considerando os atributos de qualidade dos frutos frescos de banana madura. A metodologia utilizada foi a da pesquisa descritiva por método estatístico. Os dados foram coletados por questionário, na forma de entrevista pessoal com 400 pessoas. Os atributos de qualidade (variáveis questionados e avaliados foram relacionados com a aparência, cor, textura, aroma, sabor e vida útil esperada dos frutos de banana. De acordo com a preferência dos consumidores entrevistados, o fruto de banana maduro ideal deve apresentar características como: penca contendo 10 a 12 dedos (frutos, dedos de tamanho médio ou grande, diâmetro médio, quina presente, ausência de pintas pretas na casca, cor da polpa amarelo-clara ou média, textura firme, aroma e sabor de intensidade média, mediamente doce e vida útil de 7 a 10 dias em condição ambiente. O sabor, vida útil e aparência dos frutos de banana são considerados os mais importantes atributos na escolha ou compra da banana, segundo os consumidores entrevistados.Brazil has an approximate production of six million annual tons of banana (Musa spp., with a consumption close to 35 kg / inhabitant / year. The acceptance of the banana fruit is due, mainly, to its sensorial aspects, nutritional value and convenience. The identification of the customers' needs and desires consists of a critical activity of the marketing. The objective of this work was to research the consumer preferences of a local market (Cruz

  8. Pinto Coloso, nueva variedad de frijol para el estado de Durango Pinto Coloso, a new dry bean variety for the State of Durango

    Directory of Open Access Journals (Sweden)

    Rigoberto Rosales Serna

    2010-12-01

    Full Text Available En Durango los productores agrícolas demandan variedades de frijol pinto con grano tolerante al oscurecimiento acelerado de la testa y tamaño mayor en relación con Pinto Saltillo, la cual es la variedad más popular actualmente. El objetivo fue generar variedades superiores a Pinto Saltillo en calidad comercial, tolerancia similar al oscurecimiento de la testa y mayor tamaño de grano. En el INIFAP-Durango se generó la variedad Pinto Coloso (PT08036, con el método genealógico, a partir de la cruza entre Pinto Mestizo y Pinto Saltillo [(Pinto Mestizo/Pinto Saltillo-69-2-2]. Esta variedad mostró rendimiento promedio de 1 715 kg ha-1 y fluctuaciones entre 923 kg ha-1 hasta 2 645 kg ha-1. En promedio Pinto Coloso, comparado con Pinto Saltillo, presentó mayor precocidad a floración (40 vs 45 días, madurez (81 vs 88 días y tamaño del grano (39 vs 30. El crecimiento de Pinto Coloso es de enredadera indeterminada, con guías cortas no trepadoras, la altura del dosel oscila entre 34 y 38 cm y la guía crece 75 cm. Pinto Coloso tiene granos de 48 g por 100 semillas y un intervalo de peso entre 30 y 48 g por cada 100 semillas. El grano es transversalmente elíptico, de forma externa elíptica-romboidal, color crema de la testa, pintas de color café y el hilio es amarillo-naranja. Pinto Coloso mostró tolerancia a la antracnosis y roya; así como valores medios y altos de susceptibilidad a tizón común y pudriciones de raíz. Esta variedad está en proceso de validación en terrenos de productores para establecer su adaptabilidad y potencial para incrementar la calidad del frijol pinto producido en México.In Durango, farmers demand pinto bean cultivars with slow darkening grains and larger seed size compared to Pinto Saltillo, which is currently the most popular variety. The aim was to generate commercially superior varieties showing slow darkening coat, earlier maturity and larger seed size in comparison to Pinto Saltillo. Pinto Coloso (PT

  9. Progresso de doenças fúngicas e correlação com variáveis climáticas em mamoeiro Progress of fungal diseases and correlation with climatic variables in papaya

    Directory of Open Access Journals (Sweden)

