
Sample records for picoeukaryote ostreococcus exposed

  1. Comparative Analysis of Culture Conditions for the Optimization of Carotenoid Production in Several Strains of the Picoeukaryote Ostreococcus

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Guyon


    Full Text Available Microalgae are promising sources for the sustainable production of compounds of interest for biotechnologies. Compared to higher plants, microalgae have a faster growth rate and can be grown in industrial photobioreactors. The microalgae biomass contains specific metabolites of high added value for biotechnology such as lipids, polysaccharides or carotenoid pigments. Studying carotenogenesis is important for deciphering the mechanisms of adaptation to stress tolerance as well as for biotechnological production. In recent years, the picoeukaryote Ostreococcus tauri has emerged as a model organism thanks to the development of powerful genetic tools. Several strains of Ostreococcus isolated from different environments have been characterized with respect to light response or iron requirement. We have compared the carotenoid contents and growth rates of strains of Ostreococcus (OTTH595, RCC802 and RCC809 under a wide range of light, salinity and temperature conditions. Carotenoid profiles and productivities varied in a strain-specific and stress-dependent manner. Our results also illustrate that phylogenetically related microalgal strains originating from different ecological niches present specific interests for the production of specific molecules under controlled culture conditions.

  2. Marine Picoeukaryotes in Cold Water

    DEFF Research Database (Denmark)

    Sørensen, Nikolaj

    Picoeukaryotes form an important part of marine ecosystems, both as primary producers, bacterial grazers and parasites. The Arctic is experiencing accelerated global warming and picoeukaryotes may thus be considered to be at the forefront of climate change. This PhD thesis sets out to investigate...

  3. Seasonal changes in the communities of photosynthetic picoeukaryotes in Ofunato Bay as revealed by shotgun metagenomic sequencing

    KAUST Repository

    Rashid, Jonaira


    Small photosynthetic eukaryotes play important roles in oceanic food webs in coastal regions. We investigated seasonal changes in the communities of photosynthetic picoeukaryotes (PPEs) of the class Mamiellophyceae, including the genera Bathycoccus, Micromonas and Ostreococcus, in Ofunato Bay, which is located in northeastern Japan and faces the Pacific Ocean. The abundances of PPEs were assessed over a period of one year in 2015 at three sampling stations, KSt. 1 (innermost bay area), KSt. 2 (middle bay area) and KSt. 3 (bay entrance area) at depths of 1 m (KSt. 1, KSt. 2 and KSt. 3), 8 m (KSt. 1) or 10 m (KSt. 2 and KSt. 3) by employing MiSeq shotgun metagenomic sequencing. The total abundances of Bathycoccus, Ostreococcus and Micromonas were in the ranges of 42–49%, 35–49% and 13–17%, respectively. Considering all assayed sampling stations and depths, seasonal changes revealed high abundances of PPEs during the winter and summer and low abundances during late winter to early spring and late summer to early autumn. Bathycoccus was most abundant in the winter, and Ostreococcus showed a high abundance during the summer. Another genus, Micromonas, was relatively low in abundance throughout the study period. Taken together with previously suggested blooming periods of phytoplankton, as revealed by chlorophyll a concentrations in Ofunato Bay during spring and late autumn, these results for PPEs suggest that greater phytoplankton blooming has a negative influence on the seasonal occurrences of PPEs in the bay.

  4. Seasonal changes in the communities of photosynthetic picoeukaryotes in Ofunato Bay as revealed by shotgun metagenomic sequencing

    KAUST Repository

    Rashid, Jonaira; Kobiyama, Atsushi; Reza, Md. Shaheed; Yamada, Yuichiro; Ikeda, Yuri; Ikeda, Daisuke; Mizusawa, Nanami; Ikeo, Kazuho; Sato, Shigeru; Ogata, Takehiko; Kudo, Toshiaki; Kaga, Shinnosuke; Watanabe, Shiho; Naiki, Kimiaki; Kaga, Yoshimasa; Mineta, Katsuhiko; Bajic, Vladimir B.; Gojobori, Takashi; Watabe, Shugo


    Small photosynthetic eukaryotes play important roles in oceanic food webs in coastal regions. We investigated seasonal changes in the communities of photosynthetic picoeukaryotes (PPEs) of the class Mamiellophyceae, including the genera Bathycoccus, Micromonas and Ostreococcus, in Ofunato Bay, which is located in northeastern Japan and faces the Pacific Ocean. The abundances of PPEs were assessed over a period of one year in 2015 at three sampling stations, KSt. 1 (innermost bay area), KSt. 2 (middle bay area) and KSt. 3 (bay entrance area) at depths of 1 m (KSt. 1, KSt. 2 and KSt. 3), 8 m (KSt. 1) or 10 m (KSt. 2 and KSt. 3) by employing MiSeq shotgun metagenomic sequencing. The total abundances of Bathycoccus, Ostreococcus and Micromonas were in the ranges of 42–49%, 35–49% and 13–17%, respectively. Considering all assayed sampling stations and depths, seasonal changes revealed high abundances of PPEs during the winter and summer and low abundances during late winter to early spring and late summer to early autumn. Bathycoccus was most abundant in the winter, and Ostreococcus showed a high abundance during the summer. Another genus, Micromonas, was relatively low in abundance throughout the study period. Taken together with previously suggested blooming periods of phytoplankton, as revealed by chlorophyll a concentrations in Ofunato Bay during spring and late autumn, these results for PPEs suggest that greater phytoplankton blooming has a negative influence on the seasonal occurrences of PPEs in the bay.

  5. New Insights into the Diversity of Marine Picoeukaryotes (United States)

    Not, Fabrice; del Campo, Javier; Balagué, Vanessa; de Vargas, Colomban; Massana, Ramon


    Over the last decade, culture-independent surveys of marine picoeukaryotic diversity based on 18S ribosomal DNA clone libraries have unveiled numerous sequences of novel high-rank taxa. This newfound diversity has significantly altered our understanding of marine microbial food webs and the evolution of eukaryotes. However, the current picture of marine eukaryotic biodiversity may be significantly skewed by PCR amplification biases, occurrence of rDNA genes in multiple copies within a single cell, and the capacity of DNA to persist as extracellular material. In this study we performed an analysis of the metagenomic dataset from the Global Ocean Survey (GOS) expedition, seeking eukaryotic ribosomal signatures. This PCR-free approach revealed similar phylogenetic patterns to clone library surveys, suggesting that PCR steps do not impose major biases in the exploration of environmental DNA. The different cell size fractions within the GOS dataset, however, displayed a distinct picture. High protistan diversity in the Marine Stramenopiles) appeared as potentially prominent grazers and we observed a significant decrease in the contribution of alveolate and radiolarian sequences, which overwhelmingly dominated rDNA libraries. The rRNA approach appears to be less affected by taxon-specific rDNA copy number and likely better depicts the biogeochemical significance of marine protists. PMID:19787059

  6. Growth on ATP Elicits a P-Stress Response in the Picoeukaryote Micromonas pusilla.

    Directory of Open Access Journals (Sweden)

    LeAnn P Whitney

    Full Text Available The surface waters of oligotrophic oceans have chronically low phosphate (Pi concentrations, which renders dissolved organic phosphorus (DOP an important nutrient source. In the subtropical North Atlantic, cyanobacteria are often numerically dominant, but picoeukaryotes can dominate autotrophic biomass and productivity making them important contributors to the ocean carbon cycle. Despite their importance, little is known regarding the metabolic response of picoeukaryotes to changes in phosphorus (P source and availability. To understand the molecular mechanisms that regulate P utilization in oligotrophic environments, we evaluated transcriptomes of the picoeukaryote Micromonas pusilla grown under Pi-replete and -deficient conditions, with an additional investigation of growth on DOP in replete conditions. Genes that function in sulfolipid substitution and Pi uptake increased in expression with Pi-deficiency, suggesting cells were reallocating cellular P and increasing P acquisition capabilities. Pi-deficient M. pusilla cells also increased alkaline phosphatase activity and reduced their cellular P content. Cells grown with DOP were able to maintain relatively high growth rates, however the transcriptomic response was more similar to the Pi-deficient response than that seen in cells grown under Pi-replete conditions. The results demonstrate that not all P sources are the same for growth; while M. pusilla, a model picoeukaryote, may grow well on DOP, the metabolic demand is greater than growth on Pi. These findings provide insight into the cellular strategies which may be used to support growth in a stratified future ocean predicted to favor picoeukaryotes.

  7. Diversity of picoeukaryotes at an oligotrophic site off the Northeastern Red Sea Coast.

    KAUST Repository

    Acosta, Francisco


    Picoeukaryotes are protists ≤ 3 μm composed of a wide diversity of taxonomic groups. They are an important constituent of the ocean\\'s microbiota and perform essential ecological roles in marine nutrient and carbon cycles. Despite their importance, the true extent of their diversity has only recently been uncovered by molecular surveys that resulted in the discovery of a substantial number of previously unknown groups. No study on picoeukaryote diversity has been conducted so far in the main Red Sea basin-a unique marine environment characterized by oligotrophic conditions, high levels of irradiance, high salinity and increased water temperature.

  8. Robustness of circadian clocks to daylight fluctuations: hints from the picoeucaryote Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Quentin Thommen

    Full Text Available The development of systemic approaches in biology has put emphasis on identifying genetic modules whose behavior can be modeled accurately so as to gain insight into their structure and function. However, most gene circuits in a cell are under control of external signals and thus, quantitative agreement between experimental data and a mathematical model is difficult. Circadian biology has been one notable exception: quantitative models of the internal clock that orchestrates biological processes over the 24-hour diurnal cycle have been constructed for a few organisms, from cyanobacteria to plants and mammals. In most cases, a complex architecture with interlocked feedback loops has been evidenced. Here we present the first modeling results for the circadian clock of the green unicellular alga Ostreococcus tauri. Two plant-like clock genes have been shown to play a central role in the Ostreococcus clock. We find that their expression time profiles can be accurately reproduced by a minimal model of a two-gene transcriptional feedback loop. Remarkably, best adjustment of data recorded under light/dark alternation is obtained when assuming that the oscillator is not coupled to the diurnal cycle. This suggests that coupling to light is confined to specific time intervals and has no dynamical effect when the oscillator is entrained by the diurnal cycle. This intriguing property may reflect a strategy to minimize the impact of fluctuations in daylight intensity on the core circadian oscillator, a type of perturbation that has been rarely considered when assessing the robustness of circadian clocks.

  9. Mesoscale distribution and functional diversity of picoeukaryotes in the first-year sea ice of the Canadian Arctic. (United States)

    Piwosz, Kasia; Wiktor, Józef Maria; Niemi, Andrea; Tatarek, Agnieszka; Michel, Christine


    Sea ice, a characteristic feature of polar waters, is home to diverse microbial communities. Sea-ice picoeukaryotes (unicellular eukaryotes with cell size Arctic first-year sea ice. Here, we investigated the abundance of all picoeukaryotes, and of 11 groups (chlorophytes, cryptophytes, bolidophytes, haptophytes, Pavlovaphyceae, Phaeocystis spp., pedinellales, stramenopiles groups MAST-1, MAST-2 and MAST-6 and Syndiniales Group II) at 13 first-year sea-ice stations localized in Barrow Strait and in the vicinity of Cornwallis Island, Canadian Arctic Archipelago. We applied Catalyzed Reporter Deposition-Fluorescence In Situ Hybridization to identify selected groups at a single cell level. Pavlovaphyceae and stramenopiles from groups MAST-2 and MAST-6 were for the first time reported from sea ice. Total numbers of picoeukaryotes were significantly higher in the vicinity of Cornwallis Island than in Barrow Strait. Similar trend was observed for all the groups except for haptophytes. Chlorophytes and cryptophytes were the dominant plastidic, and MAST-2 most numerous aplastidic of all the groups investigated. Numbers of total picoeukaryotes, chlorophytes and MAST-2 stramenopiles were positively correlated with the thickness of snow cover. All studied algal and MAST groups fed on bacteria. Presence of picoeukaryotes from various trophic groups (mixotrophs, phagotrophic and parasitic heterotrophs) indicates the diverse ecological roles picoeukaryotes have in sea ice. Yet, >50% of total sea-ice picoeukaryote cells remained unidentified, highlighting the need for further study of functional and phylogenetic sea-ice diversity, to elucidate the risks posed by ongoing Arctic changes.

  10. Phagotrophy by the picoeukaryotic green alga Micromonas: implications for Arctic Oceans. (United States)

    McKie-Krisberg, Zaid M; Sanders, Robert W


    Photosynthetic picoeukaryotes (PPE) are recognized as major primary producers and contributors to phytoplankton biomass in oceanic and coastal environments. Molecular surveys indicate a large phylogenetic diversity in the picoeukaryotes, with members of the Prymnesiophyceae and Chrysophyseae tending to be more common in open ocean waters and Prasinophyceae dominating coastal and Arctic waters. In addition to their role as primary producers, PPE have been identified in several studies as mixotrophic and major predators of prokaryotes. Mixotrophy, the combination of photosynthesis and phagotrophy in a single organism, is well established for most photosynthetic lineages. However, green algae, including prasinophytes, were widely considered as a purely photosynthetic group. The prasinophyte Micromonas is perhaps the most common picoeukaryote in coastal and Arctic waters and is one of the relatively few cultured representatives of the picoeukaryotes available for physiological investigations. In this study, we demonstrate phagotrophy by a strain of Micromonas (CCMP2099) isolated from Arctic waters and show that environmental factors (light and nutrient concentration) affect ingestion rates in this mixotroph. In addition, we show size-selective feeding with a preference for smaller particles, and determine P vs I (photosynthesis vs irradiance) responses in different nutrient conditions. If other strains have mixotrophic abilities similar to Micromonas CCMP2099, the widespread distribution and frequently high abundances of Micromonas suggest that these green algae may have significant impact on prokaryote populations in several oceanic regimes.

  11. Diversity of picoeukaryotes at an oligotrophic site off the Northeastern Red Sea Coast.

    KAUST Repository

    Acosta, Francisco; Ngugi, David; Stingl, Ulrich


    , the true extent of their diversity has only recently been uncovered by molecular surveys that resulted in the discovery of a substantial number of previously unknown groups. No study on picoeukaryote diversity has been conducted so far in the main Red Sea

  12. Unique picoeukaryotic algal community under multiple environmental stress conditions in a shallow, alkaline pan. (United States)

    Pálffy, Károly; Felföldi, Tamás; Mentes, Anikó; Horváth, Hajnalka; Márialigeti, Károly; Boros, Emil; Vörös, Lajos; Somogyi, Boglárka


    Winter phytoplankton communities in the shallow alkaline pans of Hungary are frequently dominated by picoeukaryotes, sometimes in particularly high abundance. In winter 2012, the ice-covered alkaline Zab-szék pan was found to be extraordinarily rich in picoeukaryotic green algae (42-82 × 10(6) cells ml(-1)) despite the simultaneous presence of multiple stressors (low temperature and light intensity with high pH and salinity). The maximum photosynthetic rate of the picoeukaryote community was 1.4 μg C μg chlorophyll a (-1) h(-1) at 125 μmol m(-2) s(-1). The assimilation rates compared with the available light intensity measured on the field show that the community was considerably light-limited. Estimated areal primary production was 180 mg C m(-2) d(-1). On the basis of the 18S rRNA gene analysis (cloning and DGGE), the community was phylogenetically heterogeneous with several previously undescribed chlorophyte lineages, which indicates the ability of picoeukaryotic communities to maintain high genetic diversity under extreme conditions.

  13. Community composition of picoeukaryotes in the South China Sea during winter (United States)

    Lin, Yun-Chi; Chiang, Kuo-Ping; Kang, Lee-Kuo


    Picoeukaryotes, the smallest protists, are highly diverse and abundant in the ocean. However, little information is available about their community composition in the tropical northwestern Pacific Ocean. This study collected surface and deep chlorophyll maximum (DCM) waters from the South China Sea (SCS) to study the picoeukaryotic composition by constructing clone libraries of the 18S rRNA gene. The libraries were dominated by the heterotrophic organisms, alveolates and Rhizaria, which accounted for 46% and 16% of total clones, respectively. MALV-I was the most abundant group in alveolates, and Rhizaria appears to be a key organism in the SCS, particularly within DCM layers. These results indicate that parasitism is significant in the oligotrophic and tropical SCS. Apart from core-dinoflagellates, chlorophytes, haptophytes, cryptophytes and pelagophytes were other important contributors to primary production in pico-sized fraction based on quantitative and qualitative data.

  14. Diversity of Picoeukaryotes at an Oligotrophic Site off the Northern Red Sea Coast

    KAUST Repository

    Espinosa, Francisco Jose Acosta


    Picoeukaryotes are protist 3 µm belonging to a wide diversity of taxonomic groups, and they are an important constituent of the ocean microbiota, performing essential ecological roles in marine trophic chains and in nutrient and carbon budgets. Despite this, the true extent of their diversity is currently unknown, and in the last decade molecular surveys have uncovered a substantial number of previously unknown groups from all taxonomic levels. No studies on this group have been done so far on the Red Sea, a unique marine environment characterized by oligotrophic conditions and high irradiance, salinity and water temperature. We sampled the surface waters of a site near the northern Red Sea coast, and analyzed the picoeukaryotic diversity through the construction of PCR clone libraries using the 18S ribosomal gene. The community captured by our library is dominated by three main groups, the alveolates (32%), chlorophytes (32%) and Stramenopiles (20.55%). Members of Radiolaria, Cercozoans and Haptophyta were also found, although in low abundances. Photosynthetic organisms are especially diverse and abundant in the sample, with heterotrophic organism mostly composed by the mostly parasitic novel alveolates and bacterivorous stramenopiles. Novel clades were detected among the Novel Alveolates- II and the photosynthetic stramenopiles taxa, which suggests that they may be part of a number of groups unique to the basin and adapted to the high salinity and temperature conditions. This is the first study done on the Red Sea focusing on the diversity of the complete picoeukaryotic fraction, and provides a stepping stone in the characterization of the picoeukaryotic component of the microbial diversity of the basin.

  15. Prasinovirus Attack of Ostreococcus Is Furtive by Day but Savage by Night. (United States)

    Derelle, Evelyne; Yau, Sheree; Moreau, Hervé; Grimsley, Nigel H


    Prasinoviruses are large DNA viruses that infect diverse genera of green microalgae worldwide in aquatic ecosystems, but molecular knowledge of their life cycles is lacking. Several complete genomes of both these viruses and their marine algal hosts are now available and have been used to show the pervasive presence of these species in microbial metagenomes. We have analyzed the life cycle of Ostreococcus tauri virus 5 (OtV5), a lytic virus, using transcriptome sequencing (RNA-Seq) from 12 time points of healthy or infected Ostreococcus tauri cells over a day/night cycle in culture. In the day, viral gene transcription remained low while host nitrogen metabolism gene transcription was initially strongly repressed for two successive time points before being induced for 8 h, but during the night, viral transcription increased steeply while host nitrogen metabolism genes were repressed and many host functions that are normally reduced in the dark appeared to be compensated either by genes expressed from the virus or by increased expression of a subset of 4.4% of the host's genes. Some host cells underwent lysis progressively during the night, but a larger proportion were lysed the following morning. Our data suggest that the life cycles of algal viruses mirror the diurnal rhythms of their hosts. IMPORTANCE Prasinoviruses are common in marine environments, and although several complete genomes of these viruses and their hosts have been characterized, little is known about their life cycles. Here we analyze in detail the transcriptional changes occurring over a 27-h-long experiment in a natural diurnal rhythm, in which the growth of host cells is to some extent synchronized, so that host DNA replication occurs late in the day or early in the night and cell division occurs during the night. Surprisingly, viral transcription remains quiescent over the daytime, when the most energy (from light) is available, but during the night viral transcription activates, accompanied

  16. Diversity of picoeukaryotes at an oligotrophic site off the Northeastern Red Sea Coast. (United States)

    Acosta, Francisco; Ngugi, David Kamanda; Stingl, Ulrich


    Picoeukaryotes are protists ≤ 3 μm composed of a wide diversity of taxonomic groups. They are an important constituent of the ocean's microbiota and perform essential ecological roles in marine nutrient and carbon cycles. Despite their importance, the true extent of their diversity has only recently been uncovered by molecular surveys that resulted in the discovery of a substantial number of previously unknown groups. No study on picoeukaryote diversity has been conducted so far in the main Red Sea basin-a unique marine environment characterized by oligotrophic conditions, high levels of irradiance, high salinity and increased water temperature. We sampled surface waters off the coast of the northeastern Red Sea and analyzed the picoeukaryotic diversity using Sanger-based clone libraries of the 18S rRNA gene in order to produce high quality, nearly full-length sequences. The community captured by our approach was dominated by three main phyla, the alveolates, stramenopiles and chlorophytes; members of Radiolaria, Cercozoa and Haptophyta were also found, albeit in low abundances. Photosynthetic organisms were especially diverse and abundant in the sample, confirming the importance of picophytoplankton for primary production in the basin as well as indicating the existence of numerous ecological micro-niches for this trophic level in the upper euphotic zone. Heterotrophic organisms were mostly composed of the presumably parasitic Marine Alveolates (MALV) and the presumably bacterivorous Marine Stramenopiles (MAST) groups. A small number of sequences that did not cluster closely with known clades were also found, especially in the MALV-II group, some of which could potentially belong to novel clades. This study provides the first snapshot of the picoeukaryotic diversity present in surface waters of the Red Sea, hence setting the stage for large-scale surveying and characterization of the eukaryotic diversity in the entire basin. Our results indicate that the

  17. Identification and analysis of OsttaDSP, a phosphoglucan phosphatase from Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Julieta B Carrillo

    Full Text Available Ostreococcus tauri, the smallest free-living (non-symbiotic eukaryote yet described, is a unicellular green alga of the Prasinophyceae family. It has a very simple cellular organization and presents a unique starch granule and chloroplast. However, its starch metabolism exhibits a complexity comparable to higher plants, with multiple enzyme forms for each metabolic reaction. Glucan phosphatases, a family of enzymes functionally conserved in animals and plants, are essential for normal starch or glycogen degradation in plants and mammals, respectively. Despite the importance of O. tauri microalgae in evolution, there is no information available concerning the enzymes involved in reversible phosphorylation of starch. Here, we report the molecular cloning and heterologous expression of the gene coding for a dual specific phosphatase from O. tauri (OsttaDSP, homologous to Arabidopsis thaliana LSF2. The recombinant enzyme was purified to electrophoretic homogeneity to characterize its oligomeric and kinetic properties accurately. OsttaDSP is a homodimer of 54.5 kDa that binds and dephosphorylates amylopectin. Also, we also determined that residue C162 is involved in catalysis and possibly also in structural stability of the enzyme. Our results could contribute to better understand the role of glucan phosphatases in the metabolism of starch in green algae.

  18. The reduced kinome of Ostreococcus tauri: core eukaryotic signalling components in a tractable model species. (United States)

    Hindle, Matthew M; Martin, Sarah F; Noordally, Zeenat B; van Ooijen, Gerben; Barrios-Llerena, Martin E; Simpson, T Ian; Le Bihan, Thierry; Millar, Andrew J


    The current knowledge of eukaryote signalling originates from phenotypically diverse organisms. There is a pressing need to identify conserved signalling components among eukaryotes, which will lead to the transfer of knowledge across kingdoms. Two useful properties of a eukaryote model for signalling are (1) reduced signalling complexity, and (2) conservation of signalling components. The alga Ostreococcus tauri is described as the smallest free-living eukaryote. With less than 8,000 genes, it represents a highly constrained genomic palette. Our survey revealed 133 protein kinases and 34 protein phosphatases (1.7% and 0.4% of the proteome). We conducted phosphoproteomic experiments and constructed domain structures and phylogenies for the catalytic protein-kinases. For each of the major kinases families we review the completeness and divergence of O. tauri representatives in comparison to the well-studied kinomes of the laboratory models Arabidopsis thaliana and Saccharomyces cerevisiae, and of Homo sapiens. Many kinase clades in O. tauri were reduced to a single member, in preference to the loss of family diversity, whereas TKL and ABC1 clades were expanded. We also identified kinases that have been lost in A. thaliana but retained in O. tauri. For three, contrasting eukaryotic pathways - TOR, MAPK, and the circadian clock - we established the subset of conserved components and demonstrate conserved sites of substrate phosphorylation and kinase motifs. We conclude that O. tauri satisfies our two central requirements. Several of its kinases are more closely related to H. sapiens orthologs than S. cerevisiae is to H. sapiens. The greatly reduced kinome of O. tauri is therefore a suitable model for signalling in free-living eukaryotes.

  19. Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas

    Energy Technology Data Exchange (ETDEWEB)

    Worden, Alexandra Z.; Lee, Jae-Hyeok; Mock, Thomas; Rouze, Pierre; Simmons, Melinda P.; Aerts, Andrea L.; Allen, Andrew E.; Cuvelier, Marie L.; Derelle, Evelyne; Everett, Meredieht V.; Foulon, Elodie; Grimwood, Jane; Gundlach, Heidrun; Henrissat, Bernard; Napoli, Carolyn; McDonald, Sarah M.; Parker, Micaela S.; Rombauts, Stephane; Salamov, Asaf; von Dassow, Peter; Badger, Jonathan G,; Coutinho, Pedro M.; Demir, Elif; Dubchak, Inna; Gentemann, Chelle; Eikrem, Wenche; Gready, Jill E.; John, Uwe; Lanier, William; Lindquist, Erika A.; Lucas, Susan; Mayer, Kluas F. X.; Moreau, Herve; Not, Fabrice; Otillar, Robert; Panaud, Olivier; Pangilinan, Jasmyn; Paulsen, Ian; Piegu, Benoit; Poliakov, Aaron; Robbens, Steven; Schmutz, Jeremy; Roulza, Eve; Wyss, Tania; Zelensky, Alexander; Zhou, Kemin; Armbrust, E. Virginia; Bhattacharya, Debashish; Goodenough, Ursula W.; Van de Peer, Yves; Grigoriev, Igor V.


    Picoeukaryotes are a taxonomically diverse group of organisms less than 2 micrometers in diameter. Photosynthetic marine picoeukaryotes in the genus Micromonas thrive in ecosystems ranging from tropical to polar and could serve as sentinel organisms for biogeochemical fluxes of modern oceans during climate change. These broadly distributed primary producers belong to an anciently diverged sister clade to land plants. Although Micromonas isolates have high 18S ribosomal RNA gene identity, we found that genomes from two isolates shared only 90percent of their predicted genes. Their independent evolutionary paths were emphasized by distinct riboswitch arrangements as well as the discovery of intronic repeat elements in one isolate, and in metagenomic data, but not in other genomes. Divergence appears to have been facilitated by selection and acquisition processes that actively shape the repertoire of genes that are mutually exclusive between the two isolates differently than the core genes. Analyses of the Micromonas genomes offer valuable insights into ecological differentiation and the dynamic nature of early plant evolution.

  20. Ostreococcus tauri Luminescent Reporter Lines as Biosensors for Detecting Pollution From Copper-Mine Tailing Effluents in Coastal Environments

    Directory of Open Access Journals (Sweden)

    Carlos Henríquez-Castillo


    Full Text Available Phytoplankton cells are excellent biosensors for environmental monitoring and toxicity assessments in different natural systems. Green algae, in particular, appear to be more responsive to copper (Cu disturbances. This is interesting considering that Cu pollution in coastal environments has increased over the last century, with enormous repercussions to marine ecosystems. Unfortunately, no high-throughput method exists for the environmental monitoring of Cu toxicity in seawater. To assess potential uses as biosensors of Cu pollution, high-throughput screening was performed on five luminescence reporter lines constructed in the green algae Ostreococcus tauri RCC745. The reporter line expressing the iron storage ferritin protein fused to luciferase (Fer-Luc was the most sensitive, responding to Cu concentrations in the μM range. Fer-Luc was also the most sensitive reporter line for detecting toxicity in mining-derived polluted seawater predominantly contaminated by soluble Cu. Nevertheless, the Cyclin-Dependent-Kinase A (CDKA reporter was most suitable for detecting the toxicity of copper-mine tailing effluents containing other metals (e.g., iron. These results highlight that Ostreococcus biosensors can serve as a reliable, inexpensive, and automated, high-throughput laboratory approach for performing seawater analyses of coastal areas subjected to metal disturbances. When challenged with Cu, O. tauri not only evidenced a rapid, transcriptional response for the tested genes, but also showed changes in a broad range of genes, especially as related to the stress response. Overall, the obtained results reinforce that a single biosensor is insufficient when dealing with complex mixtures of toxic compounds in natural environments.

  1. Vertical distribution of major photosynthetic picoeukaryotic groups in stratified marine waters

    KAUST Repository

    Cabello, Ana M.