    Márcio Shiguero Suzuki

    2007-06-01

    Full Text Available Avaliou-se o progresso de doenças fúngicas do mamoeiro e os efeitos dos fatores climáticos em três áreas experimentais: 1- área de produção de mamão conduzida no sistema convencional, que recebeu irrigação por gotejamento; 2- área de produção de mamão conduzida no sistema convencional, que recebeu irrigação por aspersão; 3- área de produção de mamão cultivada no sistema orgânico, com irrigação por microaspersão. Na área 1 foram avaliados três sistemas diferentes de condução: 1 sem a aplicação de fungicidas e sem sanitização das plantas (testemunha sem sanitização; 2 sem a aplicação de fungicidas e com sanitização das plantas (testemunha com sanitização; e 3 com a aplicação de fungicidas para o controle de doenças foliares e sem sanitização (padrão do produtor. Em cada sistema de condução foram demarcadas quatro parcelas (repetições com 20 plantas, sendo 10 plantas consideradas úteis. Foram avaliadas a incidência e a severidade da mancha-de-ascoquita, pinta-preta e do oídio como doenças foliares. Nos frutos, após a colheita foram avaliadas as incidências da antracnose, mancha-chocolate e podridão-peduncular. As epidemias da mancha-de-ascoquita ocorrem em temperaturas variando de 15 ºC a 20 ºC; para a pinta-preta as condições favoráveis ao desenvolvimento de epidemias foi temperatura variando de 25 ºC a 30 ºC e umidade relativa variando de 80 % a 100 %, sendo o pico da intensidade da doença ocorre entre os meses de novembro a março. Para o oídio, a faixa de temperatura que favoreceu a doença foi 15 ºC a 20 ºC e umidade relativa de 60 a 70 %. Em relação às podridões que incidiram nos frutos, observou-se que não houve relação entre a incidência da podridão-peduncular e a precipitação pluvial acumulada, 15 dias antes da avaliação ou no período de desenvolvimento do fruto (r The effect of climatic conditions on progress of fungal diseases of papaya were evaluated in

  10. Characterization of Sugars and Organic Acids in Commercial Varieties of Table Grapes Caracterización de Azúcares y Ácidos Orgánicos en Variedades Comerciales de Uva de Mesa

    Directory of Open Access Journals (Sweden)

    Pablo Muñoz-Robredo

    2011-09-01

    los atributos primordiales para su consumo fresco. Sin embargo, la mayor��a de los estudios realizados al respecto se han desarrollado en uva para la producción de vino, la cual crece, se cultiva y se procesa de manera diferente a la uva de mesa. Por lo tanto, el objetivo del presente trabajo se centró en caracterizar los cambios en azúcares y ácidos orgánicos a lo largo de su desarrollo en las variedades ‘Thompson Seedless’, ‘Red Globe’, y ‘Crimson Seedless’, producidas bajo las mismas condiciones agroclimáticas. Para cada variedad se realizaron muestreos semanales desde 2 semanas previas a pinta hasta la cosecha comercial. Los azúcares y ácidos orgánicos fueron cuantificados mediante cromatografía líquida de alto rendimiento (HPLC equipados con detectores evaporativos de dispersión de la luz (ELSD y ultra violeta, respectivamente. El rango de concentraciones de ácidos y azúcares encontrados en uva fueron los siguientes: ácido tartárico, 1,28-7,45 g L-1; ácido málico, 0,38-29,92 g L-1, ácido cítrico trazas-1,03 g L-1; fructosa, 0,15-8,74 g (azúcar 100 g (uva-1; glucosa, 0,19-8,71 g (azúcar 100 g (uva-1 and sacarosa 0.02-0.91 g (azúcar 100 g(uva-1. Entre los azúcares, glucosa fue la más abundante en etapas tempranas y luego disminuyó hasta el período de cosecha, cuando la cantidad de fructosa y glucosa converge en un promedio de 47% para cada azúcar. A pesar de que los ácidos orgánicos alcanzaron un nivel constante entre 3 a 4 semanas antes de su cosecha, existen diferencias importantes en el perfil de ácidos orgánicos entre las variedades, con ‘Thompson Seedless’ mostrando la más baja relación de ácidos tartárico/málico de 1,19. Estas diferencias son un punto importante al considerar el sabor general para cada variedad.

  11. Reindeer husbandry and local planning

    Directory of Open Access Journals (Sweden)

    Lars P. Niia

    1986-06-01

    åmna forslag på hur samebyns interessen kan båtre tillvaratas och hur den kan oka sitt inflytande i planeringssammanhang. På grundval av framkomna resultat foreslås: —att samebyn skapar egen kompetens. Det år fråga om att forbereda sig infor forandringar i omgivningen exvis i form av markanvåndnings- och utvecklingsplanering. —att samebyn bygger upp den egna organisationen. —att samebyn får ett mera breddat och fordjupat inflytande i det kommunala planerings- och beslutssystemet. Detta projekt och tidigare erfarenheter visar på att samråd som form for inflytande år svag och osåker.Poronhoito ja kunnallinen suunnittelu.Abstract in Finnish / Yhteenveto: Keskeinen teema poronhoidon yhteydesså on selkkaukset poronhoidon ja muiden taloudellisten hyotyjen vålillå kuten turismin, yhteiskunnan laajennuksen j.n.e. yhteisten pinta-alojen hyvåksikåytosså. Historiallinen, taannehtiva katsaus osoittaa, ettei tårna ongclma ole millåån tavalla joku uusi ilmio, vaan vanha teema vaihdellen ajassa ja alueilla. Sami Instituhttan erååsså tutkimusprojektissa on suoritettu tutkielma pitåen pååmåårånå: 1. koettaa kuvailla poronhoidon suunnitteluedellytykset, 2. koettaa selvittåå, miten poronhoidon edut otetaan talteen kunnallisessa, fyysilliscssa suunnittelussa, 3. loytåå ilmaisumuotoja siitå, miten poronhoidon maa-alueen kåytto voidaan kuvailla, 4. jåttåå ehdotuksia siitå, miten paliskunnan etuja voidaan paremmin ottaa talteen sckå miten se voi lisåtå vaikutusvaltaansa suunnittelun yhteydesså. Esilletulleiden tulosten perusteella ehdotetaan:— ettå paliskunta muodostaa oman toimivallan. On kysymys valmistautua ympåriston muutoksiin esimerkiksi maa-alueen kåyton- ja kehityssuunnittelussa, — ettå paliskunta perustaa oman jårjeston, — ettå paliskunta saa leveåmmån ja syvemmån vaikutusvallan kunnallisessa suunnittelu- ja pååtoselimesså. Tamd projekti ja aikaisempi kokemus osoittaa, ettå neuvottelu vaikutusvaltaisena on hcikkoa ja epåvarmaa.

  12. Macroscopical and microscopical studies of the common bile duct in reindeer (Rangifer tarandus tarandus L

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    . Sisäosan muodostaa poimuuntunut limakalvo. Limakalvoa ympäröivät sidekudossäikeet ja serosa, sappikäytävän loppuosassa myös lihassäikeistö. Seinämässä havaittiin yksittäisiä valkosoluja ja imusolukasautumia. Poikkeuksellisena anatomisena piirteenä voidaan pitää haimasaarekkeiden esiintymistä sappikäytäväseinämän kudoksissa jopa läheisessä kosketuksessa pintaepiteeliin. Limakalvon epiteelikudos on sekä pinta- että rauhassolukkoa, joka erittää limaa. Epiteelissä tunnistettiin lukuisia kerässoluja huolimatta siitä, että poroille oli suoritettu loishäätö edellisenä syksynä.Studier av gallgången (ductus hepaticus communis hos ren.Abstract in Swedish / Sammandrag: Den gemensamma gallgångens histologi och sekretoriska funktion hos renen har inte tidigare beskrivits. För att klarlägga den makroskopiska byggnaden och topografin av den gemensamma gallgången (ductus hepaticus communis undersöktes dessa i 25 renar. Väggen i 20 gallgånger granskades histologiskt. Undersökningarna visade att ductus pancreaticus mynnar ut i ductus hepaticus communis bildande en gemensam utforselgång till duodenum. Ductus hepaticus communis är c. 2-3 mm i diameter och 3-5 cm lång. Den elastiska gangens vägg är c. 1 mm tjock delvis omgiven av fett- och pankreasvävnad. Gangens vägg består av serosa, bindvävsfibrer och nära mynningen ses muskelfibrer. Insidan av gången är beklädd med en veckad slemhinna. Lymfatisk vävnad och enstaka lymfocyter observeras. Anmärkningsvärt är att pankreasvävnad förekommer i gallgångens vägg och under slemhinnan. Slemhinnans epitel består av yt- och körtelepitel som avsöndrar slem. De globulära leukocyterna var talrika i epitelet trots att renarna avmaskats på hösten.