    Photosynthetic picoeukaryotes (PPEs) are fundamental contributors to oceanic primary production and form diverse communities dominated by prymnesiophytes, chlorophytes, pelagophytes and chrysophytes. Here, we studied the vertical distribution of these major groups in two offshore regions of the northern Iberian Peninsula during summer stratification. We performed a fine-scale vertical sampling (every ∼2 m) across the DCM and used fluorescence in situ hybridization (FISH) to determine the PPE composition and to explore the possible segregation of target groups in the light, nutrient and temperature gradients. Chlorophytes, pelagophytes and prymnesiophytes, in this order of abundance, accounted for the total PPEs recorded by flow cytometry in the Avilés canyon, and for more than half in the Galicia Bank, whereas chrysophytes were undetected. Among the three detected groups, often the prymnesiophytes were dominant in biomass. In general, all groups were present throughout the water column with abundance peaks around the DCM, but their distributions differed: pelagophytes were located deeper than the other two groups, chlorophytes presented two peaks and prymnesiophytes exhibited surface abundances comparable to those at the DCM. This study offers first indications that the vertical distribution of different PPE groups is heterogeneous within the DCM. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  2. In silico structural determination of GPAT enzyme from Ostreococcus lucimarinus for biotechnological application of microalgal biofuel production

    International Nuclear Information System (INIS)

    Baral, Maitree; Misra, Namrata; Panda, Prasanna Kumar; Thirunavoukkarasu, Manakkannan


    Glycerol-3-phosphate acyltransferase (GPAT) is an enzyme in the triacylglycerol (TAG) biosynthetic pathway that catalyses the conversion of glycerol-3-phosphate to lysophosphatidic acid. Targeting key enzymes involved in TAG pathway is considered to be a powerful strategy for augmented lipid accumulation in microorganisms. In the present study three-dimensional structure of the marine microalgae, Ostreococcus lucimarinus GPAT protein was developed based on the crystal structure of Cucurbita moschata GPAT protein. Besides, several structure validation tools were employed to confirm the reliability of the developed model. The predicted and validated model reveals the tertiary structure of GPAT monomer comprising of two domains, the smaller domain I, which folds into a four helix bundle, and the larger domain II, which is constructed from alternating α/β secondary structural elements that give rise to 9-stranded β sheet flanked by 11α helices. Critical structural analysis of the developed model reveals the presence of H(X) 4D motif; the latter being, a consensus sequence conserved amongst many glycerolipid acyltransferase. The detected cluster of positively charged residues H189, K243, H244, R285 and R287 in the model could be conjectured to be important in glycerol-3-phosphate recognition. The structural insight obtained from this in silico study may provide useful clues to further advanced biotechnological studies of strategic site-specific genetic and metabolic engineering of microalgae for enhanced biofuel production.

  3. Label-free quantitative analysis of the casein kinase 2-responsive phosphoproteome of the marine minimal model species Ostreococcus tauri. (United States)

    Le Bihan, Thierry; Hindle, Matthew; Martin, Sarah F; Barrios-Llerena, Martin E; Krahmer, Johanna; Kis, Katalin; Millar, Andrew J; van Ooijen, Gerben


    Casein kinase 2 (CK2) is a protein kinase that phosphorylates a plethora of cellular target proteins involved in processes including DNA repair, cell cycle control, and circadian timekeeping. CK2 is functionally conserved across eukaryotes, although the substrate proteins identified in a range of complex tissues are often different. The marine alga Ostreococcus tauri is a unicellular eukaryotic model organism ideally suited to efficiently study generic roles of CK2 in the cellular circadian clock. Overexpression of CK2 leads to a slow circadian rhythm, verifying functional conservation of CK2 in timekeeping. The proteome was analysed in wild-type and CK2-overexpressing algae at dawn and dusk, revealing that differential abundance of the global proteome across the day is largely unaffected by overexpression. However, CK2 activity contributed more strongly to timekeeping at dusk than at dawn. The phosphoproteome of a CK2 overexpression line and cells treated with CK2 inhibitor was therefore analysed and compared to control cells at dusk. We report an extensive catalogue of 447 unique CK2-responsive differential phosphopeptide motifs to inform future studies into CK2 activity in the circadian clock of more complex tissues. All MS data have been deposited in the ProteomeXchange with identifier PXD000975 ( © 2015 The Authors. PROTEOMICS Published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Functional characterization of the NhaA Na+/H+ antiporter from the green picoalga Ostreococcus tauri. (United States)

    Dawut, Keatisuda; Sirisattha, Sophon; Hibino, Takashi; Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon


    Transmembrane ion transport is a critical process in the cellular response to salt stress. Among the known functional membrane transporters that are involved in the salt stress response, Na + /H + antiporters have been extensively studied. These ubiquitous membrane proteins are crucial for salt tolerance and are associated with the regulation of internal pH, cell volume, morphogenesis, and vesicular trafficking. Molecular and functional analyses of Na + /H + antiporters have been characterized among taxa but little is known about algal Na + /H + antiporters. Here, we analyzed putative Na + /H + antiporters from the complete genome sequence of the marine picoalga Ostreococcus tauri. At least 10 putative Na + /H + antiporters belonging to the SOS1, NHX, and KEA/Kef families were found. Surprisingly, a bacterial type NhaA sequence (OtNhaA) was also found. Topological modeling of OtNhaA predicted 12 possible transmembrane segments with a long N-terminus. The full-length (FL_OtNhaA) and N-terminal truncated (ΔN112_OtNhaA) versions of OtNhaA were constructed, expressed in the salt-sensitive mutant Escherichia coli TO114, and functionally characterized. Complementation analysis revealed that FL_OtNhaA- and ΔN112_OtNhaA-expressing cells exhibited increased tolerance to high NaCl concentrations up to 700 mM. Antiporter activity assays showed that both FL_OtNhaA and ΔN112_OtNhaA proteins predominantly exhibited Na + /H + and Ca 2+ /H + antiporter activities at alkaline pH conditions. Intriguingly, the ΔN112_OtNhaA exhibited higher Na + /H + and Ca 2+ /H + antiporter activities compared to FL_OtNhaA. Kinetic analysis revealed that FL_OtNhaA has a high affinity for Na + and Ca 2+ ions with a K m of 1.1 ± 0.23 mM for Na + (at pH 8.5) and a K m of 0.3 ± 0.07 mM for Ca 2+ (at pH 8.5). Since NhaA has shown striking diversity among taxa, our results provide insight into the functional properties of the algal NhaA Na + /H + antiporter. These results will

  5. Life-cycle and genome of OtV5, a large DNA virus of the pelagic marine unicellular green alga Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Evelyne Derelle

    Full Text Available Large DNA viruses are ubiquitous, infecting diverse organisms ranging from algae to man, and have probably evolved from an ancient common ancestor. In aquatic environments, such algal viruses control blooms and shape the evolution of biodiversity in phytoplankton, but little is known about their biological functions. We show that Ostreococcus tauri, the smallest known marine photosynthetic eukaryote, whose genome is completely characterized, is a host for large DNA viruses, and present an analysis of the life-cycle and 186,234 bp long linear genome of OtV5. OtV5 is a lytic phycodnavirus which unexpectedly does not degrade its host chromosomes before the host cell bursts. Analysis of its complete genome sequence confirmed that it lacks expected site-specific endonucleases, and revealed the presence of 16 genes whose predicted functions are novel to this group of viruses. OtV5 carries at least one predicted gene whose protein closely resembles its host counterpart and several other host-like sequences, suggesting that horizontal gene transfers between host and viral genomes may occur frequently on an evolutionary scale. Fifty seven percent of the 268 predicted proteins present no similarities with any known protein in Genbank, underlining the wealth of undiscovered biological diversity present in oceanic viruses, which are estimated to harbour 200Mt of carbon.

  6. Exposing diversity

    DEFF Research Database (Denmark)

    Nørtoft, Kamilla; Nordentoft, Helle Merete

    professionals´ meetings with patients and relatives. In the paper we draw data from focus group discussions with interdisciplinary groups of health care professionals working in the area of care for older people. The video narratives used to initiate discussions are developed through ethnographic fieldwork...... in the homes of older people and in pedagogical institutions targeting older people. In the paper we look at the potentials and challenges in working with ethnographic video narratives as a pedagogical tool. Our findings indicate that the use of video narratives has the potential to expose the diversity...... focus on their own professional discipline and its tasks 2) stimulates collaborative learning when they discuss their different interpretations of the ethnographic video narratives and achieve a deeper understanding of each other’s work and their clients’ lifeworlds, which might lead to a better...

  7. Buildings exposed to fire

    International Nuclear Information System (INIS)


    The 24 lectures presented to the colloquium cover the following subject fields: (1) Behaviour of structural components exposed to fire; (2) Behaviour of building materials exposed to fire; (3) Thermal processes; (4) Safety related, theoretical studies. (PW) [de

  8. Fire exposed aluminium structures

    NARCIS (Netherlands)

    Maljaars, J.; Fellinger, J.E.J.; Soetens, F.


    Material properties and mechanical response models for fire design of steel structures are based on extensive research and experience. Contrarily, the behaviour of aluminium load bearing structures exposed to fire is relatively unexplored. This article gives an overview of physical and mechanical

  9. The exposed breast

    International Nuclear Information System (INIS)

    Ingman, Wendy


    The skin and lungs are two tissues that are frequently bombarded with cancer-initiating factors, such as ultraviolet rays from the sun and smoke and pollutants in the air we breathe. Yet breast cancer is the most common type of cancer in Australian women, affecting one in eight before the age of 85. It is more common than skin melanoma and lung cancer. Why, then, does the breast so commonly get cancer when it is not a tissue that is particularly exposed to the environmental agents that increase cancer risk in other major organs? Is there something unique about this tissue that makes it particularly susceptible? The breast undergoes cellular changes over the course of the monthly menstrual cycle, and and these changes affect cancer susceptibility. Rising levels of the hormones oestrogen and progesterone occur immediately after the egg is released from the ovary, and these hormones cause the breast cells to divide and change to accommodate further development if pregnancy occurs. If the woman becomes pregnant, the cells in the breast continue to develop and become the milk-producing structures required to feed a newborn baby. But if pregnancy does not occur there is a drop in progesterone, which triggers the death of the newly developed breast cells. This occurs at the same time women have their period. Then the cycle starts again, and continues every month until menopause, unless the woman becomes pregnant.

  10. Exposing the faults

    International Nuclear Information System (INIS)

    Richardson, P.J.


    UK NIREX, the body with responsibility for finding an acceptable strategy for deposition of radioactive waste has given the impression throughout its recent public consultation that the problem of nuclear waste is one of public and political acceptability, rather than one of a technical nature. However the results of the consultation process show that it has no mandate from the British public to develop a single, national, deep repository for the burial of radioactive waste. There is considerable opposition to this method of managing radioactive waste and suspicion of the claims by NIREX concerning the supposed integrity and safety of this deep burial option. This report gives substance to those suspicions and details the significant areas of uncertainty in the concept of effective geological containment of hazardous radioactive elements, which remain dangerous for tens of thousands of years. Because the science of geology is essentially retrospective rather than predictive, NIREX's plans for a single, national, deep 'repository' depend heavily upon a wide range of assumptions about the geological and hydrogeological regimes in certain areas of the UK. This report demonstrates that these assumptions are based on a limited understanding of UK geology and on unvalidated and simplistic theoretical models of geological processes, the performance of which can never be directly tested over the long time-scales involved. NIREX's proposals offer no guarantees for the safe and effective containment of radioactivity. They are deeply flawed. This report exposes the faults. (author)

  11. Reprocessing of nonoptimally exposed holograms

    International Nuclear Information System (INIS)

    Phipps, G.S.; Robertson, C.E.; Tamashiro, F.M.


    Two reprocessing techniques have been investigated that are capable of correcting the effects of nonoptimum optical density of photographic amplitude holograms recorded on Agfa-Gevaert type 10E75 plates. In some cases a reprocessed hologram will exhibit a diffraction efficiency even higher than that obtainable from a hologram exposed and processed to the optimum density. The SNR of the reprocessed holograms is much higher than that of the same holograms belached with cupric bromide. In some cases the SNR approaches the optimum value for a properly exposed amplitude hologram. Subjective image quality and resolution of reprocessed hologram reconstructins appear to be no different than for normal single-development holograms. Repeated reprocessing is feasible and in some cases desirable as a means of increasing diffraction efficiency

  12. Advances in treating exposed fractures. (United States)

    Nogueira Giglio, Pedro; Fogaça Cristante, Alexandre; Ricardo Pécora, José; Partezani Helito, Camilo; Lei Munhoz Lima, Ana Lucia; Dos Santos Silva, Jorge


    The management of exposed fractures has been discussed since ancient times and remains of great interest to present-day orthopedics and traumatology. These injuries are still a challenge. Infection and nonunion are feared complications. Aspects of the diagnosis, classification and initial management are discussed here. Early administration of antibiotics, surgical cleaning and meticulous debridement are essential. The systemic conditions of patients with multiple trauma and the local conditions of the limb affected need to be taken into consideration. Early skeletal stabilization is necessary. Definitive fixation should be considered when possible and provisional fixation methods should be used when necessary. Early closure should be the aim, and flaps can be used for this purpose.

  13. Leukemias in the progeny of exposed parents

    International Nuclear Information System (INIS)

    Kosenko, M.M.; Gudkova, N.V.


    The purpose of this study was to assess the incidence of leukemias among the progeny of exposed parents. The parents were exposed as a result of discharge of radioactive waste from the Mayak atomic plant into the Techa river in the Southern Urals. The doses per parents gonads, ranging from 0.035 to 1.27 Sv, were due to external exposure in 1950-1956 and to incorporation of Cs-137. Nine cases with leukemia and four with lympohoma were recorded in 13.500 antenatally exposed subjects and descendants of exposed parents over the period of 1950 to 1988. The leukemia morbidity index for the progeny of exposed parents was 2.51, which virtually not statistically differ from that in control group. Refs. 7, figs. 3, tabs. 3

  14. Eryptosis in lead-exposed workers. (United States)

    Aguilar-Dorado, Itzel-Citlalli; Hernández, Gerardo; Quintanar-Escorza, Martha-Angelica; Maldonado-Vega, María; Rosas-Flores, Margarita; Calderón-Salinas, José-Víctor


    Eryptosis is a physiological phenomenon in which old and damaged erythrocytes are removed from circulation. Erythrocytes incubated with lead have exhibited major eryptosis. In the present work we found evidence of high levels of eryptosis in lead exposed workers possibly via oxidation. Blood samples were taken from 40 male workers exposed to lead (mean blood lead concentration 64.8μg/dl) and non-exposed workers (4.2μg/dl). The exposure to lead produced an intoxication characterized by 88.3% less δ-aminolevulinic acid dehydratase (δALAD) activity in lead exposed workers with respect to non-lead exposed workers. An increment of oxidation in lead exposed workers was characterized by 2.4 times higher thiobarbituric acid-reactive substance (TBARS) concentration and 32.8% lower reduced/oxidized glutathione (GSH/GSSG) ratio. Oxidative stress in erythrocytes of lead exposed workers is expressed in 192% higher free calcium concentration [Ca(2+)]i and 1.6 times higher μ-calpain activity with respect to non-lead exposed workers. The adenosine triphosphate (ATP) concentration was not significantly different between the two worker groups. No externalization of phosphatidylserine (PS) was found in non-lead exposed workers (lead exposed workers showed 2.82% externalization. Lead intoxication induces eryptosis possibly through a molecular pathway that includes oxidation, depletion of reduced glutathione (GSH), increment of [Ca(2+)], μ-calpain activation and externalization of PS in erythrocytes. Identifying molecular signals that induce eryptosis in lead intoxication is necessary to understand its physiopathology and chronic complications. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Eryptosis in lead-exposed workers

    International Nuclear Information System (INIS)

    Aguilar-Dorado, Itzel-Citlalli; Hernández, Gerardo; Quintanar-Escorza, Martha-Angelica; Maldonado-Vega, María; Rosas-Flores, Margarita; Calderón-Salinas, José-Víctor


    Eryptosis is a physiological phenomenon in which old and damaged erythrocytes are removed from circulation. Erythrocytes incubated with lead have exhibited major eryptosis. In the present work we found evidence of high levels of eryptosis in lead exposed workers possibly via oxidation. Blood samples were taken from 40 male workers exposed to lead (mean blood lead concentration 64.8 μg/dl) and non-exposed workers (4.2 μg/dl). The exposure to lead produced an intoxication characterized by 88.3% less δ-aminolevulinic acid dehydratase (δALAD) activity in lead exposed workers with respect to non-lead exposed workers. An increment of oxidation in lead exposed workers was characterized by 2.4 times higher thiobarbituric acid-reactive substance (TBARS) concentration and 32.8% lower reduced/oxidized glutathione (GSH/GSSG) ratio. Oxidative stress in erythrocytes of lead exposed workers is expressed in 192% higher free calcium concentration [Ca 2+ ] i and 1.6 times higher μ-calpain activity with respect to non-lead exposed workers. The adenosine triphosphate (ATP) concentration was not significantly different between the two worker groups. No externalization of phosphatidylserine (PS) was found in non-lead exposed workers (< 0.1%), but lead exposed workers showed 2.82% externalization. Lead intoxication induces eryptosis possibly through a molecular pathway that includes oxidation, depletion of reduced glutathione (GSH), increment of [Ca 2+ ], μ-calpain activation and externalization of PS in erythrocytes. Identifying molecular signals that induce eryptosis in lead intoxication is necessary to understand its physiopathology and chronic complications. - Graphical abstract: Fig. 1. (A) Blood lead concentration (PbB) and (B) phosphatidylserine externalization on erythrocyte membranes of non-lead exposed (□) and lead exposed workers (■). Values are mean ± SD. *Significantly different (P < 0.001). - Highlights: • Erythrocytes of lead exposed workers showed higher PS

  16. Eryptosis in lead-exposed workers

    Energy Technology Data Exchange (ETDEWEB)

    Aguilar-Dorado, Itzel-Citlalli [Biochemistry Department, Centro de Investigación y Estudios Avanzados IPN, México, DF (Mexico); Hernández, Gerardo [Section of Methodology of Science, Centro de Investigación y Estudios Avanzados IPN, México, DF (Mexico); Quintanar-Escorza, Martha-Angelica [Faculty of Medicine, UJED, Durango, DGO (Mexico); Maldonado-Vega, María [CIATEC, León, GTO (Mexico); Rosas-Flores, Margarita [Biochemistry Department, Centro de Investigación y Estudios Avanzados IPN, México, DF (Mexico); Calderón-Salinas, José-Víctor, E-mail: [Biochemistry Department, Centro de Investigación y Estudios Avanzados IPN, México, DF (Mexico)


    Eryptosis is a physiological phenomenon in which old and damaged erythrocytes are removed from circulation. Erythrocytes incubated with lead have exhibited major eryptosis. In the present work we found evidence of high levels of eryptosis in lead exposed workers possibly via oxidation. Blood samples were taken from 40 male workers exposed to lead (mean blood lead concentration 64.8 μg/dl) and non-exposed workers (4.2 μg/dl). The exposure to lead produced an intoxication characterized by 88.3% less δ-aminolevulinic acid dehydratase (δALAD) activity in lead exposed workers with respect to non-lead exposed workers. An increment of oxidation in lead exposed workers was characterized by 2.4 times higher thiobarbituric acid-reactive substance (TBARS) concentration and 32.8% lower reduced/oxidized glutathione (GSH/GSSG) ratio. Oxidative stress in erythrocytes of lead exposed workers is expressed in 192% higher free calcium concentration [Ca{sup 2+}]{sub i} and 1.6 times higher μ-calpain activity with respect to non-lead exposed workers. The adenosine triphosphate (ATP) concentration was not significantly different between the two worker groups. No externalization of phosphatidylserine (PS) was found in non-lead exposed workers (< 0.1%), but lead exposed workers showed 2.82% externalization. Lead intoxication induces eryptosis possibly through a molecular pathway that includes oxidation, depletion of reduced glutathione (GSH), increment of [Ca{sup 2+}], μ-calpain activation and externalization of PS in erythrocytes. Identifying molecular signals that induce eryptosis in lead intoxication is necessary to understand its physiopathology and chronic complications. - Graphical abstract: Fig. 1. (A) Blood lead concentration (PbB) and (B) phosphatidylserine externalization on erythrocyte membranes of non-lead exposed (□) and lead exposed workers (■). Values are mean ± SD. *Significantly different (P < 0.001). - Highlights: • Erythrocytes of lead exposed workers

  17. The properties degradation of exposed GFRP roof (United States)

    Zainudin, Mohammad; Diharjo, Kuncoro; Kaavessina, Mujtahid; Setyanto, Djoko


    There is much consideration of roof selection as a protector of a building against the outside weather, such as lightweight, strong stiff, corrosion resistant and guarantee for the availability of products. Based on these considerations, glass fiber reinforced polymer (GFRP) roof is a roof which can fulfill the requirement. The objective of this research is to investigate the degradation of physical and mechanical properties of GFRP roof exposed in outside weather. This GFRP roof composite was produced using a sheet molding compound (SMC) supplied by PT Intec Persada, Tangerang, Indonesia. There are two kinds GFRP roofs evaluated in this research that are GFRP roof exposed within 7 years and new GFRP roof that has not been exposed. The GFRP roofs were cut manually for preparing the specimens for hardness test, tensile test, SEM and FTIR test. The results show that the GFRP roof exposed within 7 years had the degradation of properties compared to the new GFRP roof. The exposed GFRP roof had lower strength and hardness compared to the new GFRP roof. The SEM observation indicates that exposed GFRP roof had the debonding of fiber on the surface, and in contrast, there are no debonding of fiber in the new GFRP roof surface. It can be recommended that the exposed GFRP roof may be repaired to enhance its performance and can re-increase its properties using the coating.

  18. Disposal of tritium-exposed metal hydrides

    International Nuclear Information System (INIS)

    Nobile, A.; Motyka, T.


    A plan has been established for disposal of tritium-exposed metal hydrides used in Savannah River Site (SRS) tritium production or Materials Test Facility (MTF) R ampersand D operations. The recommended plan assumes that the first tritium-exposed metal hydrides will be disposed of after startup of the Solid Waste Disposal Facility (SWDF) Expansion Project in 1992, and thus the plan is consistent with the new disposal requiremkents that will be in effect for the SWDF Expansion Project. Process beds containing tritium-exposed metal hydride powder will be disposed of without removal of the powder from the bed; however, disposal of tritium-exposed metal hydride powder that has been removed from its process vessel is also addressed

  19. Exposing Latent Information in Folksonomies for Reasoning (United States)


    1.73 $.") SKOS /reference/20081001/ Spiteri, L.F. (2007) "The structure and form of folksonomy tags: The road to the...Exposing Latent Information in Folksonomies for Reasoning January 14, 2010 Sponsored by Defense Advanced Research Projects Agency (DOD...DATES COVERED (From - To! 4/14/2009-12/23/2009 4. TITLE AND SUBTITLE Exposing Latent Information in Folksonomies for Reasoning Sa. CONTRACT

  20. Protein (Viridiplantae): 308803454 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  1. Genetic Alterations in Pesticide Exposed Bolivian Farmers

    DEFF Research Database (Denmark)

    Jørs, Erik; González, Ana Rosa; Ascarrunz, Maria Eugenia


    : Questionnaires were applied and blood tests taken from 81 volunteers from La Paz County, of whom 48 were pesticide exposed farmers and 33 non-exposed controls. Sixty males and 21 females participated with a mean age of 37.3 years (range 17-76). Data of exposure and possible genetic damage were collected...... and evaluated by well known statistical methods, controlling for relevant confounders. To measure genetic damage chromosomal aberrations and the comet assay analysis were performed. Results: Pesticide exposed farmers had a higher degree of genetic damage compared to the control group. The number of chromosomal......, probably related to exposure to pesticides. Due to the potentially negative long term health effects of genetic damage on reproduction and the development of cancer, preventive measures are recommended. Effective control with imports and sales, banning of the most toxic pesticides, education...

  2. Proximally exposed A-bomb survivors. 2

    International Nuclear Information System (INIS)

    Kamada, Nanao


    Methods for observing chromosomes can be chronologically divided into the era of non-differential staining technique (1962-1975) and the era of differential staining method (since 1976). This paper reviews the literature of chromosomal aberrations in bone marrow cells found in the two eras. Findings during the era of 1962-1975 include the frequency of chromosomal aberrations in bone marrow cells, comparison of chromosomal aberrations in bone marrow cells and T lymphocytes, and annual variation of chromosomal aberrations. The frequency of chromosomal aberrations was high in proximally exposed A-bomb survivors (90.5% and 52.6% in A-bomb survivors exposed within 500 m and at 501-1,000 m, respectively); on the contrary, it was low in those exposed far from 1,000 m (6.2% or less). The frequency of chromosomal aberrations in bone marrow cells was lower than that in T lymphocytes (21.5% vs 27.1% in those exposed within 500 m and 14.1% vs 23% in those exposed at 501-1,000 m). Annual analysis for chromosomal aberrations has shown the somewhat dependence upon medullary hematopoiesis and virus infection. The advent of differential staining technique since 1976 has made it possible to clarify the type of chromosomal aberrations and site of breakage. Of 710 bone marrow cells taken from 13 A-bomb survivors exposed within 1,000 m, 121 cells (from 11 A-bomb survivors) exhibited chromosomal aberrations. In differential staining analysis, all 121 cells but one were found to be of stable type, such as translocation and inversion. Furthermore, the site of breakage was found to be non-randomly distributed. Analysis of chromosomal aberrations in bone marrow cells has advantages of reflecting dynamic condition of these cells and determining gradual progression into leukemia. (N.K.)

  3. Exposing the Mathematical Wizard: Approximating Trigonometric Functions (United States)

    Gordon, Sheldon P.


    For almost all students, what happens when they push buttons on their calculators is essentially magic, and the techniques used are seemingly pure wizardry. In this article, the author draws back the curtain to expose some of the mathematics behind computational wizardry and introduces some fundamental ideas that are accessible to precalculus…

  4. Exposing Library Services with AngularJS


    Jakob Voß; Moritz Horn


    This article provides an introduction to the JavaScript framework AngularJS and specific AngularJS modules for accessing library services. It shows how information such as search suggestions, additional links, and availability can be embedded in any website. The ease of reuse may encourage more libraries to expose their services via standard APIs to allow usage in different contexts.

  5. Expose Mechanical Engineering Students to Biomechanics Topics (United States)

    Shen, Hui


    To adapt the focus of engineering education to emerging new industries and technologies nationwide and in the local area, a biomechanics module has been developed and incorporated into a mechanical engineering technical elective course to expose mechanical engineering students at ONU (Ohio Northern University) to the biomedical engineering topics.…

  6. Stabilizer for seismically exposed bridge cranes

    International Nuclear Information System (INIS)

    Engelke, M.; Kuhr, H.


    The invention concerns a stabilizer for seismically exposed bridge cranes in reactor buildings. The trolley and the crane bridge are fitted with the stabilizer consisting of a bipartite safety catch which is connected with a joint and able to take up the vertical loads during an earthquake. This stabilizer is suitable for all kinds of bridge cranes operated in seismically active regions

  7. Dose coefficients for individual occupationally exposed

    International Nuclear Information System (INIS)


    This Regulation refers to the requirements of the Regulation CNEN-NN.3.01, 'Basic Act of Radiological Protection', aiming its application to the dose calculation, with purposes of conformity verification with limits and restrictions of doses and level of reference for individual occupationally exposed, according to the express in its section 5

  8. Fibrosis biomarkers in workers exposed to MWCNTs

    International Nuclear Information System (INIS)

    Fatkhutdinova, Liliya M.; Khaliullin, Timur O.; Vasil'yeva, Olga L.; Zalyalov, Ramil R.; Mustafin, Ilshat G.; Kisin, Elena R.; Birch, M. Eileen; Yanamala, Naveena; Shvedova, Anna A.


    Multi-walled carbon nanotubes (MWCNT) with their unique physico-chemical properties offer numerous technological advantages and are projected to drive the next generation of manufacturing growth. As MWCNT have already found utility in different industries including construction, engineering, energy production, space exploration and biomedicine, large quantities of MWCNT may reach the environment and inadvertently lead to human exposure. This necessitates the urgent assessment of their potential health effects in humans. The current study was carried out at NanotechCenter Ltd. Enterprise (Tambov, Russia) where large-scale manufacturing of MWCNT along with relatively high occupational exposure levels was reported. The goal of this small cross-sectional study was to evaluate potential biomarkers during occupational exposure to MWCNT. All air samples were collected at the workplaces from both specific areas and personal breathing zones using filter-based devices to quantitate elemental carbon and perform particle analysis by TEM. Biological fluids of nasal lavage, induced sputum and blood serum were obtained from MWCNT-exposed and non-exposed workers for assessment of inflammatory and fibrotic markers. It was found that exposure to MWCNTs caused significant increase in IL-1β, IL6, TNF-α, inflammatory cytokines and KL-6, a serological biomarker for interstitial lung disease in collected sputum samples. Moreover, the level of TGF-β1 was increased in serum obtained from young exposed workers. Overall, the results from this study revealed accumulation of inflammatory and fibrotic biomarkers in biofluids of workers manufacturing MWCNTs. Therefore, the biomarkers analyzed should be considered for the assessment of health effects of occupational exposure to MWCNT in cross-sectional epidemiological studies. - Highlights: • The effects of MWCNT exposure in humans remain unclear. • We found increased KL-6/TGF-β levels in the biofluids of MWCNT-exposed workers.