  13. Feijoeiro manteiga, planta-teste para os vírus de vira-cabeça e da necrose branca do fumo A bean variety useful as a local-lesion test plant for tomato spotted wilt and Brazilian tobacco streak viruses

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1957-01-01

    Full Text Available Entre cêrca de 200 variedades de feijoeiro ensaiadas, a Manteiga foi mais sensitiva aos vírus de vira-cabeça e da necrose branca, formando, nas fôlhas primárias, lesões locais adequadas para contagens. Com o vírus de vira-cabeça as lesões locais apareceram de 3 -6 dias após as inoculações, sob a forma de manchas cloróticas, às vezes com anéis necróticos; com o vírus da necrose branca as lesões se manifestaram em 1 - 4 dias, sob a forma de pontuações necróticas, pequenos anéis necróticos ou, em casos de certas estirpes do vírus, como pintas cloróticas. Feijoeiros com as fôlhas primárias tendo 2/3 de sua expansão ou mais desenvolvidas deram melhores resultados para o vírus de vira-cabeça; para o vírus da necrose branca os melhores resultados foram obtidos com fôlhas que tinham 2/3 ou ligeiramente menos de sua expansão total. O vírus de vira-cabeça não se tornou sistêmico em plantas inoculadas mecanicamente. A maioria das estirpes do vírus da necrose branca também não se tornou sistêmica em feijoeiros inoculados mecanicamente. Uma estirpe amarela deste tem a capacidade de se tornar sistêmica em feijoeiros sob determinadas condições. O sulfito de sódio em solução 0,0125 M, usado na extração do inóculo, aumentou ligeiramente o número de lesões formadas nas fôlhas do feijoeiro Manteiga pelo vírus de vira-cabeça; aumento consideravelmente maior foi obtido com a extração em presença de búfer de fosfato 0,1 M com pH 7, sendo êsse efeito atribuído a um aumento da sensitividade da planta-teste. A mistura de ambos causou aumento igual ou ligeiramente menor que o búfer só. Para o vírus da necrose branca a presença de sulfito de sódio 0,0125 M durante a extração aumentou consideravelmente o número de lesões, sendo esse efeito atribuído à diminuição na perda de atividade do vírus, devida à oxidação; o búfer sozinho ocasionou pequeno aumento em comparação com a testemunha, mas a

  14. The Guadalupian Fauna

    Science.gov (United States)

    Girty, George H.

    1908-01-01

    The first descriptions of the Guadalupian fauna were published nearly fifty years ago. This early account of Shumard's was meager enough, but gave promise of a facies interesting and novel among the known Carboniferous faunas of North America. The following pages add largely to our knowledge of Guadalupian life, and I believe more than make good any promise contained in the previous account. Nevertheless, even the collections of the Guadalupian fauna here described fail to do justice to its richness and diversity, and the present report is completed with the hope of returning to the subject after another visit to the Guadalupe Mountains. Although a description of this range and the adjacent region can be found elsewhere, a repetition of the more important facts will conduce to a better understanding of the geologic relations of the fauna described herein and will serve to illustrate the references to localities and horizons necessarily involved in the paleontologic discussion. The Guadalupe Mountains are situated chiefly in southeastern New Mexico, but extend across the border for a short distance into the trans-Pecos region of Texas. Save only for this southern extreme both their geology and their topography are practically unknown, and it should be understood that anything hereafter said of them relates only to that portion. These mountains form a north-south range of considerable height, which rises abruptly from an arid and treeless plain, stretching westward to more mountainous elevations, the Cornudas Mountains and the Sierra Tinaja Pinta. This plain is locally known as Crow Flats and forms a part of the Salt Basin (Pl. I). It is now used as cattle ranges, water being raised by windmills. The only permanent surface water consists of salt lakes - broad, shallow pools incrusted with saline deposits, which in the early days were extensively sought for domestic use. This water is of course unfit for consumption, but cattle seem as a rule not to mind the less