  9. Fibrosis biomarkers in workers exposed to MWCNTs

    Energy Technology Data Exchange (ETDEWEB)

    Fatkhutdinova, Liliya M., E-mail: [Kazan State Medical University, ul. Butlerova 49, Kazan 420012 (Russian Federation); Khaliullin, Timur O., E-mail: [Kazan State Medical University, ul. Butlerova 49, Kazan 420012 (Russian Federation); Department of Physiology & Pharmacology, WVU, Morgantown, WV (United States); Vasil' yeva, Olga L., E-mail: [Kazan State Medical University, ul. Butlerova 49, Kazan 420012 (Russian Federation); Zalyalov, Ramil R., E-mail: [Kazan State Medical University, ul. Butlerova 49, Kazan 420012 (Russian Federation); Mustafin, Ilshat G., E-mail: [Kazan State Medical University, ul. Butlerova 49, Kazan 420012 (Russian Federation); Kisin, Elena R., E-mail: [National Institute for Occupational Safety and Health, Morgantown, WV (United States); Birch, M. Eileen, E-mail: [National Institute for Occupational Safety and Health, Cincinnati, OH (United States); Yanamala, Naveena, E-mail: [National Institute for Occupational Safety and Health, Morgantown, WV (United States); Shvedova, Anna A., E-mail: [National Institute for Occupational Safety and Health, Morgantown, WV (United States); Department of Physiology & Pharmacology, WVU, Morgantown, WV (United States)


    Multi-walled carbon nanotubes (MWCNT) with their unique physico-chemical properties offer numerous technological advantages and are projected to drive the next generation of manufacturing growth. As MWCNT have already found utility in different industries including construction, engineering, energy production, space exploration and biomedicine, large quantities of MWCNT may reach the environment and inadvertently lead to human exposure. This necessitates the urgent assessment of their potential health effects in humans. The current study was carried out at NanotechCenter Ltd. Enterprise (Tambov, Russia) where large-scale manufacturing of MWCNT along with relatively high occupational exposure levels was reported. The goal of this small cross-sectional study was to evaluate potential biomarkers during occupational exposure to MWCNT. All air samples were collected at the workplaces from both specific areas and personal breathing zones using filter-based devices to quantitate elemental carbon and perform particle analysis by TEM. Biological fluids of nasal lavage, induced sputum and blood serum were obtained from MWCNT-exposed and non-exposed workers for assessment of inflammatory and fibrotic markers. It was found that exposure to MWCNTs caused significant increase in IL-1β, IL6, TNF-α, inflammatory cytokines and KL-6, a serological biomarker for interstitial lung disease in collected sputum samples. Moreover, the level of TGF-β1 was increased in serum obtained from young exposed workers. Overall, the results from this study revealed accumulation of inflammatory and fibrotic biomarkers in biofluids of workers manufacturing MWCNTs. Therefore, the biomarkers analyzed should be considered for the assessment of health effects of occupational exposure to MWCNT in cross-sectional epidemiological studies. - Highlights: • The effects of MWCNT exposure in humans remain unclear. • We found increased KL-6/TGF-β levels in the biofluids of MWCNT-exposed workers.

  10. Stability of people exposed to water flows

    Directory of Open Access Journals (Sweden)

    E. Martínez-Gomariz


    Full Text Available Our cities are formed by several elements which are exposed to floods of a magnitude according to the importance of the rainfall event and the design of the urban drainage system. The most important components in the cities are the pedestrians who develop various activities during rain events. Focusing on pedestrians, the research on their stability when they are exposed to water flows provides the necessary knowledge to understand and manage the associated hazard for them. In this research, several experiments with humans were carried out in order to determine the stability limits to pedestrians crossing through a water flow in a real scale platform. The results obtained and by comparing those with human stability criteria proposed by other authors and guidelines provide a more restrictive criterion.

  11. Children exposed to war/terrorism. (United States)

    Shaw, Jon A


    This paper reviews the prevalence of psychological morbidities in children who have been exposed to war-related traumas or terrorism as well as the diversity of war-related casualties and their associated psychological responses. The psychological responses to war-related stressors are categorized as (1) little or no reaction, (2) acute emotional and behavioral effects, and (3) long-term effects. Specific categories of war-related casualties discussed include refugee status, traumatic bereavement, effects of parental absence, and child soldiers. Psychological responses associated with terrorism and bioterrorism are presented. Lastly, mediators of the psychological response to war-related stressors are discussed, to include exposure effects, gender effects, parental, family and social factors, and child-specific factors. Children exposed to war-related stressors experience a spectrum of psychological morbidities including posttraumatic stress symptomatology, mood disorders, externalizing and disruptive behaviors, and somatic symptoms determined by exposure dose effect. Specific questions for future research are identified.

  12. Studies on persons exposed to plutonium

    International Nuclear Information System (INIS)

    Voelz, G.L.; Stebbings, J.H.; Hempelmann, L.H.; Haxton, L.K.; York, D.A.


    The results of four studies of persons exposed, or potentially exposed, to plutonium are summarized. The studies are: a five-year update on clinical examinations and health experience of 26 Manhattan District workers heavily exposed at Los Alamos in 1944 to 1945; a 30-year mortality follow-up of 224 white male workers with plutonium body burdens of 10 nCi or more; a review of cancer mortality rates between 1950 and 1969 among Los Alamos County, New Mexico, male residents, all of whom have worked in or have lived within a few kilometers of a major plutonium plant and other nuclear facilities; and a review of cancer incidence rates between 1969 and 1974 in male residents of Los Alamos County. No excess of mortality due to any cause was observed in the 224 male subjects with the highest plutonium exposures at Los Alamos. Clinical examinations of the Manhattan District workers, whose average age in 1976 was 56 years, show them to be active persons with diseases that are not unusual for their ages. The two deaths in this group over the past 30 years have not been due to cancer. Mortality and incidence data indicate no excess of lung cancer in Los Alamos County males

  13. EXPOSE-R2: The Astrobiological ESA Mission on Board of the International Space Station

    Directory of Open Access Journals (Sweden)

    Elke Rabbow


    Full Text Available On July 23, 2014, the Progress cargo spacecraft 56P was launched from Baikonur to the International Space Station (ISS, carrying EXPOSE-R2, the third ESA (European Space Agency EXPOSE facility, the second EXPOSE on the outside platform of the Russian Zvezda module, with four international astrobiological experiments into space. More than 600 biological samples of archaea, bacteria (as biofilms and in planktonic form, lichens, fungi, plant seeds, triops eggs, mosses and 150 samples of organic compounds were exposed to the harsh space environment and to parameters similar to those on the Mars surface. Radiation dosimeters distributed over the whole facility complemented the scientific payload. Three extravehicular activities later the chemical samples were returned to Earth on March 2, 2016, with Soyuz 44S, having spent 588 days in space. The biological samples arrived back later, on June 18, 2016, with 45S, after a total duration in space of 531 days. The exposure of the samples to Low Earth Orbit vacuum lasted for 531 days and was divided in two parts: protected against solar irradiation during the first 62 days, followed by exposure to solar radiation during the subsequent 469 days. In parallel to the space mission, a Mission Ground Reference (MGR experiment with a flight identical Hardware and a complete flight identical set of samples was performed at the premises of DLR (German Aerospace Center in Cologne by MUSC (Microgravity User Support Center, according to the mission data either downloaded from the ISS (temperature data, facility status, inner pressure status or provided by RedShift Design and Engineering BVBA, Belgium (calculated ultra violet radiation fluence data. In this paper, the EXPOSE-R2 facility, the experimental samples, mission parameters, environmental parameters, and the overall mission and MGR sequences are described, building the background for the research papers of the individual experiments, their analysis and results.

  14. Towards harmonized qualifications for radiation exposed personnel

    International Nuclear Information System (INIS)

    Briso, Hugo A.


    The accelerated process of globalization affecting mankind doesn't exclude safety matters. Indeed, some trans national corporations are increasingly offering specialized engineering services such as industrial radiography or well lodging. As well, a growing scientific exchange involves the mobility of nuclear researchers in different areas, for instance radiochemistry, nuclear medicine and radiotherapy. Such a breakdown in the technological frontiers must necessarily be reflected by the regulatory solutions. Particularly, diverse levels of theoretical-practical training for radiation exposed personnel coexist in the Latin-American Region, being an especially sensitive problem for radiation protection matters. The spectrum goes from post-graduate courses required for radiation protection officers in some countries, while in others only basic recommendations are required for the operating personnel. Another scheme consists of medium level course for the operating personnel, while radiation protection officers don't have special requirements. Many educational private institutions teach non standardized courses which only give broad concepts of radiation protection. On the other hand, usually nothing is said about the operational training, or else its certification is entrusted to the employer itself. In some countries multiple Regulatory Authorities apply dissimilar criteria to assess safety matters, including the evaluation of workers applications. The necessary regional integration makes indispensable to establish common standards for granting authorizations. Having similar or homogeneous requirements for the universe of radiation exposed personnel, i.e. source operators, radiation protection officers, qualified experts and technical support people would be easier for the Regulatory Authorities to have common methodologies of evaluation for the applicants. An IAEA supported technical cooperation project related to this paper seeks to establish standardized

  15. Lymphocytic subsets in occupationally exposed persons

    International Nuclear Information System (INIS)

    Tuschl, H.; Kovac, R.; Wottawa, A.


    The percentage of CD2, CD4, CD8 and NK cells of peripheral blood was investigated in persons occupationally exposed to very low doses of ionizing radiation. Investigations were carried out by monoclonal antibodies and flow-cytometry. While significant effects of age and smoking habits on the relative number of CD8 cells and CD4/CD8 ratios could be established, no influence of the very low radiation exposure on the profile of lymphocytic cells in blood was found, except a very slight effect on the relative number of total T cells (= CD2 cells). 7tabs., 2figs., 16refs. (Author)

  16. Renographic curve of persons exposed to mercury

    International Nuclear Information System (INIS)

    Kolenic, J.; Jurgova, T.; Zimacek, J.; Petrovicova, J.; Bilicky, J.


    In the group of 72 workers which were exposed to fumes of metallic mercury we evaluated possible nephrotoxic effect of Hg 0 . We also used nuclear renography for evaluation of kidney. Nephrotoxic effect of Hg 0 was proved by increased proteinuria and relatively frequent findings of pathological renogram. In the group with pathological renogram, elimination of Hg 0 in urine (1822.8 -3 ) was increased. In the group with normal finding the value was 883.7 -3 . These findings pointed at toxic effect of Hg 0 on kidney and suitability of radionuclide examination for disclosing of subclinical pathological changes. (authors)

  17. Spoiled Onions: Exposing Malicious Tor Exit Relays


    Winter, Philipp; Lindskog, Stefan


    Several hundred Tor exit relays together push more than 1 GiB/s of network traffic. However, it is easy for exit relays to snoop and tamper with anonymised network traffic and as all relays are run by independent volunteers, not all of them are innocuous. In this paper, we seek to expose malicious exit relays and document their actions. First, we monitored the Tor network after developing a fast and modular exit relay scanner. We implemented several scanning modules for detecting common attac...

  18. Uniform Protection for Multi-exposed Targets

    DEFF Research Database (Denmark)

    Vigo, Roberto; Nielson, Flemming; Nielson, Hanne Riis


    the Quality Calculus that computes the combinations of data required to reach a program point and relates them to a notion of cost. In this way, we can compare the security deployed on different paths that expose the same resource. The analysis is formalised in terms of flow logic, and is implemented......Ensuring that information is protected proportionately to its value is a major challenge in the development of robust distributed systems, where code complexity and technological constraints might allow reaching a key functionality along various paths. We propose a protection analysis over...

  19. Backfilling of trenches exposed to waves

    DEFF Research Database (Denmark)

    Hjelmager Jensen, Jacob; Fredsøe, Jørgen


    This paper treats the numerical prediction of initial and long-term morphology of small pipeline trenches. For this purpose a refined flow and sediment transport description is applied such that the entire mathematical problem is formulated and solved on a curvilinear grid using a k - ε turbulence......-closure. The backfilling process of trenches exposed to either waves or a steady current is of importance in relation to the implementation of pipelines in the marine environment. With respect to the sedimentation of trenches, the non-dimensional Trench-Keulegan-Carpenter number, KC = a/L, where a is the excursion length...

  20. Analyses of Concrete Structures Exposed to Fire

    DEFF Research Database (Denmark)

    Hertz, Kristian

    The text book contains the data and methods necessary for fire safety design of concrete constructions. The methods relate to standard fire as well as to any time of any other fire course.Material data are presented for concretes exposed to fire, and calculation methods are given for the ultimate...... bending capacity of beams and slabs, the ultimate shear capacity of beams, for the instability of columns and walls and for the deflection of prestressed and non-prestressed beams, slabs, walls and columns.All methods have been derived and compared to tests by Kristian Hertz....

  1. Occupational health care of radiation exposed workers

    International Nuclear Information System (INIS)

    Abdul Rahim Rahman Hamzah


    The medical problems encountered by the earlier pioneer workers in radiation at the turn of the century are well known. In the 1928, the ICRP (International Committee for Radiological Protection) was instituted and the ALARA principle of radiation protection was evolved. Occupational health care is about maintaining the health and safety of workers in their workplaces. This involves using medical, nursing and engineering practices to achieve its objectives. In certain occupations, including those where workers are exposed to ionising radiation, some of these principles are enshrined in the legislation and would require statutory compliance. Occupational health care of radiation workers seek to prevent ill health arising from exposure to radiation by consolidating the benefits of exposures control and dosimetry. This is via health surveillance for spillages, contamination and exposures to unsealed sources of radiation. It is unlikely that can plan and hope to cater for a Chernobyl type of disaster. However, for the multitude of workers in industry exposed to radiation, control models are available. These are from the more in industrialize countries with a nuclear based energy industry, and where radioactive gadgetry are used in places ranging from factories and farms to construction sites. These models involve statutory requirements on the standard of work practices, assessment of fitness to work and the monitoring of both the worker and the workplace. A similar framework of activity is present in Malaysia. This will be further enhanced with the development of her general health and safety at work legislation. (author)

  2. Protection of man: the exposed individual

    Energy Technology Data Exchange (ETDEWEB)

    Bohnstedt, A.; Knebel, J.U. [Programme Nuclear Safety Research, Karlsruhe Institute of Technology, Herrmann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Breustedt, B. [Institute for Radiation Research, Karlsruhe Institute of Technology, Herrmann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany)


    Present methods for quantifying radiation exposure rely on a standardized reference man (75 kg) with defined average anatomical and physiological data. But individual person actually exposed differs from this idealized standard man. Therefore the focus of investigations at the Institute for Radiation Research (Institut fuer Strahlenforschung, ISF) which was founded at Karlsruhe Institute of Technology (Karlsruher Institut fuer Technologie, KIT) in 2009 is based on the vision to place the exposed individual with its anatomical and physiological particularities, under consideration of age, gender, body height, body shape and environment, in the centre of an individual-related quantification of the external and internal radiation exposure. Research work at the ISF is aiming at quantifying radiation exposure by improved determination of doses essentially caused by external radiation fields and the intake of radionuclides into the body. The three main topics of the institute are - external dosimetry (e.g. using a (voxel) model of the hand to simulate skin dose distribution); - internal dosimetry (e.g. body size related efficiency calibration of in-vivo counting equipment); - numerical methods/modeling (e.g. development of a mathematical/voxel-hybrid model of the human body). (authors)

  3. Zirconium ignition in exposed fuel channel

    Energy Technology Data Exchange (ETDEWEB)

    Elias, E., E-mail:; Hasan, D.; Nekhamkin, Y.


    Highlights: • We demonstrate the idea of runaway zirconium–steam reactions in severe accidents in today's LWRs. • We predict the thermal-hydraulics conditions relevant to cladding oxidation in an exposed fuel channel of a partially uncovered core. • The Semenov theory of metal combustion is extended to define a criterion for runaway oxidation reaction in fuel cladding. - Abstract: A theoretical model based on simultaneous solution of the heat and mass transfer equations is developed for predicting the rate of thermo-chemical reaction between zirconium cladding and a hot steam environment. Ignition conditions relevant to cladding oxidation in an exposed fuel channel of a partially uncovered core are predicted based on the theory of metal combustion. A range of decay power, convective heat transfer coefficients, and initial temperatures leading to uncontrolled runaway cladding oxidation is identified. The model could be readily integrated as part of a fuel channel analysis code for predicting possible outcomes of different accident mitigation procedures in light water nuclear reactors under LOCA conditions.

  4. To be a worker (exposed?) or not to be a worker (exposed?) that is the question

    International Nuclear Information System (INIS)

    Ammerich, M.


    The notion of personnel is detailed in this article in order to know exactly what personnel is considered as exposed and what radiation doses are under this term. The regulatory texts are studied in different articles of the French law and show that different kind of exposed personnel are considered. The definitions are varying with the notion of risk, of radiation doses and the work itself. This article asks for a better and more precise definition that will help the actors of radiation protection. (N.C.)

  5. Brain damage among the prenatally exposed

    International Nuclear Information System (INIS)

    Otake, Masanori; Schull, W.J.; Yoshimaru, Hiroshi.


    Significant effects on the developing brain of exposure to ionizing radiation are seen among those individuals exposed in the 8th through the 25th week after fertilization. These effects, particularly in the most sensitive period, 8-15 weeks after fertilization, manifest themselves as an increased frequency of severe mental retardation (SMR), a diminution in IQ score and in school performance, and an increase in the occurrence of seizures. Of 30 SMR cases, 18 (60%) had small heads. About 10% of the individuals with small head sizes observed among the in utero clinical sample were mentally retarded. When all of the cases of mental retardation are included in the analysis, a linear dose-response model fits the data adequately and no evidence of a threshold emerges; however, if the two probable nonradiation-related cases of Down's syndrome are excluded from the 19 SMR cases exposed 8-15 weeks after fertilization, the evidence of a threshold is stronger. The 95% lower bound of the threshold based on the new dosimetry system appears to be in the range of 0.12-0.23 Gy. In the 16-25 week period, the 95% lower bound of the threshold is 0.21 Gy both with and without inclusion of two probable nonradiation-related retarded cases. In a regression analysis of IQ scores and school performance data, a greater linearity is suggested with the new dosimetry (DS86) than with the old (T65DR), but the mean IQ score and the mean school performance of those exposed in utero to doses under 0.10 Gy are similar, and not statistically different from the means in the control group. The risk ratios for unprovoked seizures, following exposure during the 8th through the 15th week after fertilization, are 4.4 (90% confidence interval: 0.5-40.9) after 0.10-0.49 Gy and 24.9 (4.1-191.6) after 0.50 Gy or more when the mentally retarded are included and 4.4 (0.5-40.9) and 14.5 (0.4-199.6), respectively, when they are excluded. (author)

  6. Immune Response among Patients Exposed to Molds

    Directory of Open Access Journals (Sweden)

    Jordan N. Fink


    Full Text Available Macrocyclic trichothecenes, mycotoxins produced by Stachybotrys chartarum, have been implicated in adverse reactions in individuals exposed to mold-contaminated environments. Cellular and humoral immune responses and the presence of trichothecenes were evaluated in patients with mold-related health complaints. Patients underwent history, physical examination, skin prick/puncture tests with mold extracts, immunological evaluations and their sera were analyzed for trichothecenes. T-cell proliferation, macrocyclic trichothecenes, and mold specific IgG and IgA levels were not significantly different than controls; however 70% of the patients had positive skin tests to molds. Thus, IgE mediated or other non-immune mechanisms could be the cause of their symptoms.

  7. Reactivity of lithium exposed graphite surface

    International Nuclear Information System (INIS)

    Harilal, S.S.; Allain, J.P.; Hassanein, A.; Hendricks, M.R.; Nieto-Perez, M.


    Lithium as a plasma-facing component has many attractive features in fusion devices. We investigated chemical properties of the lithiated graphite surfaces during deposition using X-ray photoelectron spectroscopy and low-energy ion scattering spectroscopy. In this study we try to address some of the known issues during lithium deposition, viz., the chemical state of lithium on graphite substrate, oxide layer formation mechanisms, Li passivation effects over time, and chemical change during exposure of the sample to ambient air. X-ray photoelectron studies indicate changes in the chemical composition with various thickness of lithium on graphite during deposition. An oxide layer formation is noticed during lithium deposition even though all the experiments were performed in ultrahigh vacuum. The metal oxide is immediately transformed into carbonate when the deposited sample is exposed to air.

  8. Lifetime assessment of service-exposed components

    International Nuclear Information System (INIS)

    Kalwa, G.; Weber, H.


    A longtime prognosis on the operation of creep-exposed components requires a lifetime analysis. The basis for such an analysis can be improved by an analysis of microstructure and material properties. Actually the grade of material exhaustion has to be regarded as proper assessment quantity. However, stress and time safety also are valuable assessment quantities which should be taken into consideration, especially when the grade of exhaustion is uncertain because of inaccurate input parameters. A correct assessment of the damage state cannot be made without taking into consideration the failure mechanism which has to be assumed for a specific component. With respect to creep the most critical component of a steamline system is the pipe bend because of the risk of large damage events. For this case component metallography by replicas is suggested as preventive test method. The continuation of service of a creep damage pipe bend cannot be recommended. (orig./MM) [de

  9. Water infiltration into exposed fractured rock surfaces

    International Nuclear Information System (INIS)

    Rasmussen, T.C.; Evans, D.D.


    Fractured rock media are present at many existing and potential waste disposal sites, yet characterization data and physical relationships are not well developed for such media. This study focused on water infiltration characteristics of an exposed fractured rock as an approach for defining the upper boundary condition for unsaturated-zone water percolation and contaminant transport modeling. Two adjacent watersheds of 0.24 and 1.73 ha with slopes up to 45% were instrumented for measuring rainfall and runoff. Fracture density was measured from readily observable fracture traces on the surface. Three methods were employed to evaluate the rainfall-runoff relationship. The first method used the annual totals and indicated that only 22.5% of rainfall occurred as runoff for the 1990-1991 water year, which demonstrates a high water intake rate by the exposed fracture system. The second method employed total rainfall and runoff for individual storms in conjunction with the commonly used USDA Soil Conservation Service curve number method developed for wide ranges of soils and vegetation. Curve numbers between 75 and 85 were observed for summer and winter storms with dry antecedent runoff conditions, while values exceeded 90 for wet conditions. The third method used a mass-balance approach for four major storms, which indicated that water intake rates ranged from 2.0 to 7.3 mm h -1 , yielding fracture intake velocities ranging from 122 to 293 m h -1 . The three analyses show the complexity of the infiltration process for fractured rock. However, they contribute to a better understanding of the upper boundary condition for predicting contaminant transport through an unsaturated fractured rock medium. 17 refs., 4 figs., 1 tab

  10. Exposing the Myths, Defining the Future

    International Nuclear Information System (INIS)

    Slavov, S.


    With this official statement, the WEC calls for policymakers and industry leaders to ''get real'' as the World Energy Council as a global energy body exposes the myths by informing the energy debate and defines a path to a more sustainable energy future. The World Energy Council urged stakeholders to take urgent and incisive actions, to develop and transform the global energy system. Failure to do so could put aspirations on the triple challenge of WEC Energy Trilemma defined by affordability, accessibility and environmental sustainability at serious risk. Through its multi-year in-depth global studies and issue-mapping the WEC has found that challenges that energy sector is facing today are much more crucial than previously envisaged. The WEC's analysis has exposed a number of myths which influence our understanding of important aspects of the global energy landscape. If not challenged, these misconceptions will lead us down a path of complacency and missed opportunities. Much has, and still is, being done to secure energy future, but the WEC' s studies reveal that current pathways fall short of delivering on global aspirations of energy access, energy security and environmental improvements. If we are to derive the full economic and social benefits from energy resources, then we must take incisive and urgent action to modify our steps to energy solutions. The usual business approaches are not effective, the business as usual is not longer a solution. The focus has moved from large universal solutions to an appreciation of regional and national contexts and sharply differentiated consumer expectations.(author)

  11. Clinical investigation of proximate exposed group, 1

    International Nuclear Information System (INIS)

    Ito, Chikako; Hasegawa, Kazuyo; Kato, Masafumi; Kumasawa, Toshihiko


    In order to investigate effects of the A-bombing on prevalence of diabetes mellitus, follow-up studies were made on 5907 A-bomb survivors who received glucose tolerance test (GTT) during 20 years between 1963 and 1983. The A-bomb survivors were divided into the group A (1899 men and 1165 women exposed within 1.9 km from the hypocenter) and the group B (1725 men and 1118 women exposed 3.0 km or farther from it). Among non-obese survivors, 21.9% and 21.8% were being treated for diabetes mellitus or were evaluated as having diabetic type on GTT in the group A and the group B, respectively; while this was seen in 52.1% of obese survivors in the group A and 49.9% in the group B. There was no difference between the groups. In non-obese survivors, the annual development rate from the normal type to the diabetic type was 0.89% in the group A and 0.65% in the group B; the annual development rate from the borderline type to the diabetic type was 5.73% in the group A and 5.49% in the group B, showing no differences between the groups. The annual development rate from the normal or borderline type to the diabetic type was two times or higher in obese survivors than in non-obese survivors irrespective of exposure status. Regarding the number of diabetic survivors who became non-diabetic type in spite of having no treatment, and prevalence of diabetic complications, no difference was seen between the groups. These results suggest that the A-bombing has scarcely influenced the prevalence of diabetes mellitus and clinical course. (Namekawa, K.)

  12. 9 CFR 78.8 - Brucellosis exposed cattle. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucellosis exposed cattle. 78.8... Restrictions on Interstate Movement of Cattle Because of Brucellosis § 78.8 Brucellosis exposed cattle. Brucellosis exposed cattle may be moved interstate only as follows: (a) Movement to recognized slaughtering...

  13. Biological monitoring results for cadmium exposed workers. (United States)

    McDiarmid, M A; Freeman, C S; Grossman, E A; Martonik, J


    As part of a settlement agreement with the Occupational Safety and Health Administration (OSHA) involving exposure to cadmium (Cd), a battery production facility provided medical surveillance data to OSHA for review. Measurements of cadmium in blood, cadmium in urine, and beta 2-microglobulin in urine were obtained for more than 100 workers over an 18-month period. Some airborne Cd exposure data were also made available. Two subpopulations of this cohort were of primary interest in evaluating compliance with the medical surveillance provisions of the Cadmium Standard. These were a group of 16 workers medically removed from cadmium exposure due to elevations in some biological parameter, and a group of platemakers. Platemaking had presented a particularly high exposure opportunity and had recently undergone engineering interventions to minimize exposure. The effect on three biological monitoring parameters of medical removal protection in the first group and engineering controls in platemakers is reported. Results reveal that both medical removal from cadmium exposures and exposure abatement through the use of engineering and work practice controls generally result in declines in biological monitoring parameters of exposed workers. Implications for the success of interventions are discussed.

  14. Behavioral changes in fish exposed to phytoestrogens

    International Nuclear Information System (INIS)

    Clotfelter, Ethan D.; Rodriguez, Alison C.


    We investigated the behavioral effects of exposure to waterborne phytoestrogens in male fighting fish, Betta splendens. Adult fish were exposed to a range of concentrations of genistein, equol, β-sitosterol, and the positive control 17β-estradiol. The following behaviors were measured: spontaneous swimming activity, latency to respond to a perceived intruder (mirror reflection), intensity of aggressive response toward a perceived intruder, probability of constructing a nest in the presence of a female, and the size of the nest constructed. We found few changes in spontaneous swimming activity, the latency to respond to the mirror, and nest size, and modest changes in the probability of constructing a nest. There were significant decreases, however, in the intensity of aggressive behavior toward the mirror following exposure to several concentrations, including environmentally relevant ones, of 17β-estradiol, genistein, and equol. This suggests that phytoestrogen contamination has the potential to significantly affect the behavior of free-living fishes. - Environmentally relevant concentrations of phytoestrogens reduce aggressive behavior in fish

  15. Exposing the “One China” Principle

    Directory of Open Access Journals (Sweden)

    Chien-yuan Tseng


    Full Text Available In 1992, when the governments from both sides across the Taiwan Strait began having contacts, both of them, at the People’s Republic of China (PRC’s request, expressed verbally, and in relation to functional issues, that they advocated the “one China” principle, though what “one China” actually meant was open to different interpretations, and the shift that elevated the 1992 “one China” interpretations from the functional level to the political level did not occur until April 2005. Since President Tsai Ing-wen was sworn in and the Democratic Progressive Party (DPP became the ruling party of the Republic of China (ROC on Taiwan in early 2016, the PRC has used Tsai’s rejection of this so-called “1992 consensus” as a pretext to discontinue all intergovernmental communication channels with the ROC on Taiwan, while also cutting down on cross-strait civil exchanges in travel and education. This thinkpiece article aims to scrutinise this “one China” principle, how it has developed over the years, and expose its underlying realities.

  16. Degradation of HEPA filters exposed to DMSO

    International Nuclear Information System (INIS)

    Bergman, W.; Wilson, K.; Larsen, G.; Lopez, R.; LeMay, J.


    Dimethyl sulfoxide (DMSO) sprays are being used to remove the high explosive (HE) from nuclear weapons in the process of their dismantlement. A boxed 50 cfm HEPA filter with an integral prefilter was exposed to DMSO vapor and aerosols that were generated by a spray nozzle to simulate conditions expected in the HE dissolution operation. After 198 hours of operation, the pressure drop of the filter had increased from 1.15 inches to 2.85 inches, and the efficiency for 0.3 μm dioctyl sebacate (DOS) aerosols decreased from 99.992% to 98.6%. Most of the DMSO aerosols had collected as a liquid pool inside the boxed HEPA. The liquid was blown out of the filter exit with 100 cfm air flow at the end of the test. Since the filter still met the minimum allowed efficiency of 99.97% after 166 hours of exposure, we recommend replacing the filter every 160 hours of operation or sooner if the pressure drop increases by 50%. Examination of the filter showed that visible cracks appeared at the joints of the wooden frame and a portion of the sealant had pulled away from the frame. Since all of the DMSO will be trapped in the first HEPA filter, the second HEPA filter should not suffer from DMSO degradation. Thus the combined efficiency for the first filter (98.6%) and the second filter (99.97%) is 99.99996% for 0.3μm particles. If the first filter is replaced prior to its degradation, each of the filters will have 99.97% efficiency, and the combined efficiency will be 99.999991%. The collection efficiency for DMSO/HE aerosols will be much higher because the particle size is much greater

  17. Degradation of HEPA filters exposed to DMSO

    Energy Technology Data Exchange (ETDEWEB)

    Bergman, W.; Wilson, K.; Larsen, G. [Lawrence Livermore National Laboratory, CA (United States)] [and others


    Dimethyl sulfoxide (DMSO) sprays are being used to remove the high explosive (HE) from nuclear weapons in the process of their dismantlement. A boxed 50 cmf HEPA filter with an integral prefilter was exposed to DMSO vapor and aerosols that were generated by a spray nozzle to simulate conditions expected in the HE dissolution operation. After 198 hours of operation, the pressure drop of the filter had increased form 1.15 inches to 2,85 inches, and the efficiency for 0.3 {mu}m dioctyl sebacate (DOS) aerosols decreased form 99.992% to 98.6%. Most of the DMSO aerosols had collected as a liquid pool inside the boxed HEPA. The liquid was blown out of the filter exit with 100 cmf air flow at the end of the test. Since the filter still met the minimum allowed efficiency of 99.97% after 166 hours of exposure, we recommend replacing the filter every 160 hours of operation or sooner if the pressure drop increases by 50%. Examination of the filter showed that visible cracks appeared at the joints of the wooden frame and a portion of the sealant had pulled away from the frame. Since all of the DMSO will be trapped in the first HEPA filter, the second HEPA filter should not suffer from DMSO degradation. Thus the combined efficiency for the first filter (98.6%) and the second filter (99.97%) is 99.99996% for 0.3 {mu}m particles. If the first filter is replaced prior to its degradation, each of the filters will have 99.97% efficiency, and the combined efficiency will be 99.999991%. The collection efficiency for DMSO/HE aerosols will be much higher because the particle size is much greater.

  18. Vertical distribution of major photosynthetic picoeukaryotic groups in stratified marine waters

    KAUST Repository

    Cabello, Ana M.; Latasa, Mikel; Forn, Irene; Moran, Xose Anxelu G.; Massana, Ramon


    composition and to explore the possible segregation of target groups in the light, nutrient and temperature gradients. Chlorophytes, pelagophytes and prymnesiophytes, in this order of abundance, accounted for the total PPEs recorded by flow cytometry

  19. Educator Sexual Misconduct: Exposing or Causing Learners to Be Exposed to Child Pornography or Pornography

    Directory of Open Access Journals (Sweden)

    Susan Coetzee


    Full Text Available he law recognises that non-contact sexual offences can cause harm and several offences were created to regulate non-contact sexual child abuse offences. Several of these offences deal with the exposure or causing exposure of children to child pornography or pornography. Sexual grooming of children and the “Exposure or display of or causing exposure or display of child pornography or pornography to children” are criminalised in sections 18(2 and 19 of the Criminal Law (Sexual Offences and Related Matters Amendment Act 32 of 2007. And offences in relation to exposing children to disturbing, harmful and age-inappropriate materials are criminalised in sections 24A(2 and (4 of the Films and Publications Act 65 of 1996. In this article the author considered the content of the offences of “Exposure or display of or causing exposure or display of child pornography or pornography to children” in relation to the other offences dealing with exposure of children to child pornography or pornography. Benchmarked against these criminal offences the author then conceptualised exposing learners, or causing the exposure of learners to child pornography or pornography as forms of educator misconduct. The seriousness that should be attached to these forms of misconduct was considered in light of the various criminal offences. The review of the criminal offences and the forms of educator misconduct brought the ineffectiveness of current forms of serious educator misconduct to the fore. There is no form of serious misconduct that covers the transgression of educators who expose learners to child pornography or pornography that can be classified as “XX”. In conclusion a suggestion is made with regard to how a new form of serious misconduct could be worded so as to cover this gap, eg An educator must be dismissed if he or she is found guilty of – (g exposing a learner to or causing exposure of a learner to material classified as “Refused” or

  20. [A survey of occupational health among polyether-exposed workers]. (United States)

    Fu, Xu-ying; Yu, Bin; Zhang, Chun-ping; Zheng, Guan-hua; Bai, Lan; Zhang, Pan-pan


    To investigate the occupational health of the workers simultaneously exposed to acrylonitrile, epoxyethane, epoxypropane, and styrene. A questionnaire survey was conducted in 70 front-line workers simultaneously exposed to acrylonitrile, epoxyethane, epoxypropane, and styrene (exposure group) and 50 managers (control group) in a polyether manufacturer; in addition, air monitoring at workplace and occupational health examination were also performed. The obtained data were analyzed. The female workers in exposure group and the spouses of male workers in exposure group had significantly higher spontaneous abortion rates than their counterparts in control group (P polyether-exposed working years had significantly higher mean levels of DNA damage than the control group (P polyether-exposed working years and those with not less than 20 polyether-exposed working years had significantly higher mean micronucleus rates than the control group (P polyether-exposed working years (P > 0.05); the workers with not less than 5 and less than 20 polyether-exposed working years and workers with not less than 20 polyether-exposed working years had significantly higher mean micronucleus rates than those with less than 5 polyether-exposed working years (P polyether manufacturer.

  1. Going beyond the most exposed people in a dose assessment

    Energy Technology Data Exchange (ETDEWEB)

    Hjerpe, Thomas; Broed, Robert [Facilia AB, Gustavslundsvaegen 151C, SE-167 51 Bromma (Sweden); Ikonen, Ari T.K. [Environmental Research and Assessment, EnviroCase, Ltd., Hallituskatu 1 D 4, FI-28 100 Pori (Finland)


    The dose assessment in a long-term radiation safety assessment often focus on assessing dose of a representative person to be used for determining compliance with a radiation dose constraint. This representative person is often assumed to receive a dose that is representative of the most exposed people, i.e., the more highly exposed individuals in the population. This is not always sufficient, the Finnish regulations for disposal of nuclear waste has radiation dose constraint to the most exposed people as well as for larger groups of exposed people. This work presents the methodology to assessing dose of a representative person for a larger group of exposed people as applied by Posiva in the TURVA-2012 safety case for the spent nuclear fuel disposal at Olkiluoto. In addition, annual doses from the set of biosphere calculation cases analysed in TURVA-2012 are presented and discussed. Special focus is given on explaining the differences in exposure levels and exposure routes between the estimated annual doses to representative persons for most exposed people and a larger exposed group. The results show that the annual doses to a larger group of people ranges from one to three orders of magnitude below the annual doses to the most exposed people. Furthermore, the exposure route related to food ingestion is less significant for the larger group of people compared to the most exposed people and that the exposure route related to water ingestion shows the opposite behaviour. (authors)

  2. Response of exposed bark and exposed lichen to an urban area

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, A.M.J. [Polytechnic Institute of Coimbra, Oliveira do Hospital (Portugal). Oliveira do Hospital College of Technology and Management; Freitas, M.C.; Canha, N. [URSN, Sacavem (Portugal). Inst. Tecnologico e Nuclear (ITN); Verburg, T.G.; Wolterbeek, H.T. [Technical Univ. of Delft (Netherlands). Dept. of Radiation, Radionuclides and Reactors


    The aim of this study is to understand emission sources of chemical elements using biomonitoring as a tool. The selected lichen and bark were respectively Parmotrema bangii and Criptomeria japonica, sampled in the pollution-free atmosphere of Azores (Sao Miguel island), Portugal, and were exposed in the courtyards of 22 basic schools of Lisbon. The exposure was from January to May 2008 and from June to October 2008 (designated through the text as winter and summer respectively). The chemical element concentrations were determined by INAA. Conductivity of the lichen samples was measured. Factor analysis (MCTTFA) was applied to winter/summer bark/lichen exposed datasets. Arsenic emission sources, soil with anthropogenic contamination, a Se source, traffic, industry, and a sea contribution, were identified. In lichens, a physiological source based on the conductivity values was found. The spatial study showed contribution of sources to specific school positioning. Conductivity values were high in summer in locations as international Lisbon airport and downtown. Lisbon is spatially influenced by marine air mass transportation. It is concluded that one air sampler in Lisbon might be enough to define the emission sources under which they are influenced. (orig.)

  3. Ecophysiological tolerance of duckweeds exposed to copper

    Energy Technology Data Exchange (ETDEWEB)

    Kanoun-Boule, Myriam [Centre for Functional Ecology, Department of Botany, University of Coimbra, Coimbra 3000-456 (Portugal)], E-mail:; Vicente, Joaquim A.F.; Nabais, Cristina [Centre for Functional Ecology, Department of Botany, University of Coimbra, Coimbra 3000-456 (Portugal); Prasad, M.N.V. [Department of Plant Sciences, University of Hyderabad, Hyderabad 500046 (India); Freitas, Helena [Centre for Functional Ecology, Department of Botany, University of Coimbra, Coimbra 3000-456 (Portugal)


    Although essential for plants, copper can be toxic when present in supra-optimal concentrations. Metal polluted sites, due to their extreme conditions, can harbour tolerant species and/or ecotypes. In this work we aimed to compare the physiological responses to copper exposure and the uptake capacities of two species of duckweed, Lemna minor (Lm(EC1)) and Spirodela polyrrhiza (SP), from an abandoned uranium mine with an ecotype of L. minor (Lm(EC2)) from a non-contaminated pond. From the lowest Cu concentration exposure (25 {mu}M) to the highest (100 {mu}M), Lm(EC2) accumulated higher amounts of copper than Lm(EC1) and SP. Dose-response curves showed that Cu content accumulated by Lm(EC2) increases linearly with Cu treatment concentrations (r{sup 2} = 0.998) whereas quadratic models were more suitable for Lm(EC1) and SP (r{sup 2} = 0.999 and r{sup 2} = 0.998 for Lm(EC1) and SP, respectively). A significant concentration-dependent decline of chlorophyll a (chl a) and carotenoid occurred as a consequence of Cu exposure. These declines were significant for Lm(EC2) exposed to the lowest Cu concentration (25 {mu}M) whereas for Lm(EC1) and SP a significant decrease in chl a and carotenoids was observed only at 50 and 100 {mu}M-Cu. Electric conductivity (EC) and malondialdehyde (MDA) content increased after Cu exposure, indicating oxidative stress. Significant increase of EC was observed in Lm(EC2) for all Cu concentrations whereas the increase for Lm(EC1) and SP became significant only after an exposure to 50 {mu}M-Cu. On the contrary, for Lm(EC1), SP, and Lm(EC2), MDA content significantly increased even at the lowest concentration. Protein content and catalase (CAT) activity showed a decrease with an increase in Cu concentration. For the species Lm(EC1) and SP, a significant effect of copper on CAT activity was observed only at the highest concentration (100 {mu}M-Cu) whereas, for Lm(EC2), this effect started to be significant after an exposure to 50 {mu

  4. Ecophysiological tolerance of duckweeds exposed to copper

    International Nuclear Information System (INIS)

    Kanoun-Boule, Myriam; Vicente, Joaquim A.F.; Nabais, Cristina; Prasad, M.N.V.; Freitas, Helena


    Although essential for plants, copper can be toxic when present in supra-optimal concentrations. Metal polluted sites, due to their extreme conditions, can harbour tolerant species and/or ecotypes. In this work we aimed to compare the physiological responses to copper exposure and the uptake capacities of two species of duckweed, Lemna minor (Lm(EC1)) and Spirodela polyrrhiza (SP), from an abandoned uranium mine with an ecotype of L. minor (Lm(EC2)) from a non-contaminated pond. From the lowest Cu concentration exposure (25 μM) to the highest (100 μM), Lm(EC2) accumulated higher amounts of copper than Lm(EC1) and SP. Dose-response curves showed that Cu content accumulated by Lm(EC2) increases linearly with Cu treatment concentrations (r 2 = 0.998) whereas quadratic models were more suitable for Lm(EC1) and SP (r 2 = 0.999 and r 2 = 0.998 for Lm(EC1) and SP, respectively). A significant concentration-dependent decline of chlorophyll a (chl a) and carotenoid occurred as a consequence of Cu exposure. These declines were significant for Lm(EC2) exposed to the lowest Cu concentration (25 μM) whereas for Lm(EC1) and SP a significant decrease in chl a and carotenoids was observed only at 50 and 100 μM-Cu. Electric conductivity (EC) and malondialdehyde (MDA) content increased after Cu exposure, indicating oxidative stress. Significant increase of EC was observed in Lm(EC2) for all Cu concentrations whereas the increase for Lm(EC1) and SP became significant only after an exposure to 50 μM-Cu. On the contrary, for Lm(EC1), SP, and Lm(EC2), MDA content significantly increased even at the lowest concentration. Protein content and catalase (CAT) activity showed a decrease with an increase in Cu concentration. For the species Lm(EC1) and SP, a significant effect of copper on CAT activity was observed only at the highest concentration (100 μM-Cu) whereas, for Lm(EC2), this effect started to be significant after an exposure to 50 μM-Cu. Superoxide dismutase (SOD) activity

  5. Psychopharmacologic treatment of children prenatally exposed to drugs of abuse. (United States)

    Hulvershorn, Leslie A; Schroeder, Kristen M; Wink, Logan K; Erickson, Craig A; McDougle, Christopher J


    This pilot study compared the pharmacologic treatment history and clinical outcomes observed in pediatric outpatients with psychiatric disorders exposed to drugs of abuse in utero to those of an age-matched, sex-matched and psychiatric disorder-matched, non-drug-exposed group. In this matched cohort study, medical records of children treated at an academic, child and adolescent psychiatry outpatient clinic were reviewed. Children with caregiver-reported history of prenatal drug exposure were compared with a non-drug-exposed control group being cared for by the same providers. Patients were rated with the Clinical Global Impressions-Severity scale (CGI-S) throughout treatment. The changes in pre-treatment and post-treatment CGI-S scores and the total number of medication trials were determined between groups. The drug-exposed group (n = 30) had a higher total number of lifetime medication trials compared with the non-drug-exposed group (n = 28) and were taking significantly more total medications, at their final assessment. Unlike the non-drug-exposed group, the drug-exposed group demonstrated a lack of clinical improvement. These results suggest that in utero drug-exposed children may be more treatment-refractory to or experience greater side effects from the pharmacologic treatment of psychiatric disorders than controls, although we cannot determine if early environment or drugs exposure drives these findings. Copyright © 2015 John Wiley & Sons, Ltd.

  6. Unusual presentation of necrotizing fasciitis in an HIV exposed infant

    African Journals Online (AJOL)

    ... presentation of NF, in this instance, it presented on the scalp, in an HIV exposed neonate. It also stressed the importance prompt diagnosis of all skin lesions in HIV exposed neonates, and the role of early diagnosis and aggressive multi disciplinary team management in salvaging NF which is a potentially fatal condition.

  7. Animal Cruelty by Children Exposed to Domestic Violence (United States)

    Currie, Cheryl L.


    Objective: The first objective of this study was to determine if children exposed to domestic violence were significantly more likely to be cruel to animals than children not exposed to violence. The second was to determine if there were significant age and gender differences between children who were and were not cruel to animals. Method: A…

  8. 9 CFR 78.23 - Brucellosis exposed bison. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucellosis exposed bison. 78.23... AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS BRUCELLOSIS Restrictions on Interstate Movement of Bison Because of Brucellosis § 78.23 Brucellosis exposed bison...

  9. 9 CFR 78.32 - Brucellosis exposed swine. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucellosis exposed swine. 78.32... AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS BRUCELLOSIS Restrictions on Interstate Movement of Swine Because of Brucellosis § 78.32 Brucellosis exposed swine. (a...

  10. Self-reported hearing performance in workers exposed to solvents

    Directory of Open Access Journals (Sweden)

    Adrian Fuente


    Full Text Available OBJECTIVE: To compare hearing performance relating to the peripheral and central auditory system between solvent-exposed and non-exposed workers. METHODS: Forty-eight workers exposed to a mixture of solvents and 48 non-exposed control subjects of matched age, gender and educational level were selected to participate in the study. The evaluation procedures included: pure-tone audiometry (500 - 8,000 Hz, to investigate the peripheral auditory system; the Random Gap Detection test, to assess the central auditory system; and the Amsterdam Inventory for Auditory Disability and Handicap, to investigate subjects' self-reported hearing performance in daily-life activities. A Student t test and analyses of covariance (ANCOVA were computed to determine possible significant differences between solvent-exposed and non-exposed subjects for the hearing level, Random Gap Detection test and Amsterdam Inventory for Auditory Disability and Handicap. Pearson correlations among the three measures were also calculated. RESULTS: Solvent-exposed subjects exhibited significantly poorer hearing thresholds for the right ear than non-exposed subjects. Also, solvent-exposed subjects exhibited poorer results for the Random Gap Detection test and self-reported poorer listening performance than non-exposed subjects. Results of the Amsterdam Inventory for Auditory Disability and Handicap were significantly correlated with the binaural average of subject pure-tone thresholds and Random Gap Detection test performance. CONCLUSIONS: Solvent exposure is associated with poorer hearing performance in daily life activities that relate to the function of the peripheral and central auditory system.

  11. The differences in phenolic content in rivers exposed and non-exposed to anthropogenic contamination. (United States)

    Michałowicz, Jaromir; Bukowska, Bozena; Duda, Wirgiliusz


    The purpose of the work was to determine the differences in a kind, number and concentrations of phenol, chlorophenols, chlorocatechols chlorinated methoxyphenols (chloroguaiacols, chlorosyringols) and 3,4,5-trichloroveratrole in the drainage of the Dzierzazna river, the flow non-exposed to anthropogenic contamination and in the Ner river, the flow exposed to anthropogenic pollution. The samples of water were collected in the Dzierzazna river in the Swoboda locality, the inflow of the Dzierzazna river - the Ciosenka river and, also, in the spring situated in Ciosny Sady locality. Water of the Ner river was collected in points near Łódź, Konstantynów, Poddebice and Dabie towns. The compounds were condensed (adsorbed) and eluted with methylene chloride on octadecyl C18 layer in a Baker Separex system. The obtained eluent was separated using the method of gas chromatography and analysed using mass spectrometry technique. In samples collected from the drainage of the Dzierzazna river phenol, chlorophenols, guaiacol, trichloroguaiacol, tetrachloroguaiacol, trichlorosyringol and 3,4,5-trichloroveratole were determined. As no anthropogenic sources are situated within the drainage of the Dzierzazna river, we may suppose that most of the determined compounds are mainly of natural origin. No or trace concentrations of chlorinated methoxyphenols were noted in the water of the Ner river, but a higher number, and concentrations of chlorophenols and additionally chlorocatechols were determined in this flow. It is also apparent that changes in a number and concentrations of phenols in the water of the Ner river did not prove a seasonal character, which was typical of the Dzierzazna drainage waters.

  12. Survey on Urinary Levels of Aflatoxins in Professionally Exposed Workers

    Directory of Open Access Journals (Sweden)

    Fulvio Ferri


    Full Text Available Feed mill workers may handle or process maize contaminated with aflatoxins (AFs. This condition may lead to an unacceptable intake of toxins deriving from occupational exposure. This study assessed the serological and urinary levels of AFs in workers exposed to potentially contaminated dusts in two mills. From March to April 2014, blood and urine samples were collected, on Monday and Friday morning of the same working week from 29 exposed workers and 30 non-exposed controls. AFs (M1, G2, G1, B1, B2 and aflatoxicol (AFOH A were analyzed. Each subject filled in a questionnaire to evaluate potential food-borne exposures to mycotoxins. AFs contamination in environmental dust was measured in both plants. No serum sample was found to be positive. Seventy four percent of urine samples (73.7% revealed AFM1 presence. AFM1 mean concentration was 0.035 and 0.027 ng/mL in exposed and non-exposed workers, respectively (p = 0.432; the concentration was slightly higher in Friday’s than in Monday’s samples, in exposed workers, 0.040 versus (vs. 0.031 and non-exposed controls (0.030 vs. 0.024, p = 0.437. Environmental AFs contamination ranged from 7.2 to 125.4 µg/kg. The findings of this study reveal the presence of higher AFs concentration in exposed workers than in non-exposed controls, although these differences are to be considered consistent with random fluctuations.

  13. Care of HIV-exposed and HIV-infected neonates

    African Journals Online (AJOL)

    However, further reduction in MTCT may be possible if newborns at high risk of acquiring HIV ... infants of breastfeeding mothers with newly diagnosed HIV infection, dual NVP/ .... birth HIV DNA PCR testing for HIV-exposed low birth weight.

  14. UDS in lymphocytes of occupationally radiation exposed persons

    International Nuclear Information System (INIS)

    Tuschl, H.; Kovac, R.


    To determine a possible effect of low dose radiation on DNA repair processes, peripheral lymphocytes of mine workers exposed to 222 Rn in the thermal gallery of Badgastein (Austria) and employees of the Austrian Research Centre Seibersdorf, exposed to varying doses of gamma radiation, were investigated. The capacity for unscheduled DNA synthesis (UDS) induced by in vitro UV irradiation was measured by autoradiography of isolated lymphocytes of exposed persons and unexposed controls. In all 222 Rn-exposed mine workers a significant increase of UDS above control values could be observed. Gamma irradiation 31 mrad had a significant effect on UDS, indicating a stimulation of DNA repair capability by chronic low dose exposure. (Author)

  15. Pulmonary function evaluations of dogs exposed to uranium ore dust

    International Nuclear Information System (INIS)

    Loscutoff, S.M.; Buschbom, R.L.; Palmer, R.F.; Cross, F.T.


    Pulmonary function evaluations were conducted on dogs exposed to carnotite uranium ore dust. Significant changes were detected in the slope of the single-breath N 2 washout curve, suggesting an uneven distribution of ventilation

  16. Administrative norms on radiofrequency radiation for occupationally exposed persons

    International Nuclear Information System (INIS)

    Saxeboel, G.


    The report presents a proposal for administrative norms on radiofrequency (RF) radiation for occupationally exposed persons. The norms establish maximum allowable field exposure in a frequency range from 1 MHz too 300 GHz. (RF)

  17. Micronuclei frequency in children exposed to environmental mutagens: a review

    DEFF Research Database (Denmark)

    Neri, Monica; Fucic, Aleksandra; Knudsen, Lisbeth E


    Cytogenetic monitoring has been traditionally used for the surveillance of populations exposed to genotoxic agents. In recent years sensitivity problems emerged in surveys of populations exposed to low levels of mutagens, and therefore alternative approaches have been explored. Biomonitoring....... The limited number of published papers indicates that the conduct of properly designed studies on the effect of environmental pollutants in children may be difficult. This review confirmed the usefulness of MN assay in biomonitoring studies conducted in children, revealing that in many circumstances...

  18. Epidemiological studies of some populations exposed to ionizing radiation

    International Nuclear Information System (INIS)

    Weeks, J.L.


    During 1984 September 19 and 20, a meeting was held at the Whiteshell Nuclear Research Establishment, Pinawa, Manitoba to discuss current epidemiological studies of populations exposed to low levels of ionizing radiation. Twelve representatives from three countries attended the meeting and eleven papers were extensively discussed. The majority of these papers described studies of populations occupationally exposed to radiation. The report contains summaries of the papers presented and of the discussions that took place

  19. Behavioural changes in mice exposed to low level microwave fields

    International Nuclear Information System (INIS)

    Goiceanu, C.; Gradinaru, F.; Danulescu, R.; Balaceanu, G.; Sandu, D. D.; Avadanei, O. G.


    The aim of our study is to point out some changes in mice behaviour due possibly to exposure to low-level microwave fields. Animals spontaneous behaviour were monitored and the exploring behaviour and motor activity were assessed. Ten selected Swiss male mice were exposed to low-level microwave fields of about 1 mW/cm 2 power density for a relatively long period of time (13 weeks), comparing to their lifetime. The exposure system consists in a transverse electromagnetic (TEM) Cell. A control lot of ten Swiss male mice was used. All twenty mice were selected to be of same age and of 202 g initial body weight. Each animal was placed in his own holder. The behaviour of the animals, from both exposed and control lots, was assessed by using a battery of three behavioural tests. The test sessions were performed every two weeks. During exposure period it was recorded a progressive but moderate loss of motor activity for both exposed and controls, probably due to weight gain and aging. Concerning exploratory activity there is a significant difference between control and exposed animals. Control mice had approximately constant performances in time. On the other hand exposed mice showed a progressive decrease in time of their exploratory ability. Motor activity of exposed animals does not seem to be affected by microwave exposure, in spite of moderate loss in time of motor activity in both lots, as long as it was recorded a quite similar evolution. The difference in performances of exposed and controls concerning exploratory activity seem to emphasise an effect of long-term low-level microwave exposure. The progressive loss in time of exploratory activity of exposed mice, in contrast with controls, could be due to the interference of microwaves with central nervous activity. (authors)

  20. Ethylene thiourea: thyroid function in two groups of exposed workers

    Energy Technology Data Exchange (ETDEWEB)

    Smith, D.M.


    Ethylene thiourea is manufactured at one factory in the United Kingdom and is mixed into masterbatch rubber at another. Clinical examinations and thyroid function tests were carried out over a period of three years on eight process workers and five mixers and on matched controls. The results show that the exposed mixers, but not exposed process workers, have significantly lower levels of total thyroxine (T4) than the controls. One mixer had an appreciably raised level of thyroid stimulation hormone (TSH).

  1. Ethylene thiourea: thyroid function in two groups of exposed workers. (United States)

    Smith, D M


    Ethylene thiourea is manufactured at one factory in the United Kingdom and is mixed into masterbatch rubber at another. Clinical examinations and thyroid function tests were carried out over a period of three years on eight process workers and five mixers and on matched controls. The results show that the exposed mixers, but not exposed process workers, have significantly lower levels of total thyroxine (T4) than the controls. One mixer had an appreciably raised level of thyroid stimulation hormone (TSH).

  2. Hearing Loss in Persons Exposed and not Exposed to Occupational Noise. (United States)

    Kovalova, Martina; Mrazkova, Eva; Sachova, Petra; Vojkovska, Kristyna; Tomaskova, Hana; Janoutova, Jana; Janout, Vladimir


    This study aimed to compare hearing loss in individuals at risk and those not at risk for occupational noise and to compare working loss by gender. The analysis used data from a current Czech Ministry of Health grant project called Epidemiological and Genetic Study of the Frequency of Hearing Loss (2011 to 2015; NT12246-5/2011). The analyzed sample comprised 4988 participants. Hearing was tested using pure-tone threshold audiometry, tympanometry, and measurement of the stapedius reflex. Females at risk and those not at risk for occupational noise who were younger than 44 years and older than 75 years were found to have no statistically significant differences at any pure-tone threshold audiometry frequency. In females aged 45 to 74 years, statistically significant differences were found. In males, hearing loss was observed as early as 18 years of age. When comparing males and females at no risk for occupational noise, there were no statistically significant differences at any of the frequencies in those younger than 29 years. In females aged 30 years or older, statistically significant differences were observed at various frequencies in all age groups. When comparing males and females at risk for occupational noise, statistically significant differences were more frequent than in employees not exposed to noise. Hearing loss in females does not significantly vary depending on occupational exposure. The opposite is true for males. However, the maximum differences in mean levels did not exceed 10 dB. It is therefore clear that noise is a preventable factor, and the use of personal protective equipment is warranted.

  3. Analysis of reproductive function in persons exposed to chronic radiation

    International Nuclear Information System (INIS)

    Kossenko, M.M.; Ostroumova, E.V.; Vyushkova, O.V.


    The purpose of the study was to analyze the reproductive function in individuals exposed to radiation in the riverside villages on the Techa in the Southern Urals. The exposure of the population, numbering 28000, occurred in 1950-1956 as a result of discharges into the river of radioactive wastes from the Mayak facility for processing weapon plutonium. The residents were exposed to chronic radiation, both external and internal. The range of exposure doses to gonads was sufficiently wide: 20-1270 mSv. However, the distribution of doses among the exposed individuals was ununiform, and the proportion of people whose dose was below 120 mGy accounted for 74%. The following characteristics of exposed women were analyzed: menstrual function, outcomes of pregnancy, birth rates, health status for newborns. The analysis of the menstrual function in exposed women showed that in persons exposed in childhood, menarche was registered at the age of 14.3 years, on the average (based on literature sources, menarche is attained at the age of 13 for unexposed population). The mean age at menopause was 47.9 years for exposed women (the respective mean value for Russia is 50.8 years). Pregnancy outcomes were analyzed in 9000 exposed women. The rate of medical and criminal abortions was estimated as 79 per 100 labors. The rate of spontaneous abortions for exposed women was slightly higher, 3.11%, than for controls, 2.30%; these difference, however, were statistically insignificant. The total loss of fetus or neonate (unfavorable outcomes of pregnancy: spontaneous abortions, stillbirths, early neonatal death) was estimated to be 4.58% at zero dose. Exposure to gonads at the dose 1 Sv, estimated using the above-indicated method, yielded 3% of additional unfavorable outcomes of pregnancy. It was shown, based on the analysis of birth rates for the Techa Cohort that they had not undergone any essential changes over the first 25 years of exposure compared to the respective coefficients for

  4. Analysis of reproductive function in persons exposed to chronic radiation

    Energy Technology Data Exchange (ETDEWEB)

    Kossenko, M.M.; Ostroumova, E.V.; Vyushkova, O.V. [Urals Research Center for Radiation Medicine, Chelyabinsk (Russian Federation)


    The purpose of the study was to analyze the reproductive function in individuals exposed to radiation in the riverside villages on the Techa in the Southern Urals. The exposure of the population, numbering 28000, occurred in 1950-1956 as a result of discharges into the river of radioactive wastes from the Mayak facility for processing weapon plutonium. The residents were exposed to chronic radiation, both external and internal. The range of exposure doses to gonads was sufficiently wide: 20-1270 mSv. However, the distribution of doses among the exposed individuals was ununiform, and the proportion of people whose dose was below 120 mGy accounted for 74%. The following characteristics of exposed women were analyzed: menstrual function, outcomes of pregnancy, birth rates, health status for newborns. The analysis of the menstrual function in exposed women showed that in persons exposed in childhood, menarche was registered at the age of 14.3 years, on the average (based on literature sources, menarche is attained at the age of 13 for unexposed population). The mean age at menopause was 47.9 years for exposed women (the respective mean value for Russia is 50.8 years). Pregnancy outcomes were analyzed in 9000 exposed women. The rate of medical and criminal abortions was estimated as 79 per 100 labors. The rate of spontaneous abortions for exposed women was slightly higher, 3.11%, than for controls, 2.30%; these difference, however, were statistically insignificant. The total loss of fetus or neonate (unfavorable outcomes of pregnancy: spontaneous abortions, stillbirths, early neonatal death) was estimated to be 4.58% at zero dose. Exposure to gonads at the dose 1 Sv, estimated using the above-indicated method, yielded 3% of additional unfavorable outcomes of pregnancy. It was shown, based on the analysis of birth rates for the Techa Cohort that they had not undergone any essential changes over the first 25 years of exposure compared to the respective coefficients for

  5. Analysis of the mortality of the progeny of exposed parents

    International Nuclear Information System (INIS)

    Kosenko, M.M.