  15. Electron microscopical studies of the common bile duct in reindeer

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    Full Text Available In a previous publication the authors have described some ultrastructural characteristics of granulated cells in the common bile duct of the reindeer. On the basis of the same material, electron microscopic observations on other tissue elements of bile duct wall are now reported. The surface and glandular epithelium were composed of tall columnar epithelial cells with villous structures on the luminal surfaces. The parietal cytoplasmic membranes of epithelial cells were equipped with intercellular desmosomes while intraepithelial globule leucocytes did not form any junctional complex with other cells. Apical cytoplasmic areas of superficial epithelial cells showed electron-dense small bodies possibly consisting of mucinous substances. The goblet and deep glandular cells, on the other hand, contained numerous large mucin granules with less electron-dense matrices. It appears that their secretions are more abundant than those in superficial epithelial cells which obviously are absorptive as their main function. The nuclei and other cytoplasmic organelles showed profiles similar to those in epithelial cells generally. The lumen of the bile ducts was usually empty or contained fine-granular or amorphous material. An unusual feature was the presence of parts of globule leucocytes or even almost whole cells occurring freely in ductal secretions.Elektronimikroskooppinen tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Aikaisemmassa julkaisussa tekijät kuvasivat poron yhteisen sappikäytävän (ductus hepaticus communis seinämän jyväsellisten solujen hienorakennetta. Tässä artikkelissa selostetaan saman aineiston perusteella (6 tervettä teurasporoa elektronimikroskooppisia havaintoja sappikäytäväseinämän muista kudosrakenteista. Sappikäytäväseinämän pinta- ja rauhasepiteeli koostuu korkeista epiteelisoluista. Pinnallisia epiteelisoluja kattavat säännölliset mikrovillukset, ja niillä on vain v

  16. Organic and conventional tomato cropping systems Sistemas de cultivo orgânico e convencional de tomateiro

    Directory of Open Access Journals (Sweden)

    Wagner Bettiol

    2004-06-01

    ência de manchas foliares causadas por Septoria lycopersici e Xanthomonas vesicatoria, entretanto a pinta preta e a podridão de frutos causados por Alternaria solani ocorreram em maiores proporções. Não foram observadas diferenças quanto às comunidades de fungos e bactérias do filoplano e quanto à ocorrência de plantas invasoras.

  17. Reindeer husbandry and forestry in the reindeer herding district of Poikajärvi during the years 1963 — 1984

    Directory of Open Access Journals (Sweden)

    Katarina Kupiainen

    2010-06-01

    älttää. Laajat metsien avohakkuut ja aurakset ovat supistaneet erityisesti porojen talvilaitumia. Talvclla poro kaivaa jäkälää (Cladina sp.. lumen alta ja siirtyy hangen kovetessa syömään luppoa (Alectoria ja Bryoria spp.. Jäkäliköt ovat kuitenkin kovin kuluneita ja parhaat luppometsät on hakattu. Poikajärven paliskunnan (66°30' — 67°10'N pinta-ala on 2507 km2, josta valtionmaata 1 474.5 km2 (59%. Vuosien 1963 — 1984 keskimääräinen lukuporotiheys on ollut 1.5 poroa/km2. Viimeisen20 vuoden aikana on Poikajärven valtionmaan alasta käsitelty uudistushakkuilla, pääasiassa avohakkuilla, 9.8% ja kasvatushakkuilla 19.6%. Erilaisilla maanmuokkausmenetelmillä on käsitelty 8.7%, valtaosa auraamalla. Tuoreista kankaista on avohakattu ja aurattu noin 24%. Paliskunnan valtionmetsien arvioitu hakkuukertymä on vuodesta 1976, lähtien jatkuvasti kasvanut ja oli vuonna 1984 noin 140 600 m3. Vuodesta 1963 lähtien lukuporojen määrä on vähentynyt keskimäärin 60 porolla vuodessa. Määrä on vaihdellut 4939 ja 2866 poron välillä. Vuosina 1963 — 1984 on teurastettu keskimäärin 1 425 poroa vuodessa. Vasojen osuus teurastetuista on kasvanut ja viime vuosina se on ollut lähes 80%. Poronlihantuotanto on ollut keskimäärin 36 400 kg vuodessa. Porojen lis'äruokintaa on Poikajärven paliskunnassa harjoitettu vuodesta 1969 lähtien. Lisäruokintaan käytetyn heinän määrä on kasvanut noin 5.5 kg:sta lähes 20 kg:an lukuporoa kohti. Samanaikaisesti on lukuporojen ja teurastettujen määrä sekä lihantuotanto laskenut.