    The purpose of this study was to analyze the values, time course, and structure of mortality of the progeny of exposed residents of villages on the banks of the Techa river in the Urals. The exposure was caused by discharge of radioactive waste of Mayak radiochemical plant for the manufacture of bomb plutonium into the river. A total of 76x10 6 m 3 liquid waste with a total activity of 2,75x10 6 Ci was discharged into the river from 1949 to 1956. The population of villages on the banks of the river, 26554 subjects was exposed to external and internal radiation. The doses per gonads caused by external exposure and incorporation of evenly distributed radionuclides (mainly 137 Cs) ranged 20 to 1270 mSv. A total of 23869 children were born to exposed subjects since the beginning of exposure; 3160 of these were exposed in utero. The mortality rates int he studied cohort was nothigher than in controls. However, deaths from the so-called endogenous causes were more frequent for the descendants of exposed subjects: neonatal diseases, congenital developmental defects, and states that could not be accurately defined. Correlation of the number of deaths from congenital developmental defects to the collective gonadal dose permitted us to assess the risk as 0.004 perSv, this being in agreement with the estimates of the International Committee for Radiation Protection. 7 refs.; 2 figs.; 6 tabs

  6. Serum-thyroxine levels in microwave-exposed rats

    International Nuclear Information System (INIS)

    Lu, S.T.; Lebda, N.; Michaelson, S.M.; Pettit, S.


    The nature of the response of the thyroid gland in animals exposed to microwave irradiation is controversial. Animal experimentation has contributed to the controversy because both increased and decreased thyroid functions have been reported. The thyroxine concentration in rats as representative of thyroid function in animals exposed to 2.45-GHz, 120-Hz amplitude-modulated microwaves has been studied. These studies covered a long time span; rats from two commercial sources (BS and CR) were used and subjected to different numbers of exposures, and therefore these data were evaluated for their stability. Two factors could influence in the result significantly, i.e., source of animal and number of sham exposures. Rats used in the 2-hr exposures were from two different commercial sources; rats from CR had a higher (but normal) thyroxine concentration than did rats from BS. Therefore the data of these animals were separated by commercial source for reevaluation. Instead of increased thyroxine concentration in rats exposed at 25, 30, and 40 mW/cm 2 , changes were not noted in any microwave-exposed rats. The influence of sham exposure revealed that appropriate concurrent control and specification of animal source are needed in longitudinal studies. Furthermore, statistical procedures used can greatly influence the conclusions. Thus the specificity of changes in thyroxine concentration in rats exposed to microwaves because of its sporadic occurrence and because of inconsistencies among experiments was doubted

  7. Screening and surveillance of workers exposed to mineral dusts

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, G.R.


    This publication resulted from a World Health Organisation initiated project to investigate the harmonisation of definitions, approaches and methodologies for the screening and surveillance of workers exposed to mineral dust. The first part of the book provides definitions of screening and surveillance and describes the main elements of such programmes. The second part discusses the practical aspect of the screening and surveillance of working populations exposed to crystalline silica, coal mine dust and asbestos. Although no single set of guidelines is applicable to the development and implementation of a programme for the screening and surveillance of workers exposed to mineral dust, the recommendations, together with certain caveats, should provide a useful starting point. Annexes provide examples of existing programmes in various countries and environments and discuss the use and interpretation of questionnaires, lung spirometry and chest radiography. Overall the book should be of interest to occupational health professionals.

  8. Cytogenetic investigation of subjects professionally exposed to radiofrequency radiation. (United States)

    Maes, Annemarie; Van Gorp, Urbain; Verschaeve, Luc


    Nowadays, virtually everybody is exposed to radiofrequency radiation (RFR) from mobile phone base station antennas or other sources. At least according to some scientists, this exposure can have detrimental health effects. We investigated cytogenetic effects in peripheral blood lymphocytes from subjects who were professionally exposed to mobile phone electromagnetic fields in an attempt to demonstrate possible RFR-induced genetic effects. These subjects can be considered well suited for this purpose as their RFR exposure is 'normal' though rather high, and definitely higher than that of the 'general population'. The alkaline comet assay, sister chromatid exchange (SCE) and chromosome aberration tests revealed no evidence of RFR-induced genetic effects. Blood cells were also exposed to the well known chemical mutagen mitomycin C in order to investigate possible combined effects of RFR and the chemical. No cooperative action was found between the electromagnetic field exposure and the mutagen using either the comet assay or SCE test.

  9. Histomorphological patterns in osseous rests exposed at fire

    International Nuclear Information System (INIS)

    Medina, C.; Tiesler, V.; Oliva, A.I.; Quintana, P.


    Histomorphology as part of morphological research studies bony structure on the tissue level. Its methods are applied in this investigation to evaluate histomorphological impact patterns in heat-exposed bony material, particularly color changes, fissure patterns, volumetric reduction, and changes in the size of Haversian canals. These variables were evaluated in exposed thin sections of porcine long bones, obtained during two experimental series. The first one was conducted under stable thermal conditions in a furnace by measuring heat impact in stepped time (I to S hours) and temperature intervals (200 to 800 C). During a second experimental phase, bony samples were exposed to direct fire in defined time and heat intervals. The treated specimens were then sectioned and microscopically scrutinized. The results presented here were designed to offer new analytical, measurable standards in the investigation of forms of heat exposition of the human body, applicable in forensics and the study of ancient Maya posthumous body treatments. (Author)

  10. Urine nickel concentrations in nickel-exposed workers. (United States)

    Bernacki, E J; Parsons, G E; Roy, B R; Mikac-Devic, M; Kennedy, C D; Sunderman, F W


    Electrothermal atomic absorption spectrometry was employed for analyses of nickel concentrations in urine samples from nickel-exposed workers in 10 occupational groups and from non-exposed workers in two control groups. Mean concentrations of nickel in urine were greatest in workers who were exposed to inhalation of aerosols of soluble nickel salts (e.g., workers in nickel plating operations and in an electrolytic nickel refinery). Less marked increases in urine nickel concentrations were found in groups of metal sprayers, nickel battery workers, bench mechanics and are welders. No significant increases in mean concentrations of nickel were found in urine samples from workers who performed grinding, buffing and polishing of nickel-containing alloys or workers in a coal gasification plant who employed Raney nickel as a hydrogenation catalyst. Measurements of nickel concentrations in urine are more sensitive and practical than measurements of serum nickel concentrations for evaluation of nickel exposures in industrial workers.

  11. Liver function in workers exposed of the cosmetics industry. (United States)

    Casale, T; Caciari, T; Rosati, M V; Biagi, M; De Sio, S; Andreozzi, G; Schifano, M P; Capozzella, A; Pimpinella, B; Tomei, G; Tomei, F


    The purpose of this study is to assess whether occupational exposure to substances used in the cosmetic factories may cause effects on the liver and blood counts in exposed workers. The study included 48 exposed workers and 86 unexposed controls. All workers included in the study underwent blood count, white blood count, total, direct and indirect bilirubin, transaminases, alkaline phosphatase and cholinesterase. The differences between the means and frequencies were compared using the Student's t-test and chi-square test with Yates correction and were considered significant when the p value was cosmetics industry had liver test values above the range. We noted a statistically significant higher prevalence of GPT (p cosmetics industry compared with the control group. The results obtained suggest that occupational exposure to low doses of substances used in the cosmetic industry is able to influence some liver parameters in occupationally exposed workers.

  12. Ice nucleation of ammonia gas exposed montmorillonite mineral dust particles

    Directory of Open Access Journals (Sweden)

    A. Salam


    Full Text Available The ice nucleation characteristics of montmorillonite mineral dust aerosols with and without exposure to ammonia gas were measured at different atmospheric temperatures and relative humidities with a continuous flow diffusion chamber. The montmorillonite particles were exposed to pure (100% and diluted ammonia gas (25 ppm at room temperature in a stainless steel chamber. There was no significant change in the mineral dust particle size distribution due to the ammonia gas exposure. 100% pure ammonia gas exposure enhanced the ice nucleating fraction of montmorillonite mineral dust particles 3 to 8 times at 90% relative humidity with respect to water (RHw and 5 to 8 times at 100% RHw for 120 min exposure time compared to unexposed montmorillonite within our experimental conditions. The percentages of active ice nuclei were 2 to 8 times higher at 90% RHw and 2 to 7 times higher at 100% RHw in 25 ppm ammonia exposed montmorillonite compared to unexposed montmorillonite. All montmorillonite particles are more efficient as ice nuclei with increasing relative humidities and decreasing temperatures. The activation temperature of montmorillonite exposed to 100% pure ammonia was 15°C higher than for unexposed montmorillonite particles at 90% RHw. In the 25 ppm ammonia exposed montmorillonite experiments, the activation temperature was 10°C warmer than unexposed montmorillonite at 90% RHw. Degassing does not reverse the ice nucleating ability of ammonia exposed montmorillonite mineral dust particles suggesting that the ammonia is chemically bound to the montmorillonite particle. This is the first experimental evidence that ammonia gas exposed montmorillonite mineral dust particles can enhance its activation as ice nuclei and that the activation can occur at temperatures warmer than –10°C where natural atmospheric ice nuclei are very scarce.

  13. Intrapulmonary reactions of workers exposed to dust and ozone

    Energy Technology Data Exchange (ETDEWEB)

    Tsunoda, T; Nakadate, T; Sakurai, M; Sakurai, Y


    Forty-one dust-and-ozone-exposed and 37 nonexposed workers, belonging to the Research and Development Division of a photo-copier manufacturing industry, were examined to assess the effect of the exposure to carbon, iron and resin dust and ozone in the air of the work environment by means of questionnaires on their physical condition, smoking habits and exposure history by interview, chest X-rays, testing of ventilatory functions, transcutaneous PO2 (tcPO2) test and H2O2-induced hemolysis test. The following results were obtained. Respirable dust concentrations in the air of the work place were 0.1-1.0 mg/m3, total dust concentrations 0.2-2.0 mg/m3, and ozone concentrations 0.004-0.06 ppm (0.008-0.12 mg/m3). According to the Japanese Classification of Radiographs of Pneumoconioses, the exposed workers showed a higher rate of profusion 0/1 and over, and category 1 and over (1/0 and over) than the nonexposed workers. Ventilatory function testing revealed no difference between exposed workers and nonexposed workers, but small airway narrowing was suspected in smoking workers in comparison with nonsmoking workers. Transcutaneous PO2 showed no difference between exposed and nonexposed workers, between smoking and nonsmoking workers, and between any of the paired six combinations out of the four groups of workers, i.e., nonsmoking and nonexposed, nonsmoking and exposed, smoking and nonexposed, and smoking and exposed. It was estimated by H2O2-induced hemolysis test that smoking and/or dust exposure, especially long-term exposure, gave rise to aggravation of fragility of the erythrocyte membrane by lipid peroxidation with ozone or active oxygen produced by the reaction of dust and alveolar macrophages.

  14. [Hepatotoxicity in healthy infants exposed to nevirapine during pregnancy]. (United States)

    Iveli, Pablo; Noguera-Julian, Antoni; Soler-Palacín, Pere; Martín-Nalda, Andrea; Rovira-Girabal, Núria; Fortuny-Guasch, Clàudia; Figueras-Nadal, Concepció


    The use of nevirapine in HIV-infected pregnant women is discouraged due to its potential to cause hepatotoxicity. There is limited information available on the toxicity in non-HIV infected newborn exposed to this drug during pregnancy. The aim of the study is to determine the extent of hepatotoxicity in the newborn exposed to nevirapine and HIV during pregnancy. A cross-sectional, observational, multicenter study was conducted on a cohort of healthy infants born to HIV-infected mothers, in whom the first determination of alanine aminotransferase (ALT), before 6weeks of age, was collected. Patients were allocated to 2groups according to exposure to nevirapine during pregnancy. Hepatotoxicity was rated according to the AIDS Table for Grading the Severity of Adult and Pediatric Adverse Events (DAIDS). This study included 160newborns from 159pregnancies (88exposed to nevirapine-based regimens and 71 exposed to protease inhibitors-based therapies). No cases of hepatotoxicity were observed according to the DAIDS Table for Grading. Two cases of ALT above normal values (2.8%; 95%CI: 0.3-9.8%) were observed in patients not exposed to nevirapine, and one case (1.1%; 95%CI: 0.0-6.1%) in the group exposed to nevirapine (P=.585). The lack of differences between groups suggests that highly active antiretroviral treatment regimens including nevirapine administered during pregnancy do not involve a higher risk of liver disease compared to other treatment combinations. Copyright © 2014 Elsevier España, S.L.U. y Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

  15. Contaminations of inner surface of magnesium fluoride windows in the `Expose-R' experiment on the International Space Station (United States)

    Skurat, V. E.


    A series of experiments was carried out previously on board of the International Space Station in `EXPOSE-R', a multi-user expose facility, provided by European Space Agency attached to the external surface of the Russian Segment. In one experiment, spores of microorganisms and species of higher plant seeds, in heat-sealed polymer bags were irradiated by solar radiation passed through MgF2 windows in a high space vacuum. After sample exposure, it was found that in many cases the inner surfaces of windows were contaminated. Analysis of the contamination revealed the presence of chemical groups CH2, CH3, NH, OH, C═O, Si-CH3 (Demets et al. in 2015). Their presence in deposits was explained by photofixation of gaseous precursors - some of the vapours of glues and additives in polymeric materials in the core facility of `Expose-R'. Carbon-, oxygen- and silicon-containing groups may be deposited from outer intrinsic atmosphere. This atmosphere is connected with sample compartments and core facility. However, the presence of NH groups on inner surfaces of windows was not expected. This paper shows that the process responsible for carbon-, nitrogen- and oxygen-containing group formation can be a photopolymerization of caprolactam, which is released from the outer Nylon 6 layer of polymer bags under Solar vacuum ultraviolet radiation.

  16. Analysis of early mortality rates of survivors exposed within Japanese wooden houses in Hiroshima by exposed distance

    International Nuclear Information System (INIS)

    Hayakawa, Norihiko; Munaka, Masaki; Kurihara, Minoru; Ohkita, Takeshi.


    Mortality for 3,215 A-bomb survivors who were exposed in Japanese wooden houses at ≤ 1,300 m from the hypocenter on August 6, 1945 was examined. An overall mortality was 51 % (1,640/3,215 survivors) within 61 days after the exposure. According to the distance from the hypocenter, it was 100 % in A-bomb survivors exposed at ≤ 600 m, and 20 % in those exposed between 1,201 m and 1,300 m. The mortality decreased with increasing the distance from the hypocenter. In conjunction with the duration after the exposure and the distance from the hypocenter, the mortality was 100 % 12 days after the exposure in survivors exposed at ≤ 600 m. In survivors exposed at > 800 m, the mortality tended to be higher two weeks after the exposure than immediately after that. The distance from the hypocenter causing 50 per cent mortality was estimated to be 1,026 m from August 6 to October 5; 1,002 m from August 6 to September 10; 887 m from August 7 to September 10; and 867 m from August 20 to September 16. However, these figures were probably lower than the real mortality rates, since no information was available when whole family died. (Namekawa, K.)

  17. Survival of Spores of Trichoderma longibrachiatum in Space: data from the Space Experiment SPORES on EXPOSE-R (United States)

    Neuberger, Katja; Lux-Endrich, Astrid; Panitz, Corinna


    In the space experiment `Spores in artificial meteorites' (SPORES), spores of the fungus Trichoderma longibrachiatum were exposed to low-Earth orbit for nearly 2 years on board the EXPOSE-R facility outside of the International Space Station. The environmental conditions tested in space were: space vacuum at 10-7-10-4 Pa or argon atmosphere at 105 Pa as inert gas atmosphere, solar extraterrestrial ultraviolet (UV) radiation at λ > 110 nm or λ > 200 nm with fluences up to 5.8 × 108 J m-2, cosmic radiation of a total dose range from 225 to 320 mGy, and temperature fluctuations from -25 to +50°C, applied isolated or in combination. Comparable control experiments were performed on ground. After retrieval, viability of spores was analysed by two methods: (i) ethidium bromide staining and (ii) test of germination capability. About 30% of the spores in vacuum survived the space travel, if shielded against insolation. However, in most cases no significant decrease was observed for spores exposed in addition to the full spectrum of solar UV irradiation. As the spores were exposed in clusters, the outer layers of spores may have shielded the inner part. The results give some information about the likelihood of lithopanspermia, the natural transfer of micro-organisms between planets. In addition to the parameters of outer space, sojourn time in space seems to be one of the limiting parameters.

  18. Preventing Alcohol-Exposed Pregnancy among American-Indian Youth (United States)

    Jensen, Jamie; Kenyon, DenYelle Baete; Hanson, Jessica D.


    Research has determined that the prevention of alcohol-exposed pregnancies (AEP) must occur preconceptually, either by reducing alcohol intake in women planning pregnancy or at risk for becoming pregnant, or by preventing pregnancy in women drinking at risky levels. One such AEP prevention programme with non-pregnant American-Indian (AI) women is…

  19. Maternal ability to take care of children exposed to HIV

    Directory of Open Access Journals (Sweden)

    Julyana Gomes Freitas


    Full Text Available OBJECTIVE: to assess the ability of mothers to take care of children exposed to HIV, using the Assessment Scale of Care Skills for Children Exposed to HIV at Birth and to check the association between the scale dimensions and maternal characteristics. METHOD: this cross-sectional study involved 62 HIV+ mothers whose children of up to one year old had been exposed to the virus at birth. The Assessment Scale of Care Skills for Children Exposed to HIV at Birth consists of 52 items and five dimensions, indicating high, moderate or low care ability. RESULTS: 72.7% of the mothers appropriately offered zidovudine syrup; 86.0% were highly skilled to prepare and administer milk formula; 44.4% were moderately able to prepare and administer complementary feeding; 76.5% revealed high ability to administer prophylactic treatment against pneumonia and 95.3% demonstrated high abilities for clinical monitoring and immunization. Significant associations were found between some maternal variables and the scale dimensions. CONCLUSION: the scale permits the assessment of maternal care delivery to these children and the accomplishment of specific child health interventions.

  20. 3. cotrimoxazole prophylaxis compliance among hiv exposed infants

    African Journals Online (AJOL)


    reported that their spouses knew about their HIV status and 65.7% said that they felt free to give their child cotrimoxazole in public.61.8% of the respondents did not know that there was a social support group for mothers/caretakers of HIV exposed infants in their community and 74.5% stated that there were misconceptions ...

  1. Rich Representations with Exposed Semantics for Deep Visual Reasoning (United States)


    of a relationship between visual recognition, associative processing, and episodic memory and provides important clues into the neural mechanism...provides critical evidence of a relationship between visual recognition, associative processing, and episodic memory and provides important clues into...From - To) ;run.- ~01~ Final!Technical 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER Rich Representations with Exposed Semantics for Deep Visual

  2. Erosion of marker coatings exposed to Pilot-PSI plasma

    NARCIS (Netherlands)

    Paris, P.; Hakola, A.; Bystrov, K.; De Temmerman, G.; Aints, M.; I. Jõgi,; Kiisk, M.; Kozlova, J.; Laan, M.; Likonen, J.; Lissovski, A.


    In this article, laser induced breakdown spectroscopy (LIBS) has been used to study plasma-induced erosion processes. Samples with ITER-relevant coatings were exposed to controlled plasma fluxes whose parameters were characteristic to those occurring in the reactor walls. After the experiments,

  3. Identification of Surface Exposed Elementary Body Antigens of ...

    African Journals Online (AJOL)

    This study sought to identify the surface exposed antigenic components of Cowdria ruminantium elementary body (EB) by biotin labeling, determine effect of reducing and non-reducing conditions and heat on the mobility of these antigens and their reactivity to antibodies from immunized animals by Western blotting.

  4. Seroprevalence of Hepatitis C Virus in People Exposed to ...

    African Journals Online (AJOL)

    This study was therefore undertaken to determine the seroprevalence of hepatitis C virus (HCV) infection in people who had been exposed to traditional surgical practices in Edo State, Nigeria. Sera from the subjects were tested for HCV antibodies using Clinotech Diagnostic test device supplied by Clinotech Diagnostic and ...

  5. Computed temperature profile in materials exposed to gamma radiation

    Energy Technology Data Exchange (ETDEWEB)

    Ping, Tso Chin; Choong, Yap Siew; Seon, Chan Kam


    Computed temperature profiles are presented for the materials of lead, steel, concrete and water in curved shells, when they are exposed to gamma radiation. The results are based on the usual simplified theory of thermal conduction with an exponential heat source.

  6. Histopathology of the organs of Broiler Chickens exposed to flames ...

    African Journals Online (AJOL)

    Histopathology of the organs of broiler chickens exposed to the flame and fumes of refined petroleum product kerosene at varying distances over a period of 16hrs daily for 56 days in a poultry house were evaluated. Kerosene burning was simulated in a designed burner. Kerosene flame in a designed burner was placed 4, ...

  7. Thyroidal angiogenesis in zebrafish ( Danio rerio ) exposed to high ...

    African Journals Online (AJOL)

    As a well known environmental contaminant, perchlorate inhibits thyroidal iodide uptake and reduces thyroid hormone levels. In zebrafish (Danio rerio) exposed to high concentrations of sodium perchlorate (200, 350 and 500 mg/L) for 10 days, remarkable angiogenesis was identified, not only histopathologically but also ...

  8. Management of Patients with Post- Traumatic Exposed Bones at Moi ...

    African Journals Online (AJOL)

    Background: The global frequency for open long bone fracture is at least 11.5 cases per 100,000 persons per year. Precise published research information regarding the characteristics and the management of patients with post- traumatic exposed bones for Africa, Kenya and Moi Teaching and Referral Hospital- Eldoret is ...

  9. Rapid Assessment of Anthropogenic Impacts of Exposed Sandy ...

    African Journals Online (AJOL)

    We applied a rapid assessment methodology to estimate the degree of human impact of exposed sandy beaches in Ghana using ghost crabs as ecological indicators. The use of size ranges of ghost crab burrows and their population density as ecological indicators to assess extent of anthropogenic impacts on beaches ...

  10. Methane formation in tritium gas exposed to stainless steel

    International Nuclear Information System (INIS)

    Morris, G.A.


    Tests were performed to determine the effect cleanliness of a surface exposed to tritium gas had on methane formation. These tests performed on 304 stainless steel vessels, cleaned in various ways, showed that the methane formation was reduced by the use of various cleaning procedures

  11. 'Unicorn' among rats exposed to mycotoxins from Fusarium. (United States)

    Schoental, R


    A horn-like nodule developed in the middle of the forehead of a white rat, exposed perinatally to T-2 toxin and to zearalenone, the secondary metabolites of Fusarium. The hard nodule consisted mainly of keratine, derived from a squamous carcinoma spreading through the nasal turbinals and invading the brain.

  12. Predictors of incident tuberculosis in HIV-exposed children in ...

    African Journals Online (AJOL)

    Objective: To examine the predictors of tuberculosis infection in HIV-exposed children. Design: A longitudinal cohort study nested within a randomised controlled trial. Setting: Antenatal clinics in Dar-es-Salaam, Tanzania. Subjects: Children born to 875 HIV-infected women in Tanzania. Results: A total of 82 children ...

  13. Equilibrium disorders in workers exposed to mixed solvents. (United States)

    Giorgianni, Concetto; Tanzariello, Mariagiuseppina; De Pasquale, Domenico; Brecciaroli, Renato; Spatari, Giovanna


    Organic solvents cause diseases of the vestibular system. However, little is known regarding the correlation between vestibular damage and exposure to organic solvents below threshold limit values. The best measure by which to evaluate vestibular disorders is static and dynamic posturography. The aim of this study was to evaluate equilibrium disorders via static and dynamic posturography in workers without clear symptoms and exposed to low doses of mixed solvents. 200 subjects were selected. Using an Otometrics device (Madsen, Denmark), all subjects endured static and dynamic posturography testing with both eyes-open and eyes-closed conditions. Results were compared with a control group of unexposed individuals. Based on the obtained data, the following results can be drawn: (a) subjects exposed to mixtures of solvents show highly significant differences regarding all static and dynamic posturography parameters in comparison to the control group; (b) posturography testing has proven to be a valid means by which to detect subliminal equilibrium disorders in subjects exposed to solvents. We can confirm that refinery workers exposed to mixtures of solvents can present subliminal equilibrium disorders. Early diagnosis of the latter is made possible by static and dynamic posturography.

  14. Uranium in the tissue of occupationally exposed workers

    International Nuclear Information System (INIS)

    Campbell, E.E.; McInroy, J.F.; Schulte, H.F.


    Data are presented on the content of uranium in tissue samples from deceased occupationally exposed uranium workers. Data on the distribution in lungs, lymph nodes, liver, kidneys, and bone tissues are correlated with available data on the urinary excretion of U during the period of occupational exposure. (CH)

  15. Clinical findings on in utero exposed microcephalic children

    Energy Technology Data Exchange (ETDEWEB)

    Tabuchi, Akira; Hirai, Tsuyoshi; Nakagawa, Shigeru; Shimada, Katsunobu; Fujito, Junro


    Since animal experiments have shown that microcephaly is induced by fetal exposure to radiation and microcephaly has been found in children of mothers exposed to x-ray therapy during pregnancy (Murphy et al), the main cause of microcephaly in children exposed in utero to the A-bomb is considered to be ionizing radiation. Wood et al reported the increased incidence of microcephaly and mental retardation in children exposed in utero at proximal distances which they felt could not be attributed to any other known variable. ABCC has recently concluded that the effect of in utero exposure is primarily due to the immediate effect of radiation upon the fetuses although in A-bomb exposure the physical injury to the mother due to the A-bomb cannot be completely ignored. Our survey likewise revealed an increase of microcephaly in children exposed early in pregnancy at less than 15 weeks at closer distances than 1500 m. Thus, we presume that A-bomb radiation increases the incidence of microcephaly. 16 references, 8 tables.

  16. Protecting exposed tissues with external ultrasonic super-hydration. (United States)

    Silberg, Barry Neil


    The author contends that a technique preventing dehydration of exposed tissues, such as external ultrasonic super-hydration, will result in a lower morbidity rate, decreasing deep tissue pain, susceptibility to infection, fat necrosis, wound dehiscence, and improving recovery times. He discusses how he uses this technique in his aesthetic surgery practice.

  17. 46 CFR 108.223 - Guards on exposed equipment. (United States)


    ... have hand covers, guards, or rails installed on all belts, gears, shafts, pulleys, sprockets, spindles... 46 Shipping 4 2010-10-01 2010-10-01 false Guards on exposed equipment. 108.223 Section 108.223 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN...

  18. Thyroidal angiogenesis in zebrafish (Danio rerio) exposed to high ...

    African Journals Online (AJOL)



    Apr 20, 2009 ... As a well known environmental contaminant, perchlorate inhibits thyroidal iodide uptake and reduces thyroid hormone levels. In zebrafish (Danio rerio) exposed to high concentrations of sodium perchlorate (200, 350 and 500 mg/L) for 10 days, remarkable angiogenesis was identified, not only.

  19. Donation to disaster relief campaigns: underlying social cognitive factors exposed

    NARCIS (Netherlands)

    Oosterhof, Liesbeth; Heuvelman, A.; Peters, O.


    number of very serious natural disasters have put an enormous pressure on relief organizations in the last few years. The present study exposes underlying social cognitive factors for donation to relief campaigns. A causal model was constructed, based on social cognitive theory, research on

  20. Obstetric Outcomes of Mothers Previously Exposed to Sexual Violence.

    Directory of Open Access Journals (Sweden)

    Agnes Gisladottir

    Full Text Available There is a scarcity of data on the association of sexual violence and women's subsequent obstetric outcomes. Our aim was to investigate whether women exposed to sexual violence as teenagers (12-19 years of age or adults present with different obstetric outcomes than women with no record of such violence.We linked detailed prospectively collected information on women attending a Rape Trauma Service (RTS to the Icelandic Medical Birth Registry (IBR. Women who attended the RTS in 1993-2010 and delivered (on average 5.8 years later at least one singleton infant in Iceland through 2012 formed our exposed cohort (n = 1068. For each exposed woman's delivery, nine deliveries by women with no RTS attendance were randomly selected from the IBR (n = 9126 matched on age, parity, and year and season of delivery. Information on smoking and Body mass index (BMI was available for a sub-sample (n = 792 exposed and n = 1416 non-exposed women. Poisson regression models were used to estimate Relative Risks (RR with 95% confidence intervals (CI.Compared with non-exposed women, exposed women presented with increased risks of maternal distress during labor and delivery (RR 1.68, 95% CI 1.01-2.79, prolonged first stage of labor (RR 1.40, 95% CI 1.03-1.88, antepartum bleeding (RR 1.95, 95% CI 1.22-3.07 and emergency instrumental delivery (RR 1.16, 95% CI 1.00-1.34. Slightly higher risks were seen for women assaulted as teenagers. Overall, we did not observe differences between the groups regarding the risk of elective cesarean section (RR 0.86, 95% CI 0.61-1.21, except for a reduced risk among those assaulted as teenagers (RR 0.56, 95% CI 0.34-0.93. Adjusting for maternal smoking and BMI in a sub-sample did not substantially affect point estimates.Our prospective data suggest that women with a history of sexual assault, particularly as teenagers, are at increased risks of some adverse obstetric outcomes.

  1. Obstetric Outcomes of Mothers Previously Exposed to Sexual Violence. (United States)

    Gisladottir, Agnes; Luque-Fernandez, Miguel Angel; Harlow, Bernard L; Gudmundsdottir, Berglind; Jonsdottir, Eyrun; Bjarnadottir, Ragnheidur I; Hauksdottir, Arna; Aspelund, Thor; Cnattingius, Sven; Valdimarsdottir, Unnur A


    There is a scarcity of data on the association of sexual violence and women's subsequent obstetric outcomes. Our aim was to investigate whether women exposed to sexual violence as teenagers (12-19 years of age) or adults present with different obstetric outcomes than women with no record of such violence. We linked detailed prospectively collected information on women attending a Rape Trauma Service (RTS) to the Icelandic Medical Birth Registry (IBR). Women who attended the RTS in 1993-2010 and delivered (on average 5.8 years later) at least one singleton infant in Iceland through 2012 formed our exposed cohort (n = 1068). For each exposed woman's delivery, nine deliveries by women with no RTS attendance were randomly selected from the IBR (n = 9126) matched on age, parity, and year and season of delivery. Information on smoking and Body mass index (BMI) was available for a sub-sample (n = 792 exposed and n = 1416 non-exposed women). Poisson regression models were used to estimate Relative Risks (RR) with 95% confidence intervals (CI). Compared with non-exposed women, exposed women presented with increased risks of maternal distress during labor and delivery (RR 1.68, 95% CI 1.01-2.79), prolonged first stage of labor (RR 1.40, 95% CI 1.03-1.88), antepartum bleeding (RR 1.95, 95% CI 1.22-3.07) and emergency instrumental delivery (RR 1.16, 95% CI 1.00-1.34). Slightly higher risks were seen for women assaulted as teenagers. Overall, we did not observe differences between the groups regarding the risk of elective cesarean section (RR 0.86, 95% CI 0.61-1.21), except for a reduced risk among those assaulted as teenagers (RR 0.56, 95% CI 0.34-0.93). Adjusting for maternal smoking and BMI in a sub-sample did not substantially affect point estimates. Our prospective data suggest that women with a history of sexual assault, particularly as teenagers, are at increased risks of some adverse obstetric outcomes.

  2. Measurement of DNA repair deficiency in workers exposed to benzene

    International Nuclear Information System (INIS)

    Hallberg, L.M.; Au, W.W.; El Zein, R.; Grossman, L.


    We hypothesize that chronic exposure to environmental toxicants can induce genetic damage causing DNA repair deficiencies and leading to the postulated mutator phenotype of carcinogenesis. To test our hypothesis, a host cell reactivation (HCR) assay was used in which pCMVcat plasmids were damaged with UV light (175, 350 J/m 2 UV light), inactivating the chloramphenicol acetyltransferase reporter gene, and then transfected into lymphocytes. Transfected lymphocytes were therefore challenged to repair the damaged plasmids, reactivating the reporter gene. Xeroderma pigmentosum (XP) and Gaucher cell lines were used as positive and negative controls for the HCR assay. The Gaucher cell line repaired normally but XP cell lines demonstrated lower repair activity. Additionally, the repair activity of the XP heterozygous cell line showed intermediate repair compared to the homozygous XP and Gaucher cells. We used HCR to measure the effects of benzene exposure on 12 exposed and 8 nonexposed workers from a local benzene plant. Plasmids 175 J/m 2 and 350 J/m 2 were repaired with a mean frequency of 66% and 58%, respectively, in control workers compared to 71% and 62% in exposed workers. Conversely, more of the exposed workers were grouped into the reduced repair category than controls. These differences in repair capacity between exposed and control workers were, however, not statistically significant. The lack of significant differences between the exposed and control groups may be due to extremely low exposure to benzene (<0.3 ppm), small population size, or a lack of benzene genotoxicity at these concentrations. These results are consistent with a parallel hprt gene mutation assay. 26 refs., 4 figs., 2 tabs

  3. Micronuclei frequency in albino rats exposed to high natural radiation

    International Nuclear Information System (INIS)

    Aneesh, D.; Godwin Wesley, S.


    Genotoxicity and DNA damage endpoints are used to evaluate results in the context of cell survival. Genotoxicity in mammalian cells is monitored mostly by using cytokinesis-block micronucleus (CBMN) assay. The score of micronuclei (MN) in peripheral blood lymphocytes can be used as a biomarker and also as a bio-dosimeter of radiation exposure. In the present study the effect of natural radiation on albino rats has been investigated, to find out if there is any increase in MN frequency in peripheral blood lymphocytes. Animals at the age of 2-3 weeks were exposed to natural radiation, at the dose of 10.38 μGyh -1 for a period of 6 months. A parallel control set was also maintained (0.12 μGy h -1 '). Blood samples were collected from both test (exposed to natural radiation) and control rats. Lymphocyte culture was done following 'microculture techniques' for 72 h. Cytochalasin B, at a concentration of 6.0 μg/ml, was added to the lymphocyte cultures at 44 h to block cytokinesis. The frequency of MN was evaluated by scoring a total of 1000 binucleated (BN) cells from one slide. The frequency of MN among the rats exposed to natural radiation was found to be 1.83±0.05 per 1000 BN cells and in the control it was 1.82±0.07 per 1000 BN cells. No statistically significant difference in the MN frequencies of exposed and control groups (p>0.05) was seen. The lower MN frequency in natural radiation exposed rats could be an indication of adaptive response. (author)

  4. Increased gluconeogenesis in rats exposed to hyper-G stress

    International Nuclear Information System (INIS)

    Daligcon, B.C.; Oyama, J.; Hannak, K.


    The role of gluconeogenesis on the increase in plasma glucose and liver glycogen of rats exposed to hyper-G (radial acceleration) stress was determined. Overnight-fasted, male Sprague-Dawley rats (250-300 g) were injected i.p. with uniformly labeled 14 C lactate, alanine, or glycerol (5 μCi/rat) and immediately exposed to 3.1 G for 0.25, 0.50, and 1.0 hr. 14 C incorporation of the labeled substrates into plasma glucose and liver glycogen was measured and compared to noncentrifuged control rats injected in a similar manner. Significant increases in 14 C incorporation of all three labeled substrates into plasma glucose were observed in centrifuged rats at all exposure periods; 14 C incorporation into liver glycogen was significantly increased only at 0.50 and 1.0 hr. The i.p. administration (5 mg/100-g body wt) of 5-methoxyindole-2-carboxylic acid, a potent gluconeogenesis inhibitor, prior to centrifugation blocked the increase in plasma glucose and liver glycogen during the first hour of centrifugation. The increase in plasma glucose and liver glycogen was also abolished in adrenodemedullated rats exposed to centrifugation for 1.0 hr. Propranolol, a beta-adrenergic blocker, suppressed the increase in plasma glucose of rats exposed to centrifugation for 0.25 hr. From the results of this study, it is concluded that the initial, rapid rise in plasma glucose as well as the increase in liver glycogen of rats exposed to hyper-G stress can be attributed to an increased rate of gluconeogenesis, and that epinephrine plays a dominant role during the early stages of exposure to centrifugation. 11 references, 3 tables

  5. Biological behaviour of buccal cells exposed to blue light

    International Nuclear Information System (INIS)

    Gritsch, Kerstin; Ponsonnet, Laurence; Schembri, Catherine; Farge, Pierre; Pourreyron, Laurence; Grosgogeat, Brigitte


    Blue light is used in dental practise to cure resin-based materials, but the path of the light often includes oral tissues such as gingival tissues. While adverse effects of blue light exposure on cells - such as retina cells - are well known, few studies have investigated the impact of blue light exposure on oral cells. The aim of the present in vitro study was to assess the biological effects of blue light emitted by two dental curing devices (a plasma-arc and a light-emitting diode curing unit) on human gingival fibroblasts. Light intensities and light-induced temperature rise were respectively measured with a radiometer and a thermocouple. Cellular response to blue light exposure was assessed by the observation of cell morphology (scanning electron microscopy) and the estimation of cell mitochondrial activity (MTT assay). Light intensities measured at the clinical distance were 488 ± 42 mW/cm 2 for the plasma-arc unit and ranged from 61 ± 5 to 140 ± 16 mW/cm 2 for the light-emitting diodes unit, according to the curing program used. The highest temperature rise was 0.5 and 3.5 deg. C for exposure to the plasma-arc light and to the light-emitting diodes light, respectively. Results showed no differences between exposed- and non-exposed cells in regards to cell morphology. However, cells exposed to blue light presented an increased mitochondrial activity compared to control cells (non-exposed), and mostly those exposed to plasma-arc light

  6. Are students exposed to tobacco smoke in German schools?

    Directory of Open Access Journals (Sweden)

    Heinrich, Joachim


    Full Text Available The aim of this study was to investigate to which extent 6th grade school children are exposed to tobacco smoke by others. As biomarker for the exposure to tobacco smoke nicotine and cotinine were measured in the urine. Our study population consisted of 771 schoolchildren aged 11-14 years who according to a questionnaire did not smoke. In addition we analysed the data of 459 school children who were not exposed to tobacco smoke at home. The nicotine and cotinine concentrations in the spontaneous urine sample were determined by HPLC methods.On average in about 20% of all non-smoking children, who were not exposed to tobacco smoke at home, biomarker (nicotine or cotinine were detected in the urine. The percentage of the detected biomarker values (nicotine and/or cotinine in the urine of the school children varied between 0% and 50% between schools. In addition we determined the proportion of smoking classmates per school. No positive association was found between the detected biomarker values of the non-smoking school children not exposed to tobacco smoke at home and the proportion of smokers per school. The concentration of biomarker depending on the time of day the urine samples were collected showed higher nicotine and cotinine values when the urine sample was collected between 10 and 12 o'clock in the morning compared to urine samples collected between 7 and 10 a.m.In spite of the limitations our study provides some evidence that children are exposed involuntarily to tobacco smoke by others at school. That is why our results support the requirement of a general legal ban on smoking for teachers, the school staff and students.

  7. Cancer risk in men exposed in utero to diethylstilbestrol. (United States)

    Strohsnitter, W C; Noller, K L; Hoover, R N; Robboy, S J; Palmer, J R; Titus-Ernstoff, L; Kaufman, R H; Adam, E; Herbst, A L; Hatch, E E


    An association between prenatal diethylstilbestrol (DES) exposure and cancer in men, especially testicular cancer, has been suspected, but findings from case-control studies have been inconsistent. This study was conducted to investigate the association between prenatal DES exposure and cancer risk in men via prospective follow-up. A total of 3613 men whose prenatal DES exposure status was known were followed from 1978 through 1994. The overall and site-specific cancer incidence rates among the DES-exposed men were compared with those of the unexposed men in the study and with population-based rates. The relative rate (RR) was used to assess the strength of the association between prenatal DES exposure and cancer development. All statistical tests were two-sided. Overall cancer rates among DES-exposed men were similar to those among unexposed men (RR = 1.07; 95% confidence interval [CI] = 0.58 to 1.96) and to national rates (RR = 0.99; 95% CI = 0.65 to 1.44). Testicular cancer may be elevated among DES-exposed men, since the RRs for testicular cancer were 3.05 (95% CI = 0.65 to 22.0) times those of unexposed men in the study and 2.04 (95% CI = 0.82 to 4.20) times those of males in the population-based rates. The higher rate of testicular cancer in the DES-exposed men is, however, also compatible with a chance observation. To date, men exposed to DES in utero do not appear to have an increased risk of most cancers. It remains uncertain, however, whether prenatal DES exposure is associated with testicular cancer.

  8. Nutritional Status among the Children of Age Group 5-14 Years in Selected Arsenic Exposed and Non-Exposed Areas of Bangladesh.

    Directory of Open Access Journals (Sweden)

    Mohammad Rezaul Karim


    Full Text Available To assess and compare the nutritional status of children aged 5-14 years in arsenic exposed and non- exposed areas.It was a cross sectional study conducted on 600 children of age 5-14 years from arsenic exposed and non-exposed areas in Bangladesh. Designed questionnaire and check list were used for collection of data. To estimate BMI necessary anthropometric measurements of the studied children were done. Dietary intakes of the study children were assessed using 24-hours recall method.The difference of socio-economic conditions between the children of exposed area and non-exposed area was not significant. On an average the body mass index was found to be significantly (p < 0.01 lower among the children of arsenic exposed area (49% in comparison to that of children in non-exposed area (38%. Stunting (p < 0.01, wasting (p < 0.05 and underweight (p < 0.05 were significantly higher in exposed group in comparison to non-exposed group. No significant difference of nutrition intake was found between exposed and non-exposed children as well as thin and normal children.In this study children exposed to arsenic contaminated water were found to be suffered from lower nutritional status.

  9. Nutritional Status among the Children of Age Group 5-14 Years in Selected Arsenic Exposed and Non-Exposed Areas of Bangladesh. (United States)

    Rezaul Karim, Mohammad; Ahmad, Sk Akhtar


    To assess and compare the nutritional status of children aged 5-14 years in arsenic exposed and non- exposed areas. It was a cross sectional study conducted on 600 children of age 5-14 years from arsenic exposed and non-exposed areas in Bangladesh. Designed questionnaire and check list were used for collection of data. To estimate BMI necessary anthropometric measurements of the studied children were done. Dietary intakes of the study children were assessed using 24-hours recall method. The difference of socio-economic conditions between the children of exposed area and non-exposed area was not significant. On an average the body mass index was found to be significantly (p < 0.01) lower among the children of arsenic exposed area (49%) in comparison to that of children in non-exposed area (38%). Stunting (p < 0.01), wasting (p < 0.05) and underweight (p < 0.05) were significantly higher in exposed group in comparison to non-exposed group. No significant difference of nutrition intake was found between exposed and non-exposed children as well as thin and normal children. In this study children exposed to arsenic contaminated water were found to be suffered from lower nutritional status.

  10. Chest X ray examination of workers exposed to pneumoconiosis risk

    International Nuclear Information System (INIS)

    Indovina, P.L.; Reggiani, A.; Calicchia, A.; Nicolosi, A.


    Chest X-ray examination of workers exposed to pneumoconiosis risk: critical analysis of legal and radiation protection aspects. Chest X-ray examination is one of the most common radiological examinations practised in Italy. According to Presidential Decree 1124/65, workers exposed to risk of asbestosis and silicosis must undergo a chest radiography once a year, on occasion of the periodic medical examination. Basic requirements aimed at the radiation protection of the patient must therefore be complied with, and optimization of the chest radiography execution procedures is required. This paper illustrates the results obtained with the implementation of the NEXT programme in Italy for this kind of X-ray examination. The main objective of the NEXT programme is the optimization of radiological techniques. On the basis of the most recent publications in the field of radiation protection, a critical analysis is made of the laws in force in Italy

  11. Mental health interventions for children exposed to disasters and terrorism. (United States)

    Pfefferbaum, Betty; Newman, Elana; Nelson, Summer D


    The purpose of this review is to describe interventions used with children who are exposed to disasters and terrorism and to present information about the potential benefits of these interventions. A literature search conducted in January 2013 using relevant databases and literature known to the authors that was not generated by the search yielded a total of 85 studies appropriate for review. Intervention approaches used with children exposed to disasters and terrorism included preparedness interventions, psychological first aid, psychological debriefing, psychoeducation, cognitive behavioral techniques, exposure and narrative techniques, eye movement desensitization and reprocessing, and traumatic grief interventions. The investigation of these interventions is complex, and studies varied in methodological rigor (e.g., sample size, the use of control groups, outcomes measured). Given the limitations in the currently available empirical information, this review integrates the literature, draws tentative conclusions about the current state of knowledge, and suggests future directions for study.

  12. Structural analysis of osseous rests exposed to heating

    International Nuclear Information System (INIS)

    Medina, C.; Tiesler, V.; Quintana, P.; Oliva, A.I.


    Heat exposed human remains present physical and chemical changes that, when analysed, may provide important indications about the type of heating they were exposed. This information, jointly with that of the archaeological context, allows us to know about the cultural practices of the past from a methodological perspective that actually, has not been explored sufficiently. The present investigation applies a series of structural parameters of bone in the evaluation of skeletal sample from the archaeological site of Calakmul, which exhibits signs of thermal exposure. Results on the Pre hispanic specimens are compared to those obtained from an experimental series of animal bone, which was submitted to different types of heat with the objective to contribute with new data on the forms of heating and their role in ancient Maya society. (Author)

  13. Genomic damage in children accidentally exposed to ionizing radiation

    DEFF Research Database (Denmark)

    Fucic, A; Brunborg, G; Lasan, R


    During the last decade, our knowledge of the mechanisms by which children respond to exposures to physical and chemical agents present in the environment, has significantly increased. Results of recent projects and programmes focused on children's health underline a specific vulnerability of chil...... and efficient preventive measures, by means of a better knowledge of the early and delayed health effects in children resulting from radiation exposure....... of children to environmental genotoxicants. Environmental research on children predominantly investigates the health effects of air pollution while effects from radiation exposure deserve more attention. The main sources of knowledge on genome damage of children exposed to radiation are studies performed...... after the Chernobyl nuclear plant accident in 1986. The present review presents and discusses data collected from papers analyzing genome damage in children environmentally exposed to ionizing radiation. Overall, the evidence from the studies conducted following the Chernobyl accident, nuclear tests...

  14. Chromosome aberrations in pesticide-exposed greenhouse workers

    DEFF Research Database (Denmark)

    Lander, B F; Knudsen, Lisbeth E.; Gamborg, M O


    OBJECTIVES: The aim of this study was to investigate the possibility of subtoxic exposure to pesticides causing chromosome aberrations in greenhouse workers. METHODS: In a cross-sectional and prospective study design chromosome aberration frequencies in cultured lymphocytes were examined for 116...... greenhouse workers exposed to a complex mixture of almost 50 insecticides, fungicides, and growth regulators and also for 29 nonsmoking, nonpesticide-exposed referents. RESULTS: The preseason frequencies of chromosome aberrations were slightly but not statistically significantly elevated for the greenhouse...... workers when they were compared with the referents. After a summer season of pesticide spraying in the greenhouses, the total frequencies of cells with chromosome aberrations were significantly higher than in the preseason samples (P=0.02) and also higher than for the referents (P=0.05). This finding...

  15. Granulocytes enzymes as a biomarker of radiotoxicity in exposed workers

    International Nuclear Information System (INIS)

    Milacic, S.; Jovicic, D.; Tanaskovic, I.; Marinkovic, O.; Milacic, S.)


    When radionuclide reaches the organism it causes internal irradiation and the lesions may be long lasting in various tissues. Enzymes in leukocytes will be used as a biomarkers of contamination with radio-nuclide in nuclear medicine workers. The analysed group had been consisted of 74 workers, exposed to radioactive isotopes J 131 and mTc 99 in nuclear medicine. Duration of occupational exposure (DOE) varied, so the groups with DOE of 1-5, 6-15, and 16-30 years, were compared to one another. The control group consisted of 52 subjects exposed to radionuclides (Cs 137 ) from environmental. Alkaline phosphatases and myeloperoxidase activity were inhibited in the granulocytes. The neutrophilic granulocytes count was lower while the number of eosinophils was higher

  16. Cytogenetic study of in utero exposed individuals, 2

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Masahiro; Honda, Takeo


    In 20 persons exposed in uterus to atomic radiation, chromosomes in the peripheral lymphocytes were examined using G-band differential staining and conventional Giemsa staining techniques. The subjects were divided into Group A of the mothers receiving 17 - 535 rad and Group B of the mothers receiving 0 rad. Chromosome aberrations were observed in 72 (5%) of 1,463 cells in Group A and in 19 (1%) of 1503 cells in Group B. Most of the chromosome aberrations were stable type involving translocation, inversion, and deletion. In one person whose mother was exposed to 453 rad, structural chromosome aberrations were observed in 53 (38%) of 141 cells. Furthermore, 11 cells had two kinds of clones. This finding may provide clues for elucidating the promotion of cloning of cells with stable type structural chromosome aberrations due to in uterus exposure to high doses of atomic radiation. (Namekawa, K.).

  17. Cytogenetic study of in utero exposed individuals, 2

    International Nuclear Information System (INIS)

    Itoh, Masahiro; Honda, Takeo


    In 20 persons exposed in uterus to atomic radiation, chromosomes in the peripheral lymphocytes were examined using G-band differential staining and conventional Giemsa staining techniques. The subjects were divided into Group A of the mothers receiving 17 - 535 rad and Group B of the mothers receiving 0 rad. Chromosome aberrations were observed in 72 (5 %) of 1,463 cells in Group A and in 19 (1 %) of 1503 cells in Group B. Most of the chromosome aberrations were stable type involving translocation, inversion, and deletion. In one person whose mother was exposed to 453 rad, structural chromosome aberrations were observed in 53 (38 %) of 141 cells. Furthermore, 11 cells had two kinds of clones. This finding may provide clues for elucidating the promotion of cloning of cells with stable type structural chromosome aberrations due to in uterus exposure to high doses of atomic radiation. (Namekawa, K.)

  18. English exposed common mistakes made by Chinese speakers

    CERN Document Server

    Hart, Steve


    Having analysed the most common English errors made in over 600 academic papers written by Chinese undergraduates, postgraduates, and researchers, Steve Hart has written an essential, practical guide specifically for the native Chinese speaker on how to write good academic English. English Exposed: Common Mistakes Made by Chinese Speakers is divided into three main sections. The first section examines errors made with verbs, nouns, prepositions, and other grammatical classes of words. The second section focuses on problems of word choice. In addition to helping the reader find the right word, it provides instruction for selecting the right style too. The third section covers a variety of other areas essential for the academic writer, such as using punctuation, adding appropriate references, referring to tables and figures, and selecting among various English date and time phrases. Using English Exposed will allow a writer to produce material where content and ideas-not language mistakes-speak the loudest.

  19. Personality and psychopathological profiles in individuals exposed to mobbing. (United States)

    Girardi, Paolo; Monaco, Edoardo; Prestigiacomo, Claudio; Talamo, Alessandra; Ruberto, Amedeo; Tatarelli, Roberto


    Increasingly, mental health and medical professionals have been asked to assess claims of psychological harm arising from harassment at the workplace, or "mobbing." This study assessed the personality and psychopathological profiles of 146 individuals exposed to mobbing using validity, clinical, and content scales of the Minnesota Multiphasic Personality Inventory 2. Profiles and factor analyses were obtained. Two major dimensions emerged among those exposed to mobbing: (a) depressed mood, difficulty in making decisions, change-related anguish, and passive-aggressive traits (b) somatic symptoms, and need for attention and affection. This cross-sectional pilot study provides evidence that personality profiles of mobbing victims and psychological damage resulting from mobbing may be evaluated using standardized assessments, though a longitudinal study is needed to delineate cause-and-effect relationships.

  20. Corrosion of beryllium exposed to celotex and water

    International Nuclear Information System (INIS)

    Hill, M.A.; Butt, D.P.; Lillard, R.S.


    Celotex is a commercial rigid cellulose fiberboard product primarily used in the building construction industry. Currently celotex is being used as a packing material in AL-R8 containers. Ion chromatography of celotex packing material at Lawrence Livermore National Laboratory (LLNL) has indicated that this material contains aggressive anions, including chloride, which may accelerate corrosion. It is well known that beryllium is susceptible to pitting corrosion when exposed to chloride containing environments. Levy noted pitting in beryllium at the open circuit potential when exposed to 0.1 M NaCl solution. This investigation attempts to evaluate the potential risk of accelerated beryllium corrosion from celotex and water which may occur naturally when celotex dust comes into contact with moisture from the atmosphere

  1. Upgrade and Design of Coastal Structures Exposed to Climate Changes

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen Quvang Harck

    This thesis “Upgrade and Design of Coastal Structures Exposed to Climate Changes” evaluates the performance of existing types of structures when exposed to climate changes. This includes also the potential of using cost‐sharing multipurpose structures for protection against the effects of future...... climate changes. The thesis consists of three parts. The first part evaluates the performance of existing design formulae for estimation of wave actions on structures, especially in shallow water since these structures are most vulnerable to the rising sea water levels caused by climate changes. Existing...... of coastal protection structures, which are extended to a wider range of wave conditions, and which can be used to more accurately estimate the influence from climate changes. In the second part of the thesis, the extended and modified formulae are used in case studies to evaluate the influence from climate...

  2. Upgrade and Design of Coastal Structures Exposed to Climate Changes

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen Quvang Harck

    This thesis "Upgrade and Design of Coastal Structures Exposed to Climate Changes" evaluates the performance of existing types of structures when exposed to climate changes. This includes also the potential of using cost‐sharing multipurpose structures for protection against the effects of future...... climate changes. The thesis consists of three parts. The first part evaluates the performance of existing design formulae for estimation of wave actions on structures, especially in shallow water since these structures are most vulnerable to the rising sea water levels caused by climate changes. Existing...... of coastal protection structures, which are extended to a wider range of wave conditions, and which can be used to more accurately estimate the influence from climate changes. In the second part of the thesis, the extended and modified formulae are used in case studies to evaluate the influence from climate...

  3. Warfarin binding to plasma of workers exposed to toluene diisocyanate

    Energy Technology Data Exchange (ETDEWEB)

    Bachmann, K.; Shapiro, R.; Forney, R.B. Jr.


    The extent of (14)C-warfarin binding to plasma proteins was evaluated in a group of normal, healthy volunteers and in two groups of individuals occupationally exposed to toluene diisocyanate (TDI). Plasma binding was assessed by ultrafiltration after the addition of racemic (14)C-warfarin to a final concentration of 0.8 microgram/ml. Chronic occupational exposure to TDI did not affect the extent of warfarin binding since warfarin free fractions (normalized to an albumin concentration of 4.5 g/dl) were 1.09 +/- 0.23 (mean +/- SD), 0.98 +/- 0.19, and 0.97 +/- 0.15 for controls and the two groups of TDI-exposed individuals, respectively.

  4. Immunotoxic effects of iodine-131 in prenatally exposed rats

    International Nuclear Information System (INIS)

    Cole, D.A.; Stevens, R.H.; Lindholm, P.A.; Cheng, H.F.


    Present results suggest that offspring exposed in utero to radioactive iodine-131 develop a measureable cell-mediated immune (CMI) response. Regnant Fischer F344 inbred rats were exposed to 370 kBg to 3.7 MBg (10 to 100 μCi) Na 131I on 16 to 18 days of gestation and evaluated for CMI responsiveness 2 to 3 months post exposure using an 125I radiolabeled membrane release assay. Current data suggest that not only the F1, but also the F2 pups develop a measureable CMI response. In order to determine whether other immune functions are altered studies have been initiated to evaluate the immunotoxic effect of prenatal exposure to 131I. These studies include the evaluation of the delayed hypersensitivity response and the blastogenic responses to phytoheemagglutinin, concanavalin A, and lipopolysaccharide

  5. Studies on health risks to persons exposed to plutonium

    International Nuclear Information System (INIS)

    Voelz, G.L.; Stebbings, J.H. Jr.; Healy, J.W.; Hempelmann, L.H.


    Two studies on Los Alamos workers exposed to plutonium have shown no increase in cancers of the lung, bone, and liver, three principal cancers of interest following plutonium deposition. A clinical study of 26 workers exposed 32 years ago shows no cases of cancer other than two skin cancers that were excised successfully. A mortality study of 224 workers, all persons with estimated deposition of 10 nCi or moe in 1974, showed no excess of mortality due to any cause. No bone or liver cancers were present, while one death due to lung cancer was observed as compared to an expected three cases. These negative findings on such small groups are not able to prove or disprove the validity of commonly used risk estimates as recommended in the 1972 BEIR and 1977 UNSCEAR reports, but the data do indicate that much higher risk estimates are not warranted

  6. Studies on health risks to persons exposed to plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Voelz, G.L.; Stebbings, J.H. Jr.; Healy, J.W.; Hempelmann, L.H.