  18. Comentario al libro “Creación, Arte y Psiquis”

    Directory of Open Access Journals (Sweden)

    Fernando Sánchez Torres

    2004-06-01

    nchez Medina (Editor Académico Fernando Sánchez Torres psicoanálisis y sus aportaciones al mejor conocimiento de dicho proceso, sean temas abarcados en el libro.

    Por su formación psicoanalítica freudiana, es inevitable que en la explicación de ese enigma Sánchez Medina invoque la intervención de Eros y Tánatos, vida y muerte, que son para él energía del cosmos, y que, viéndolo bien, no es -el enigma de la creación- otra cosa que el ansia de inmortalidad que acompaña al ser viviente, tesis esta de la que se ocupó con profundidad don Miguel de Unamuno en su libro Del sentido trágico de la vida, donde no se habla de ansia sino de “hambre de inmortalidad”. Allí se lee: “El que escribe, pinta o esculpe, quiere, cuando menos, dejar una sombra de su espíritu, algo que sobreviva”. Por su parte, el académico Sánchez se pregunta: “¿Cuál es el papel de la creación ante la perspectiva de la muerte?” Su respuesta es dubitativa: “Tal vez sea permitirnos abandonar la vida en paz, dejando una realización que no muera, que dé continuidad al movimiento, a la transformación, a la vida misma”. Más adelante agrega que el acto creador permite a la personalidad creadora pasar de “la nada” y “el vacío” a ser “algo”. “La nada y el vacío –dice- pueden ser sentidos como miedo a la muerte, lo cual produce la ansiedad básica”. Conociendo lo prolífico que ha sido Guillermo Sánchez para crear libros, no queda duda de que esta ansiedad básica lo ha revestido del afán para superar la nada y el vacío...

  19. A SEM study of the reindeer sinus worm (Linguatula arctica

    Directory of Open Access Journals (Sweden)

    Sven Nikander

    2009-01-01

    remain obscure. Transmission electron microscopy should be employed to gain more information about this fascinating creature and its origin.Abstract in Finnish / Yhteenveto:Elektronimikroskooppinen tutkimus poron kielimadosta (Linguatula arctica Pentastomida (matoäyriäiset ovat ryhmä erikoisia parasiitteihin kuuluvia niveljalkaisia. Niitä kutsutaan usein kielimadoiksi, sillä monet ryhmään kuuluvista lajeista ovat muodoltaan kielimäisiä. Linguatula arctica, poron kielimato, on poron nenäonteloon liittyvissä sivuonteloissa elävä loinen. Se on ainoa tunnettu matoäyriäinen, jolla on sorkkaeläin pääisäntänä ja suora (ilman väli-isäntää tapahtuva elämänkierto. Tässä tutkimuksessa tarkasteltiin L. arctica -loisen pinta- ja sisärakenteita pyyhkäisyelektronimikroskoopin avulla. Loiset kerättiin Suomen lapista talvella 1991–92. Nenän sivuontelot tutkittiin loisten varalta noin 80 porosta, ja niistä löydettiin yhteensä 30 kielimatoa. Kielimatojen ulkonäkö oli tyypillinen Linguatula-suvun loisille. Ne olivat melanmuotoisia, läpikuultavia, vaalean kellertäviä, litteitä, ne vaikuttivat jaokkeisilta ja niillä oli pitkä loppua kohden kapeneva häntä. Suu sijaitsi vatsapuolella lähellä etupäätä, ja suuhun liittyneenä oli selvästi erottuva päämäinen uloke. Suuaukon tuntumassa, suuaukon molemmilla puolilla oli pari voimakkaasti kehittyneitä kynsimäisiä koukkurakenteita. Kielimadon ulkopinta koostui annulaarisista rakenteista, mistä johtuen se vaikutti jaokkeiselta. Loisen sivuissa, kunkin jaokkeen reunassa, oli tuntoelin, joka näkyi pyyhkäisyelektronimikroskoopilla kuppimaisena syvennyksenä. Jaokerenkaiden takareuna oli pienten, taaksepäin suuntautuneiden kitiinipiikkien karhentama. Koko ulkopinnan alueella nähtiin pieniä, pyöreitä painautumia, joiden todettiin olevan loisen pintaan avautuva kärkiosa niin kutsutuista kloridisoluista. Koiraskielimadon sukuaukko sijaitsi vatsapuolella takimmaisen koukkuparin k