    Two studies on Los Alamos workers exposed to plutonium have shown no increase in cancers of the lung, bone, and liver, three principal cancers of interest following plutonium deposition. A clinical study of 26 workers exposed 32 years ago shows no cases of cancer other than two skin cancers that were excised successfully. A mortality study of 224 workers, all persons with estimated deposition of 10 nCi or moe in 1974, showed no excess of mortality due to any cause. No bone or liver cancers were present, while one death due to lung cancer was observed as compared to an expected three cases. These negative findings on such small groups are not able to prove or disprove the validity of commonly used risk estimates as recommended in the 1972 BEIR and 1977 UNSCEAR reports, but the data do indicate that much higher risk estimates are not warranted.

  7. Potential contribution of exposed resin to ecosystem emissions of monoterpenes (United States)

    Eller, Allyson S. D.; Harley, Peter; Monson, Russell K.


    Conifers, especially pines, produce and store under pressure monoterpene-laden resin in canals located throughout the plant. When the plants are damaged and resin canals punctured, the resin is exuded and the monoterpenes are released into the atmosphere, a process that has been shown to influence ecosystem-level monoterpene emissions. Less attention has been paid to the small amounts of resin that are exuded from branches, expanding needles, developing pollen cones, and terminal buds in the absence of any damage. The goal of this study was to provide the first estimate of the potential of this naturally-exposed resin to influence emissions of monoterpenes from ponderosa pine (Pinus ponderosa) ecosystems. When resin is first exuded as small spherical beads from undamaged tissues it emits monoterpenes to the atmosphere at a rate that is four orders of magnitude greater than needle tissue with an equivalent exposed surface area and the emissions from exuded beads decline exponentially as the resin dries. We made measurements of resin beads on the branches of ponderosa pine trees in the middle of the growing season and found, on average, 0.15 cm2 of exposed resin bead surface area and 1250 cm2 of total needle surface area per branch tip. If the resin emerged over the course of 10 days, resin emissions would make up 10% of the ecosystem emissions each day. Since we only accounted for exposed resin at a single point in time, this is probably an underestimate of how much total resin is exuded from undamaged pine tissues over the course of a growing season. Our observations, however, reveal the importance of this previously unrecognized source of monoterpenes emitted from pine forests and its potential to influence regional atmospheric chemistry dynamics.

  8. Examination of respiratory tract in workers occupationally exposed to beryllium

    International Nuclear Information System (INIS)

    Cianciara, M.; Swiatkowski, J.


    In a group (30) occupationally exposed to beryllium below the Maximum Allowed Concentration, deviations from the norm were found in 13% of chest x rays and impairments of lung ventilatory reserves in 46%. The low intensity and non-specific character of the changes did not allow confirmation of connection with occupational exposure. Radiological examination of the lungs, expanded functional testing of the respiratory system and measurements of blood gases are recommended to identify workers with respiratory changes at an early stage. (UK)

  9. Haemogram of adult Clarias gariepinus exposed to chronic levels of ...

    African Journals Online (AJOL)

    Clarias gariepinus (mean weight, 850 ± 60 g) mean length, 38.75 ± 6.7 cm) were exposed individually to four concentrations of Roundup, containing 360g/l glyphosate in the form of 480g/l isopropylamine salt (1.5, 3.0, 4.5 and 6.0 mg/l) and a control (0 mg/l), five replicates per concentration for 70 days in static renewal ...

  10. Limit State of Trapezoidal Metal Sheets Exposed to Concentrated Load


    Kateřina Jurdová


    In most industrial compounds are used trapezoidal metal sheets like a roof decks. These trapezoidal metal sheets are exposed by concentrated loads, usually by service loads arise from installation of air distribution, sanitary distribution, sprinkler system or wiring installation. In objects of public facilities (like shopping centre, tennis hall, etc.) they can be used for hanging advertising posters etc, too. These systems work as “building kit”. These anchoring systems are represented by c...

  11. Toxicity of lunar dust assessed in inhalation-exposed rats. (United States)

    Lam, Chiu-wing; Scully, Robert R; Zhang, Ye; Renne, Roger A; Hunter, Robert L; McCluskey, Richard A; Chen, Bean T; Castranova, Vincent; Driscoll, Kevin E; Gardner, Donald E; McClellan, Roger O; Cooper, Bonnie L; McKay, David S; Marshall, Linda; James, John T


    Humans will again set foot on the moon. The moon is covered by a layer of fine dust, which can pose a respiratory hazard. We investigated the pulmonary toxicity of lunar dust in rats exposed to 0, 2.1, 6.8, 20.8 and 60.6 mg/m(3) of respirable-size lunar dust for 4 weeks (6 h/day, 5 days/week); the aerosols in the nose-only exposure chambers were generated from a jet-mill ground preparation of a lunar soil collected during the Apollo 14 mission. After 4 weeks of exposure to air or lunar dust, groups of five rats were euthanized 1 day, 1 week, 4 weeks or 13 weeks after the last exposure for assessment of pulmonary toxicity. Biomarkers of toxicity assessed in bronchoalveolar fluids showed concentration-dependent changes; biomarkers that showed treatment effects were total cell and neutrophil counts, total protein concentrations and cellular enzymes (lactate dehydrogenase, glutamyl transferase and aspartate transaminase). No statistically significant differences in these biomarkers were detected between rats exposed to air and those exposed to the two low concentrations of lunar dust. Dose-dependent histopathology, including inflammation, septal thickening, fibrosis and granulomas, in the lung was observed at the two higher exposure concentrations. No lesions were detected in rats exposed to ≤6.8 mg/m(3). This 4-week exposure study in rats showed that 6.8 mg/m(3) was the highest no-observable-adverse-effect level (NOAEL). These results will be useful for assessing the health risk to humans of exposure to lunar dust, establishing human exposure limits and guiding the design of dust mitigation systems in lunar landers or habitats.

  12. Under-exposed. And if radiations were good for you?

    International Nuclear Information System (INIS)

    Gay, Michel


    This book is in fact a synthesis of an American publication (Under-Exposed). The author, with its characteristic style, aims at giving a positive perception of nuclear energy, at denying catastrophist speeches on nuclear energy, and more particularly on radioactivity: low doses are not dangerous, and even can be useful for our health and well-being, notably in many spa resorts. Thus, he also aims at struggling against what he considers as an ecological obscurantism

  13. Environmental Monitoring Of Microbiological Laboratory: Expose Plate Method

    International Nuclear Information System (INIS)

    Yahaya Talib; Othman Mahmud; Noraisyah Mohd Yusof; Asmah Mohibat; Muhamad Syazwan Zulkifli


    Monitoring of microorganism is important and conducted regularly on environment of microbiological laboratory at Medical Technology Division. Its objective is to ensure the quality of working environment is maintained according to microbial contamination, consequently to assure the quality of microbiological tests. This paper presents report of environmental monitoring since year 2007. The test involved was bacterial colony counts after the growth media was exposed to air at identified location. (author)

  14. End stage renal disease among ceramic workers exposed to silica


    Rapiti, E.; Sperati, A.; Miceli, M.; Forastiere, F.; Di, L; Cavariani, F.; Goldsmith, D. F.; Perucci, C. A.


    OBJECTIVES: To evaluate whether ceramic workers exposed to silica experience an excess of end stage renal disease. METHODS: On the basis of a health surveillance programme, a cohort of 2980 male ceramic workers has been enrolled during the period 1974-91 in Civitacastellana, Lazio, Italy. For each worker, employment history, smoking data, and x ray film readings were available. The vital status was ascertained for all cohort members. All 2820 people still alive and resident in the Lazio...

  15. Humidity Buildup in Electronic Enclosures Exposed to Constant Conditions

    DEFF Research Database (Denmark)

    Conseil, Helene; Staliulionis, Zygimantas; Jellesen, Morten Stendahl


    Electronic components and devices are exposed to a wide variety of climatic conditions, therefore the protection of electronic devices from humidity is becoming a critical factor in the system design. The ingress of moisture into typical electronic enclosures has been studied with defined paramet....... The moisture buildup inside the enclosure has been simulated using an equivalent RC circuit consisting of variables like controlled resistors and capacitors to describe the diffusivity, permeability, and storage in polymers....

  16. Analysis of uranium in urine of persons occupationaly exposed

    International Nuclear Information System (INIS)

    Nunes, S.C.


    A technique of uranium analysis in urine of persons occupationaly exposed, using the fluorimetric method is proposed. Two procedures for the determination are presented: the first employs platinum dishes, obtaining a detection limit of 1 ppb and the second one, using aluminium dishes, shows a detection limit of 100 ppb. Uranium and urine physico-chemical characteristics are described, as well as norms for the exposition of workers to uranium. (M.A.C.) [pt

  17. Urine mutagenicity of steel workers exposed to coke oven emissions

    Energy Technology Data Exchange (ETDEWEB)

    De Meo, M.P.; Dumenil, G.; Botta, A.H.; Laget, M.; Zabaloueff, V.; Mathias, A.


    Urine mutagenicity of 19 individuals was investigated at a steel mill. All the subjects worked on the coal processing unit. Urine samples were collected at the end of a working day. Urine samples of two exposed workers were collected at the end of two periods of rest and two periods of working. Mutagens were extracted on XAD-2 resin and tested by the Salmonella microsomal assay and the SOS spot test. Mutagenic potencies of exposed smokers and exposed non-smokers were 8.62 +/- 6.56 and 1.1 +/- 0.48 revertants/mg creatinine respectively with Salmonella typhimurium strain TA98 + S9. Both values were significantly higher than those of unexposed smokers and non-smokers (5.07 +/- 3.33 and 0.47 +/- 0.72 revertants/mg creatinine respectively). The urinary mutagenic potency of the two exposed individuals increased at the end of periods of working (15.97 +/- 2.57 revertants/mg creatinine) and decreased at the end of periods of rest (12.31 +/- 2.45 revertants/mg creatinine). Urinary mutagens were detected with S. typhimurium strain TA100 + S9 to a lesser extent. No direct-acting mutagens were detected by the SOS spot test. Atmospheric benzo(a)pyrene (BaP) were also measured by h.p.l.c. on the coke battery. BaP concentrations ranged between 0.01 and 0.6 microgram/m3 air at the different working sites. Biological monitoring with short-term tests is discussed.

  18. Children exposed to domestic violences assessment and psychopathology /


    Olaya Guzmán, Beatriz


    Descripció del recurs: 17-06-2010 Exposure to domestic violence is a current, complex concern with negative aftermath on the child's mental health. Aim: to answer the following questions about the effects that this exposure has on children's mental health: a) what should be assessed; b) what kind of psychopathology do outpatient exposed children have; c) which characteristics of the situation are more influential; and d) what is the role of parenting styles. Method: A retrospective cohort ...

  19. Entanglement witnesses arising from exposed positive linear maps


    Ha, Kil-Chan; Kye, Seung-Hyeok


    We consider entanglement witnesses arising from positive linear maps which generate exposed extremal rays. We show that every entanglement can be detected by one of these witnesses, and this witness detects a unique set of entanglement among those. Therefore, they provide a minimal set of witnesses to detect all entanglement in a sense. Furthermore, if those maps are indecomposable then they detect large classes of entanglement with positive partial transposes which have nonempty relative int...

  20. Behavior of cardiac variables in animals exposed to cigarette smoke

    Directory of Open Access Journals (Sweden)

    Sergio Alberto Rupp de Paiva


    Full Text Available OBJECTIVE: To assess the behavior of cardiac variables in animals exposed to cigarette smoke. METHODS: Two groups of Wistar rats were studied as follows: control group (C, comprising 28 animals; and smoking group (S, comprising 23 animals exposed to cigarette smoke for 30 days. Left ventricular cardiac function was assessed in vivo with transthoracic echocardiography, and myocardial performance was analyzed in vitro in preparations of isolated left ventricular papillary muscle. The cardiac muscle was assessed in isometric contractions with an extracellular calcium concentration of 2.5 mmol/L. RESULTS: No statistical difference was observed in the values of the body variables of the rats and in the mechanical data obtained from the papillary muscle between the control and smoking groups. The values of left ventricular systolic diameter were significantly greater in the smoking animals than in the control animals (C= 3.39 ± 0.4 mm and S= 3.71 ± 0.51 mm, P=0.02. A significant reduction was observed in systolic shortening fraction (C= 56.7 ± 4.2% and S= 53.5 ± 5.3%, P=0.02 and in ejection fraction (C= 0.92 ± 0.02 and S= 0.89 ± 0.04, P=0.01. CONCLUSION: The rats exposed to cigarette smoke had a reduction in left ventricular systolic function, although their myocardial function was preserved.

  1. Increased oxidative stress in infants exposed to passive smoking. (United States)

    Aycicek, Ali; Erel, Ozcan; Kocyigit, Abdurrahim


    The purpose of this study was to assess the effect of passive cigarette smoking on the oxidative and anti-oxidative status of plasma in infants. Eighty-four infants aged 6-28 weeks were divided into two groups: the study group included infants who had been exposed to passive smoking via at least five cigarettes per day for at least the past 6 weeks at home, while the control group included infants who had never been exposed to passive smoking. The antioxidative status of plasma was assessed by the measurement of individual antioxidant components: vitamin C, albumin, bilirubin, uric acid, thiol contents and total antioxidant capacity (TAC 1 and TAC 2). Oxidative status was assessed by the determination of total peroxide levels and the oxidative stress index (OSI 1 and OSI 2). Plasma vitamin C, thiol concentration and TAC 1 and TAC 2 levels were significantly lower, whereas plasma total peroxide levels and OSI 1 and OSI 2 were significantly higher, in passive smoking infants than in the controls (Pantioxidant defence system in infants, and exposes them to potent oxidative stress.

  2. Differential cardiac effects in rats exposed to atmospheric ... (United States)

    The results of this study demonstrate that atmospheric smog generated from both isoprene and toluene cause cardiac effects in rats. In addition, it appears that smog from toluene is more toxic in terms of cardiac arrhythmogenicity. Smog, which is a complex mixture of particulate matter and gaseous irritants (ozone, sulfur dioxide, reactive aldehydes), as well as components which react with sunlight to form secondary pollutants, has recently been linked to increased risk of adverse cardiac responses. The components, and therefore health effects, of atmospheric smog are determined by the fuel used to generate them. In this study we examined the difference between isoprene- and toluene-generated smog in causing cardiac effects in rats and hypothesized that both atmospheres would cause cardiac electrical and functional changes in rats. Male Wistar-Kyoto rats were exposed to either atmospheric smog generated by the USEPA’s mobile reaction chamber using either isoprene or toluene, or filtered air for four hours. One day later, rats were anesthetized and left ventricular functional responses to dobutamine were measured using a Millar probe and arrhythmia sensitivity to aconitine. Baseline left ventricular pressure (LVP) was lower in toluene-exposed animals but not isoprene when compared to air. Increases in LVP with increasing doses of dobutamine were impaired only in toluene-exposed rats. Both isoprene and toluene impaired the rate of ventri

  3. Preventive medical programmes to personnel exposed to ionizing radiation

    International Nuclear Information System (INIS)

    Estrada F, E.


    The increasing use of ionizing radiation in the medical field as well as in industry and research grants has special importance to the security aspects related to the individual as well as his surroundings, reason for which the implementation of effective Occupational Radiation Protection Programmes constitutes a priority. Presently, in Guatemala, an Occupational Medicine Programme, directed to the Radiosanitary watch over of occupationally exposed personnel does not exist. It is the goal in this project to organize and establish such programme, based on protective and training actions focused toward the employee as the main entity, his specific activities and his work surroundings. Medical watch over together with Radiation Protection will permit the reduction of the occurrence probability of accidents or incidents, as well as the limitation of stochastic effects to the undermost values. The application scope of the present project is, in the first place, directed to the occupationally exposed personnel of the Direcci[n General de Energ[a Nuclear, as regulatory entity of these activities, and afterwards, its application in the different institutions which work with ionizing radiations. All the previously exposed is based on the Nuclear Legislation prevailing in Guatemala as well as the recommendations of international organizations. (author)

  4. Rapid genetic erosion in pollutant-exposed experimental chironomid populations

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, Carsten [Abteilung Okologie und Evolution, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Vogt, Christian [Abteilung Aquatische Okotoxikologie, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Pfenninger, Markus [Abteilung Okologie und Evolution, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Schwenk, Klaus [Abteilung Okologie und Evolution, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Oehlmann, Joerg [Abteilung Aquatische Okotoxikologie, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Streit, Bruno [Abteilung Okologie und Evolution, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:; Oetken, Matthias [Abteilung Aquatische Okotoxikologie, Institut fuer Okologie, Evolution und Diversitaet, J. W. Goethe-Universitaet Frankfurt am Main, Siesmayerstrasse 70, 60054 Frankfurt am Main (Germany)], E-mail:


    Few studies have evaluated how effectively environmental contamination may reduce genetic diversity of a population. Here, we chose a laboratory approach in order to test if tributyltin (TBT) exposure at environmentally relevant concentrations leads to reduced genetic variation in the midge Chironomus riparius. Two TBT-exposed and two unexposed experimental populations were reared simultaneously in the laboratory for 12 generations. We recorded several life-history traits in each generation and monitored genetic variation over time using five variable microsatellite markers. TBT-exposed strains showed increased larval mortality (treatments: 43.8%; controls: 27.8%), slightly reduced reproductive output, and delayed larval development. Reduction of genetic variation was strongest and only significant in the TBT-exposed strains (treatments: -45.9%, controls: -24.4% of initial heterozygosity) after 12 generations. Our findings document that chemical pollution may lead to a rapid decrease in genetic diversity, which has important implications for conservation strategies and ecological management in polluted environments. - Chronic TBT exposure reduces allelic variation at five variable microsatellite loci in experimental populations of Chironomus riparius.

  5. Rapid genetic erosion in pollutant-exposed experimental chironomid populations

    International Nuclear Information System (INIS)

    Nowak, Carsten; Vogt, Christian; Pfenninger, Markus; Schwenk, Klaus; Oehlmann, Joerg; Streit, Bruno; Oetken, Matthias


    Few studies have evaluated how effectively environmental contamination may reduce genetic diversity of a population. Here, we chose a laboratory approach in order to test if tributyltin (TBT) exposure at environmentally relevant concentrations leads to reduced genetic variation in the midge Chironomus riparius. Two TBT-exposed and two unexposed experimental populations were reared simultaneously in the laboratory for 12 generations. We recorded several life-history traits in each generation and monitored genetic variation over time using five variable microsatellite markers. TBT-exposed strains showed increased larval mortality (treatments: 43.8%; controls: 27.8%), slightly reduced reproductive output, and delayed larval development. Reduction of genetic variation was strongest and only significant in the TBT-exposed strains (treatments: -45.9%, controls: -24.4% of initial heterozygosity) after 12 generations. Our findings document that chemical pollution may lead to a rapid decrease in genetic diversity, which has important implications for conservation strategies and ecological management in polluted environments. - Chronic TBT exposure reduces allelic variation at five variable microsatellite loci in experimental populations of Chironomus riparius

  6. Studies of workers exposed to low doses of external radiation

    International Nuclear Information System (INIS)

    Gilbert, E.S.


    Currently, several epidemiologic studies of workers who have been exposed occupationally to low levels of radiation are being conducted, and include studies of workers in the United States, Great Britain, and Canada involved in the production of both defense materials and nuclear power. This paper focuses on studies that evaluate the possible adverse effects resulting from external exposure to radiation. The radiation risk estimates that have been used to establish radiation protection standards for workers and others have been obtained mainly from studies of persons exposed at high doses and dose rates. However, questions remain with regard to the extrapolation process that has been necessary for estimating low-level radiation risks. Occupational studies provide a direct assessment of risk based on data on persons exposed at the actual levels of interest. If current risk estimates are correct, these studies have very little chance of detecting risk, but can still be used to provide useful upper limits on risks. The studies are also adequate to detect serious underestimation of risks. 36 refs., 3 figs., 3 tabs

  7. Assessing color vision loss among solvent-exposed workers. (United States)

    Mergler, D; Blain, L


    Acquired color vision loss has been associated with exposure to organic solvents in the workplace. However, not all tests of chromatic discrimination loss are designed to detect acquired, as opposed to congenital, loss. The Lanthony D-15 desaturated panel (D-15-d), a simple 15 cap color arrangement test, designed to identify mild acquired dyschromatopsia, can be administered rapidly in the field, under standard conditions. The objective of the present study was to evaluate the D-15-d among 23 solvent-exposed workers of a paint manufacturing plant, by comparing the results obtained with the D-15-d to those obtained with the Farnsworth-Munsell 100 Hue (FM-100), a highly sensitive measure of color vision loss. The D-15-d revealed a significantly higher prevalence of dyschromatopsia among the ten highly exposed workers (80%) as compared to the 13 moderately exposed workers (30.8%); FM-100 results revealed one false positive. All dyschromatopic workers presented blue-yellow loss; the FM-100 detected eight complex patterns, while the D-15-d identified 5. Comparison of D-15-d and FM-100 scores were highly correlated (corr. coeff. 0.87; p less than 0.001). Multiple regression analyses showed both scores to be significantly related to age and exposure level. The findings of this study indicate that the D-15-d is an adequate instrument for field study batteries. However, the FM-100 should be used for more detailed assessment.

  8. Ethanol emission from loose corn silage and exposed silage particles (United States)

    Hafner, Sasha D.; Montes, Felipe; Rotz, C. Alan; Mitloehner, Frank


    Silage on dairy farms has been identified as a major source of volatile organic compound (VOC) emissions. However, rates of VOC emission from silage are not accurately known. In this work, we measured ethanol (a dominant silage VOC) emission from loose corn silage and exposed corn silage particles using wind tunnel systems. Flux of ethanol was highest immediately after exposing loose silage samples to moving air (as high as 220 g m -2 h -1) and declined by as much as 76-fold over 12 h as ethanol was depleted from samples. Emission rate and cumulative 12 h emission increased with temperature, silage permeability, exposed surface area, and air velocity over silage samples. These responses suggest that VOC emission from silage on farms is sensitive to climate and management practices. Ethanol emission rates from loose silage were generally higher than previous estimates of total VOC emission rates from silage and mixed feed. For 15 cm deep loose samples, mean cumulative emission was as high as 170 g m -2 (80% of initial ethanol mass) after 12 h of exposure to an air velocity of 5 m s -1. Emission rates measured with an emission isolation flux chamber were lower than rates measured in a wind tunnel and in an open setting. Results show that the US EPA emission isolation flux chamber method is not appropriate for estimating VOC emission rates from silage in the field.

  9. Immunomodulatory effects in workers exposed to naturally occurring asbestos fibers. (United States)

    Ledda, Caterina; Costa, Chiara; Matera, Serena; Puglisi, Beatrice; Costanzo, Valentina; Bracci, Massimo; Fenga, Concettina; Rapisarda, Venerando; Loreto, Carla


    Natural asbestiform fibers are defined 'naturally occurring asbestos' (NOA) and refer to the mineral as a natural component of soils or rocks. The release of NOA fibers into the air from rocks or soils by routine human activities or natural weathering processes represents a risk for human beings. Fluoro-edenite (FE) is a NOA fiber detected in the benmoreitic lava in the area of Biancavilla, South-west slope of Mt. Etna. The aim of the present study was to investigate FE immunotoxicity pathways in a group of 38 occupationally exposed construction workers, in order to find any biological markers of its effect. Subjects underwent respiratory function tests and HRCT total chest scanning. Serum IL-1β, IL-6, IL-8 and TNF-α were measured. The presence of PPs was significantly greater in subjects exposed than in the control (25 vs. 2). In subjects exposed to FE, IL-1β and TNF-α values were significantly higher than the controls. The previously observed increase of IL-1β and IL-18 showed a probable involvement of the proteic complex defined inflammosome by FE fibers.

  10. Unmet Health Care Needs among Children Exposed to Parental Incarceration. (United States)

    Turney, Kristin


    Objectives The incarceration rate in the United States has increased rapidly since the mid-1970s and, accordingly, a large number of children are exposed to parental incarceration. Research finds that parental incarceration is associated with deleterious physical and mental health outcomes among children, but little is known about these children's health care access. Methods I used data from the 2011-2012 National Survey of Children's Health (N = 95,531), a population-based and nationally representative survey of non-institutionalized children ages 0-17 in the United States, to estimate the association between exposure to parental incarceration and children's unmet health care needs. Results In logistic regression models that adjust for an array of demographic and socioeconomic characteristics, children exposed to parental incarceration, compared to their counterparts, have 1.26 (95% CI 1.02-1.54) times the odds of having any unmet health care need. Analyses that disaggregate by type of unmet health care need (mental, dental, vision, mental health, or other) suggest this association is driven by a greater likelihood of unmet mental health care needs (OR 1.60; 95% CI 1.04-2.46). Conclusions Children exposed to parental incarceration, a vulnerable group especially at risk of physical and mental health problems, face challenges to health care access, especially mental health care access. Given that parental incarceration is concentrated among those children most in need of health care, parental incarceration may exacerbate existing inequalities in unmet health care needs.

  11. Antioxidant status of neonates exposed in utero to tobacco smoke. (United States)

    Fayol, L; Gulian, J M; Dalmasso, C; Calaf, R; Simeoni, U; Millet, V


    To investigate the influence of maternal smoke exposure on neonatal and maternal antioxidant status, 39 mothers who were active smokers, 14 mothers exposed to environmental tobacco smoke (ETS), 17 controls, and their newborns were included in a prospective, controlled study. Plasma total antioxidant capacity, measured as total radical-trapping antioxidant parameter (TRAP) and ferric reducing antioxidant power (FRAP), and concentrations of specific antioxidants were measured in cord and in maternal blood. A similar, significant increase in ceruloplasmin concentration was observed in neonates born to actively smoking mothers and in those born to ETS exposed mothers. Uric acid and TRAP concentrations were significantly increased in ETS-exposed newborns and their mothers, compared to newborns and mothers from the active smoking and no-exposure groups with a trend towards increased uric acid, TRAP and FRAP concentrations being observed in the active smokers group. Neonatal and maternal antioxidant concentrations correlated significantly, except for ceruloplasmin. Cord blood vitamin A, E and C concentrations were unaffected by smoke exposure. These results show that maternal active smoking as well as ETS exposure significantly affect neonatal and maternal antioxidant status. Copyright (c) 2005 S. Karger AG, Basel

  12. Biomarkers of genetic damage in human populations exposed to pesticides

    International Nuclear Information System (INIS)

    Aiassa, Delia; Manas, Fernando; Bosch, Beatriz; Gentile, Natalia; Bernardi, Natali; Gorla, Nora


    The effect of pesticides on human, animal and environmental health has been cause of concern in the scientific community for a long time. Numerous studies have reported that pesticides are not harmless and that their use can lead to harmful biological effects in the medium and long term, in exposed human and animals, and their offspring. The importance of early detection of genetic damage is that it allows us to take the necessary measures to reduce or eliminate the exposure to the deleterious agent when damage is still reversible, and thus to prevent and to diminish the risk of developing tumors or other alterations. In this paper we reviewed the main concepts in the field, the usefulness of genotoxicity studies and we compiled studies performed during the last twenty years on genetic monitoring of people occupationally exposed to pesticides. we think that genotoxicity tests, including that include chromosomal aberrations, micronucleus, sister chromatid exchanges and comet assays, should be considered as essential tools in the implementation of complete medical supervision for people exposed to potential environmental pollutants, particularly for those living in the same place as others who were others have already developed some type of malignancy. This action is particularly important at early stages to prevent the occurrence of tumors, especially from environmental origins.

  13. Evaluation of radiation protection educational level of professional exposed workers

    International Nuclear Information System (INIS)

    Marinkovic, O.; Krstev, S.; Jovanovic, S.


    Full text: Serbia and Montenegro legislation concerning with radiation protection was upgrading after publication ICRP- 60 and B.S.S., No.115. Present Law on the Protection against Ionizing Radiation is in force from 1996. Among quite new issues in radiation protection regulations there was article relate to obligatory refresher training. Due to adverse political and economic situation through many years radiation protection regulations were not fulfill completely. The aim of this investigation was to get real view to education level of professional exposed workers. In Serbia and Montenegro the most of ionizing radiation sources are in medical use and the most exposed workers are radiographers and radiologists. The test was passed by 200 radiographers and 50 radiologists. Main groups of questions were: Radiation protection and safety; difference between safety and security; legislation: law and regulations; incidents, accidents and operational failures: recording, learning. Usually, knowledge from school pales. New quantities (as ambient and personal dose equivalent) are mostly unknown. It is easier to understand the real difference between safety and security than to understand linguistic differences. Discussing regulations workers are more interesting in syndicate regulations than radiation protection ones. Operational failures and incidents are hidden. Better to say: nobody dare to speak about them. The results imposed conclusion that regulatory body has to pay more attention to upraise safety culture and radiation protection education level of professional exposed workers. (authors)

  14. Expose : procedure and results of the joint experiment verification tests (United States)

    Panitz, C.; Rettberg, P.; Horneck, G.; Rabbow, E.; Baglioni, P.

    The International Space Station will carry the EXPOSE facility accommodated at the universal workplace URM-D located outside the Russian Service Module. The launch will be affected in 2005 and it is planned to stay in space for 1.5 years. The tray like structure will accomodate 2 chemical and 6 biological PI-experiments or experiment systems of the ROSE (Response of Organisms to Space Environment) consortium. EXPOSE will support long-term in situ studies of microbes in artificial meteorites, as well as of microbial communities from special ecological niches, such as endolithic and evaporitic ecosystems. The either vented or sealed experiment pockets will be covered by an optical filter system to control intensity and spectral range of solar UV irradiation. Control of sun exposure will be achieved by the use of individual shutters. To test the compatibility of the different biological systems and their adaptation to the opportunities and constraints of space conditions a profound ground support program has been developed. The procedure and first results of this joint Experiment Verification Tests (EVT) will be presented. The results will be essential for the success of the EXPOSE mission and have been done in parallel with the development and construction of the final hardware design of the facility. The results of the mission will contribute to the understanding of the organic chemistry processes in space, the biological adaptation strategies to extreme conditions, e.g. on early Earth and Mars, and the distribution of life beyond its planet of origin.

  15. Expose-R experiment on effects of open space condition on survivorship in dormant stages of aquatic invertebrates (United States)

    Alekseev, Victor; Novikova, Nataliya; Levinskikh, Margarita; Sychev, Vladimir; Yusoff, Fatimah; Azuraidi, Osman


    Dormancy protects animals and plants in harsh environmental conditions from months up to hundred years. This phenomenon is perspective for space researches especially for interplanetary missions. Direct experiments in open space BYORYSK supported in principle the fact of survivorship of bacteria, fungi spores, seed of plants and crustacean dormant cysts. Even though the rate of survivorship in long-term treatments was low but good enough to conclude that biological invasion even to Mars is a real danger. As soon as the BYORYSK lunch was made of metal the possibility for resting stages to survive under UV treatment in vacuum without some protection was not clear. To test it an ESA and RSA equipment titled EXPOSE-R was applied. The EXPOSE-R facility was an external facility attached to the outside of the Zvezda Service Module in ISS in the end of November 2008. It had glace windows transparent for UV-radiation and possibility to measure temperature, space- and UV-radiation. Among a number of experiments requiring exposure to the open space environment it had a biological launch containing resting stages of terrestrial and aquatic organisms. These stages included dried ephippia of cladoceran Daphnia magna differentiated on size, dormant eggs of ostracode Eucypris ornate, cysts of fair-shrimp Streptocephalus torvicornis ( all from hemi desert Caspian area) and Artemis salina from salt lake Crimean populations. All dormant stages were kept in transparent to UV plastic bags placed in three layers. After about two years of exposing in open space dormant stages of 3 species A. salina, D. magna, S. torvicornis successfully survived at different scales but in second and third layers only . The highest level of survivorship was found in A. salina cysts. In preliminary land experiments that imitated land EXPOSE imitation of outside space station UV and vacuum conditions survivorship in resting eggs of D .magna, S. torvicornis and E. ornate was tested also. The total UV dose of

  16. Work ability score of solvent-exposed workers. (United States)

    Furu, Heidi; Sainio, Markku; Hyvärinen, Hanna-Kaisa; Kaukiainen, Ari


    Occupational chronic solvent encephalopathy (CSE), characterized by neurocognitive dysfunction, often leads to early retirement. However, only the more severe cases are diagnosed with CSE, and little is known about the work ability of solvent-exposed workers in general. The aim was to study memory and concentration symptoms, work ability and the effect of both solvent-related and non-occupational factors on work ability, in an actively working solvent-exposed population. A questionnaire on exposure and health was sent to 3640 workers in four solvent-exposed fields, i.e. painters and floor-layers, boat builders, printers, and metal workers. The total number of responses was 1730. We determined the work ability score (WAS), a single question item of the Work Ability Index, and studied solvent exposure, demographic factors, Euroquest memory and concentration symptoms, chronic diseases, and employment status using univariate and multivariate analyses. The findings were compared to those of a corresponding national blue-collar reference population (n = 221), and a small cohort of workers with CSE (n = 18). The proportion of workers with memory and concentration symptoms was significantly associated with solvent exposure. The WAS of solvent-exposed workers was lower than that of the national blue-collar reference group, and the difference was significant in the oldest age group (those aged over 60). Solvent-exposed worker's WAS were higher than those of workers diagnosed with CSE. The WAS were lowest among painters and floor-layers, followed by metal workers and printers, and highest among boat builders. The strongest explanatory factors for poor work ability were the number of chronic diseases, age and employment status. Solvent exposure was a weak independent risk factor for reduced WAS, comparable to a level of high alcohol consumption. Even if memory and concentration symptoms were associated with higher solvent exposure, the effect of solvents on self

  17. Color discrimination impairment in workers exposed to mercury vapor. (United States)

    Urban, Pavel; Gobba, Fabriziomaria; Nerudová, Jana; Lukás, Edgar; Cábelková, Zdena; Cikrt, Miroslav


    To study color discrimination impairment in workers exposed to elemental mercury (Hg) vapor. Twenty-four male workers from a chloralkali plant exposed to Hg vapor, aged 42+/-9.8 years, duration of exposure 14.7+/-9.7 years, were examined. The 8h TWA air-borne Hg concentration in workplace was 59 microg/m(3); mean Hg urinary excretion (HgU) was 20.5+/-19.3 microg/g creatinine; mean Hg urinary excretion after the administration of a chelating agent, sodium 2,3-dimercapto-1-propane-sulfonate (DMPS), was 751.9+/-648 microg/48h. Twenty-four age- and gender-matched control subjects were compared. Visual acuity, alcohol intake, smoking habits, and history of diseases or drugs potentially influencing color vision were registered. The Lanthony 15-Hue desaturated test (L-D15-d) was used to assess color vision. The results were expressed quantitatively as Bowman's Color Confusion Index (CCI), and qualitatively according to Verriest's classification of acquired dyschromatopsias. The CCI was significantly higher in the exposed group than in the control (mean CCI 1.15 versus 1.04; P=0.04). The proportion of subjects with errorless performance on the Lanthony test was significantly lower in the Hg exposed group compared to referents (52% versus 73%; P=0.035). The exposed group showed higher frequency of type III dyschromatopsias (blue-yellow confusion axis) in comparison with the control group (12.5% versus 8.3%), however, the difference did not reach statistical significance. Multiple regression did not show any significant relationship between the CCI, and age, alcohol consumption, or measures of exposure. In agreement with previous studies by Cavalleri et al. [Toxicol. Lett. 77 (1995) 351; Environ. Res. Sec. A 77 (1998) 173], the results of this study support the hypothesis that exposure to mercury vapor can induce sub-clinical color vision impairment. This effect was observed at an exposure level below the current biological limit for occupational exposure to mercury. This

  18. Interaction of Al with O2 exposed Mo2BC

    International Nuclear Information System (INIS)

    Bolvardi, Hamid; Music, Denis; Schneider, Jochen M.


    Highlights: • Al adheres to many surfaces. • Solid–solid interactions challenging for real (oxidized) surfaces. • Dissociative O 2 adsorption on Mo 2 BC(0 4 0). • Al nonamer is disrupted on oxidized Mo 2 BC(0 4 0). • Adhesion of a residual Al on the native oxide. - Abstract: A Mo 2 BC(0 4 0) surface was exposed to O 2 . The gas interaction was investigated using ab initio molecular dynamics and X-ray photoelectron spectroscopy (XPS) of air exposed surfaces. The calculations suggest that the most dominating physical mechanism is dissociative O 2 adsorption whereby Mo−O, O−Mo−O and Mo 2 −C−O bond formation is observed. To validate these results, Mo 2 BC thin films were synthesized utilizing high power pulsed magnetron sputtering and air exposed surfaces were probed by XPS. MoO 2 and MoO 3 bond formation is observed and is consistent with here obtained ab initio data. Additionally, the interfacial interactions of O 2 exposed Mo 2 BC(0 4 0) surface with an Al nonamer is studied with ab initio molecular dynamics to describe on the atomic scale the interaction between this surface and Al to mimic the interface present during cold forming processes of Al based alloys. The Al nonamer was disrupted and Al forms chemical bonds with oxygen contained in the O 2 exposed Mo 2 BC(0 4 0) surface. Based on the comparison of here calculated adsorption energy with literature data, Al−Al bonds are shown to be significantly weaker than the Al−O bonds formed across the interface. Hence, Al−Al bond rupture is expected for a mechanically loaded interface. Therefore the adhesion of a residual Al on the native oxide layer is predicted. This is consistent with experimental observations. The data presented here may also be relevant for other oxygen containing surfaces in a contact with Al or Al based alloys for example during forming operations


    Directory of Open Access Journals (Sweden)

    N. V. Zolotova


    Full Text Available Specific personal features of 296 children and adolescents exposed to tuberculosis and those with unidentified exposure were comparatively analyzed. Children with unidentified exposure demonstrated psychic tension, poor self-control, poorly developed social communication skills which determined disruptive interpersonal relations and uneasy personal growth. Children exposed to tuberculosis in their families were characterized by judging didactive position towards their neighbors which was formed by dysfunctional patterns of relations in their parental families. Adolescent with unidentified exposure manifested the contrast combination of pre-morbid personal attitudes which had certain etiologic contribution to the development of borderline neurotic states. The higher level of destructive reactions in the interpersonal communication was observed in the adolescents exposed to tuberculosis in their families. Identified personal features are considered to be psychological factors determining the hyperactivation of adaptive systems at the pre-morbid state and consequent development of structural functional disorders in various systems of the host, as well as providing impact on the course of tuberculosis.

  20. Vascular Hyperpermeability Response in Animals Systemically Exposed to Arsenic. (United States)

    Chen, Shih-Chieh; Chang, Chao-Yuah; Lin, Ming-Lu


    The mechanisms underlying cardiovascular diseases induced by chronic exposure to arsenic remain unclarified. The objectives of this study were to investigate whether increased vascular leakage is induced by inflammatory mustard oil in mice systemically exposed to various doses of arsenic and whether an increased vascular leakage response is still present in arsenic-fed mice after arsenic discontinuation for 2 or 6 months. ICR mice were fed water or various doses of sodium arsenite (10, 15, or 20 mg/kg/day; 5 days/week) for 8 weeks. In separate experiments, the mice were treated with sodium arsenite (20 mg/kg) for 2 or 8 weeks, followed by arsenic discontinuation for 2 or 6 months. Vascular permeability to inflammatory mustard oil was quantified using Evans blue (EB) techniques. Both arsenic-exposed and water-fed (control) mice displayed similar basal levels of EB leakage in the ears brushed with mineral oil, a vehicle of mustard oil. The levels of EB leakage induced by mustard oil in the arsenic groups fed with sodium arsenite (10 or 15 mg/kg) were similar to those of water-fed mice. However, increased levels of EB leakage in response to mustard oil stimulation were significantly higher in mice treated with sodium arsenite (20 mg/kg; high dose) than in arsenic-fed (10 or 15 mg/kg; low and middle doses) or control mice. After arsenic discontinuation for 2 or 6 months, mustard oil-induced vascular EB leakage in arsenic-fed (20 mg/kg) mice was similar to that in control mice. Dramatic increases in mustard oil-induced vascular leakage were only present in mice systemically exposed to the high arsenic dose, indicating the synergistic effects of the high arsenic dose and mustard oil.

  1. Neurobehavioral evaluation of Venezuelan workers exposed to organic solvent mixtures. (United States)

    Escalona, E; Yanes, L; Feo, O; Maizlish, N


    To assess the applicability of the World Health Organization (WHO) Neurobehavioral Core Test Battery (NCTB), we evaluated 53 male and 29 female Venezuelan workers exposed to mixtures of organic solvents in an adhesive factory, and 56 male and 11 female workers unexposed to any type of neurotoxic chemical. The average age of unexposed workers was 30 years and 33 years for those exposed, average schooling for both groups was 8 years, and the mean duration of exposure was 7 years. The NCTB, which assesses central nervous system functions, is composed of seven tests that measure simple motor function, short-term memory, eye-hand coordination, affective behavior, and psychomotor perception and speed. The battery includes: profile of mood states (POMS); Simple Reaction Time for attention and response speed; Digit Span for auditory memory; Santa Ana manual dexterity; Digit-Symbol for perceptual motor speed; the Benton visual retention for visual perception and memory; and Pursuit Aiming II for motor steadiness. In each of 13 subtests, the exposed group had a poorer performance than the nonexposed group. The range of differences in mean performance was between 5% and 89%, particularly in POMS (tension-anxiety, anger-hostility, depression-rejection, fatigue-inertia, confusion-bewilderment), Simple Reaction Time, Digit-Symbol, and Santa Ana Pegboard (p memory, confusion, paresthesias in upper and lower extremities, and sleep disturbances. We conclude that the methodology is applicable to the population studied. The tests of the NCTB were accepted by the subjects and were administered satisfactorily, except for occasional difficulties in verbal comprehension in subtests of POMS, which is the only test that requires more demanding verbal skills. The magnitude of the behavioral deficits is consistent with the probable high level of exposure and with the range of deficits previously reported in workers with long-term solvent exposures.

  2. Effects of volcanic deposit disaggregation on exposed water composition (United States)

    Back, W. E.; Genareau, K. D.


    Explosive volcanic eruptions produce a variety of hazards. Pyroclastic material can be introduced to water through ash fallout, pyroclastic flows entering water bodies, and/or lahars. Remobilization of tephras can occur soon after eruption or centuries later, introducing additional pyroclastic material into the environment. Introduction of pyroclastic material may alter the dissolved element concentration and pH of exposed waters, potentially impacting drinking water supplies, agriculture, and ecology. This study focuses on the long-term impacts of volcanic deposits on water composition due to the mechanical breakup of volcanic deposits over time. Preliminary work has shown that mechanical milling of volcanic deposits will cause significant increases in dissolved element concentrations, conductivity, and pH of aqueous solutions. Pyroclastic material from seven eruptions sites was collected, mechanically milled to produce grain sizes Soufriere Hills, Ruapehu), mafic (Lathrop Wells) and ultramafic (mantle xenoliths) volcanic deposits. Lathrop Wells has an average bulk concentration of 49.15 wt.% SiO2, 6.11 wt. % MgO, and 8.39 wt. % CaO and produces leachate concentrations of 85.69 mg/kg for Ca and 37.22 mg/kg for Mg. Taupo and Valles Caldera samples have a bulk concentration of 72.9 wt.% SiO2, 0.59 wt. % MgO, and 1.48 wt. % CaO, and produces leachate concentrations of 4.08 mg/kg for Ca and 1.56 mg/kg for Mg. Similar testing will be conducted on the intermediate and ultramafic samples to test the hypothesis that bulk magma composition and mineralogy will directly relate to the increased dissolved element concentration of exposed waters. The measured effects on aqueous solutions will aid in evaluation of impacts to marine and freshwater systems exposed to volcanic deposits.

  3. Variance in exposed perturbations impairs retention of visuomotor adaptation. (United States)

    Canaveral, Cesar Augusto; Danion, Frédéric; Berrigan, Félix; Bernier, Pierre-Michel


    Sensorimotor control requires an accurate estimate of the state of the body. The brain optimizes state estimation by combining sensory signals with predictions of the sensory consequences of motor commands using a forward model. Given that both sensory signals and predictions are uncertain (i.e., noisy), the brain optimally weights the relative reliance on each source of information during adaptation. In support, it is known that uncertainty in the sensory predictions influences the rate and generalization of visuomotor adaptation. We investigated whether uncertainty in the sensory predictions affects the retention of a new visuomotor relationship. This was done by exposing three separate groups to a visuomotor rotation whose mean was common at 15° counterclockwise but whose variance around the mean differed (i.e., SD of 0°, 3.2°, or 4.5°). Retention was assessed by measuring the persistence of the adapted behavior in a no-vision phase. Results revealed that mean reach direction late in adaptation was similar across groups, suggesting it depended mainly on the mean of exposed rotations and was robust to differences in variance. However, retention differed across groups, with higher levels of variance being associated with a more rapid reversion toward nonadapted behavior. A control experiment ruled out the possibility that differences in retention were accounted for by differences in success rates. Exposure to variable rotations may have increased the uncertainty in sensory predictions, making the adapted forward model more labile and susceptible to change or decay. NEW & NOTEWORTHY The brain predicts the sensory consequences of motor commands through a forward model. These predictions are subject to uncertainty. We use visuomotor adaptation and modulate uncertainty in the sensory predictions by manipulating the variance in exposed rotations. Results reveal that variance does not influence the final extent of adaptation but selectively impairs the retention of

  4. Improving antenatal risk assessment in women exposed to high risks. (United States)

    Perry, Natasha; Newman, Louise K; Hunter, Mick; Dunlop, Adrian


    Antenatal substance use and related psychosocial risk factors are known to increase the likelihood of child protection involvement; less is known about the predictive nature of maternal reflective functioning (RF) in this population. This preliminary study assessed psychosocial and psychological risk factors for a group of substance dependent women exposed to high risks in pregnancy, and their impact on child protection involvement. Pregnant women on opiate substitution treatment (n = 11) and a comparison group (n = 15) were recruited during their third trimester to complete measures of RF (Pregnancy Interview), childhood trauma, mental health and psychosocial assessments. At postnatal follow-up, RF was reassessed (Parent Development Interview - Revised Short Version) and mother-infant dyads were videotaped to assess emotional availability (EA). Child protection services were contacted to determine if any concerns had been raised for infant safety. Significant between-group differences were observed for demographics, psychosocial factors, trauma and mental health symptoms. Unexpectedly, no significant differences were found for RF or EA between groups. Eight women in the 'exposed to high risks' group became involved with child protection services. Reflective functioning was not significantly associated with psychosocial risk factors, and therefore did not mediate the outcome of child protection involvement. Women 'exposed to high risks' were equally able to generate a model of their own and their infants' mental states and should not be seen within a deficit perspective. Further research is required to better understand the range of risk factors that predict child protection involvement in high risk groups. © The Author(s) 2013.

  5. Heart rate variability in workers chronically exposed to lead. (United States)

    Gajek, Jacek; Zyśko, Dorota; Chlebda, Ewa


    Lead is a strong neurotoxin. The effects of lead on the activity of the autonomic nervous system, assessed by the use of heart rate variability (HRV) analysis, have not yet been established. To assess the effects of occupational chronic lead exposure on the autonomic nervous system activity. The study group consisted of 22 copper foundry workers (mean age 41.8+/-8.7 years) who had elevated parameters of lead overload and were admitted to the hospital for chelate therapy. The control group consisted of 13 age-matched healthy males. Lead concentration was measured with the use of atomic absorption spectrophotometry, and concentration of free protoporphyrins in erythrocytes (FEP) using a fluorometric method. Each patient underwent 24-hour ambulatory ECG monitoring, and standard short-term as well as long-term HRV parameters were obtained. There were no significant differences between patients and controls in HRV parameters. In the control group, HRV parameters correlated with age. In patients, a significant negative correlation between lead concentration and some short-term HRV parameters calculated during the night was found: SDNN (r=-0.48, p<0.05), TP (r=-0.48, p<0.01) and LF (r=-0.48, p<0.01). In patients, a negative correlation between lead concentration and HFnight/HFday index was found (r=-0.47 p<0.01), whereas in controls this correlation was positive (r=0.66 p<0.05). Overall HRV indices are similar in subjects exposed to lead and in healthy controls. A decrease in the physiological elevation of HF values during the night, together with an increase in lead blood concentration and lack of relationship between age and HRV parameters in workers chronically exposed to lead may suggest disturbances of the autonomic system. In subjects not exposed to lead a decrease in heart rate with an increase in FEP concentration was observed.

  6. Oxidative damage of DNA in subjects occupationally exposed to lead. (United States)

    Pawlas, Natalia; Olewińska, Elżbieta; Markiewicz-Górka, Iwona; Kozłowska, Agnieszka; Januszewska, Lidia; Lundh, Thomas; Januszewska, Ewa; Pawlas, Krystyna


    Exposure to lead (Pb) in environmental and occupational settings continues to be a serious public health problem and may pose an elevated risk of genetic damage. The aim of this study was to assess the level of oxidative stress and DNA damage in subjects occupationally exposed to lead. We studied a population of 78 male workers exposed to lead in a lead and zinc smelter and battery recycling plant and 38 men from a control group. Blood lead levels were detected by graphite furnace atomic absorption spectrophotometry and plasma lead levels by inductively coupled plasma-mass spectrometry. The following assays were performed to assess the DNA damage and oxidative stress: comet assay, determination of 8-hydroxy-2'-deoxyguanosine (8-OHdG), lipid peroxidation and total antioxidant status (TAS). The mean concentration of lead in the blood of the exposed group was 392 ± 103 μg/L and was significantly higher than in the control group (30.3 ± 29.4 μg/L, p lead exposure [lead in blood, lead in plasma, zinc protoporphyrin (ZPP)] and urine concentration of 8-OHdG. The level of oxidative damage of DNA was positively correlated with the level of lipid peroxidation (TBARS) and negatively with total anti-oxidative status (TAS). Our study suggests that occupational exposure causes an increase in oxidative damage to DNA, even in subjects with relatively short length of service (average length of about 10 years). 8-OHdG concentration in the urine proved to be a sensitive and non-invasive marker of lead induced genotoxic damage.

  7. Comments on Simplified Calculation Method for Fire Exposed Concrete Columns

    DEFF Research Database (Denmark)

    Hertz, Kristian Dahl


    The author has developed new simplified calculation methods for fire exposed columns. Methods, which are found In ENV 1992-1-2 chapter 4.3 and in proposal for Danish code of Practise DS411 chapter 9. In the present supporting document the methods are derived and 50 eccentrically loaded fire expos...... columns are calculated and compared to results of full-scale tests. Furthermore 500 columns are calculated in order to present each test result related to a variation of the calculation in time of fire resistance....

  8. Oral and dental affections in mercury-exposed workers

    Energy Technology Data Exchange (ETDEWEB)

    Fahmy, M.S.


    A total of 222 mercury-exposed workers in the Chlor-Alkali plant in Kuwait were investigated for oral and dental affections. The levels of mercury-vapor ranged from 566.6 microgram/m3 to 0.3 microgram/m3 in different parts of the factory. The periods of exposure varied from 1 to 11 years. Although the level of mercury vapor in the air and the period of exposure proved to be the main factors as regards the oral signs and symptoms, the oral hygiene condition and the individual sensitivity played substantial roles. Oral affections were found not to be due to allergy to mercury.

  9. Experiences of being exposed to intimate partner violence during pregnancy


    Engnes, Kristin; Lidén, Eva; Lundgren, Ingela


    In this study a phenomenological approach was used in order to enter deeply into the experience of living with violence during pregnancy. The aim of the study was to gain a deeper understanding of women’s experiences of being exposed to intimate partner violence (IPV) during pregnancy. The data were collected through in-depth interviews with five Norwegian women; two during pregnancy and three after the birth. The women were between the age of 20 and 38 years. All women had received support f...

  10. Exposing government response action contractors to environmental tort liability

    International Nuclear Information System (INIS)

    Roy, M.J.


    Government contractors, particularly those involved with hazardous waste response action activities, are encountering increased risks for environmental tort liabilities. Contracts often include tasks and work assignments requiring the management of industrial, chemical, nuclear or mining wastes, spent fuels, munitions or other toxic substances. Contractors exposure to liability for damages results directly from the environmental laws and regulations pursuant to which the Government has contracted them to respond. Additionally, contractors may be exposed to common law liability under such dogmas as nuisance, trespass and strict liability in tort

  11. Evaluation of carbons exposed to the Three Mile Island accident

    International Nuclear Information System (INIS)

    Deitz, V.R.; Romans, J.B.; Bellamy, R.R.


    One of the lines of defense that served to mitigate the radiological effects of the accident at Three Mile Island was the activated carbon installed in ventilation air flows. Filters in the Auxiliary and Fuel Handling Buildings of Unit 2 adsorbed tens to hundreds of curies of iodine-131, preventing the release to the environment. The carbon exposed to the accident has been replaced and the spent carbon has been analyzed in the laboratory. Independent analyses were performed for the two filter trains in both the Auxiliary and Fuel Handling Buildings, replaced at various times after the accident. The results of these analyses are compared to new (unexposed) carbons

  12. Corrosivity Sensor for Exposed Pipelines Based on Wireless Energy Transfer. (United States)

    Lawand, Lydia; Shiryayev, Oleg; Al Handawi, Khalil; Vahdati, Nader; Rostron, Paul


    External corrosion was identified as one of the main causes of pipeline failures worldwide. A solution that addresses the issue of detecting and quantifying corrosivity of environment for application to existing exposed pipelines has been developed. It consists of a sensing array made of an assembly of thin strips of pipeline steel and a circuit that provides a visual sensor reading to the operator. The proposed sensor is passive and does not require a constant power supply. Circuit design was validated through simulations and lab experiments. Accelerated corrosion experiment was conducted to confirm the feasibility of the proposed corrosivity sensor design.

  13. Analysis of plutonium-239 in occupationally exposed personnel

    International Nuclear Information System (INIS)

    Hernandez M, H.


    Apart from radiometric techniques, several mass spectrometry (Ms) techniques can be used to evaluate the incorporation of plutonium-239 in occupationally exposed personnel, among which we can consider mass spectrometry with inductively coupled plasma source (Icp-Ms); mass spectrometry with accelerators (AMS); thermal ionization mass spectrometry (TIMS) and secondary ion mass spectrometry (Sims). In this work we evaluated analytical methods to measure isotopes of plutonium-239 in urine samples from occupationally exposed personnel, using alpha spectroscopy (As), magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS) and AMS. The samples were collected during 24 h were acidified with HNO 3 at 5% in v/v. The processes used in the preparation of the samples were: a) co-precipitation, b) acid digestion, c) radiochemical separation and d) electro deposition. The results obtained in terms of minimum detectable activity of plutonium-239 were 0.1 μBq (∼ 0.4 fg per sample), 5.1 μBq (∼ 2 fg per sample), 30.1 μBq (∼ 13 fg per sample) and 0.1 μBq (∼ 51 fg per sample) for AMS, Aridus-Icp-SFMS, Icp, SFMS and As, respectively. On the other hand, samples previously analyzed by As were re-evaluated by Aridus-Icp-SFMS and AMS. The results show that extraction with 60 ml of 5% HNO 3 at 60 degrees Celsius and for 2.5 h is enough to extract 90% of Pu electrodeposited on the planchette. In conclusion, AMS is an ultra-sensitive technique for determining isotope ratios of Pu, especially when is desired to validate a method to measure plutonium-239. Additionally, Icp-SFMS is a rapid analysis technique and can be used as a screening technique in situations of radiological incidents or accidents with Pu in the occupationally exposed personnel. Regarding alpha spectroscopy has been considered as the technique of excellence in the routine analysis to measure plutonium-239 in occupationally exposed personnel, due to the low cost. Finally, Icp-SFMS and AMS

  14. Rubella virus detection by ELISA method in exposed radiation workers

    International Nuclear Information System (INIS)

    Wu Jianmei; Zhu Bo; Zhu Youming; Shao Jinhui; Wu Weiping; Han Jinxiang


    Objective: A rapid diagnosis method was developed to detect Rubella virus infection in radiation workers. Methods: Modified ELISA method was used to detect the level of lgG and lgM antibodies in 514 in Jinan district. Results: 90.47% of 514 cases was shown to be resistant against Rubella virus; 6.42% were sensitive type; 0.78% belonged to be reinfected. Conclusion: Detection of Rubella virus in exposed radiation workers was imperative, and vaccine against Rubella virus was also needed to eliminate the infection risk. (authors)

  15. Brain biochemistry of infant mice and rats exposed to lead

    Energy Technology Data Exchange (ETDEWEB)

    Berber, G.B.; Maes, J.; Gilliavod, N.; Casale, G.


    Brains of rats and mice exposed to lead from birth receive biochemical examinations. Mice are given drinking water with lead and are studied until they are 17 days old. Rats ae given lead in the diet and followed for more than a year. In mice a retardation in body growth and development in brain DNA is found. In rats, cathepsin is enhanced at almost all times. An important role of proteolytic processes and biogenic animes is suggested in lead encephalopathy. (33 references, 7 tables)

  16. Haematological evaluation of Wistar rats exposed to chronic doses ...

    African Journals Online (AJOL)

    Two groups (A and B) were respectively exposed to CdCl2 (0.25 and 2.5 mg/kg), two other groups (C and D) respectively received HgCl2 (0.12 and 1.2 mg/kg) and the last two groups (E and F) were respectively treated with the combination of these two metals: (0.25 mg/kg Cd + 0.12 mg/kg Hg) and (2.5 mg/kg Cd + 1.2 ...

  17. Test Method for Spalling of Fire Exposed Concrete

    DEFF Research Database (Denmark)

    Hertz, Kristian Dahl; Sørensen, Lars Schiøtt


    A new material test method is presented for determining whether or not an actual concrete may suffer from explosive spalling at a specified moisture level. The method takes into account the effect of stresses from hindered thermal expansion at the fire-exposed surface. Cylinders are used, which...... in many countries serve as standard specimens for testing the compressive strength. Consequently, the method is quick, cheap and easy to use in comparison to the alternative of testing full-scale or semi full-scale structures with correct humidity, load and boundary conditions. A number of concretes have...

  18. Multiple endocrine disrupting effects in rats perinatally exposed to butylparaben

    DEFF Research Database (Denmark)

    Boberg, Julie; Petersen, Marta Axelstad; Svingen, Terje


    ) expression was reduced in prepubertal, but not adult animals exposed to butylparaben. In adult testes, Nr5a1 expression was reduced at all doses, indicating persistent disruption of steroidogenesis. Prostate histology was altered at prepuberty and adult prostate weights were reduced in the high dose group......Parabens comprise a group of preservatives commonly added to cosmetics, lotions and other consumer products. Butylparaben has estrogenic and anti-androgenic properties and is known to reduce sperm counts in rats following perinatal exposure. Whether butylparaben exposure can affect other endocrine...

  19. Erosion of graphite surface exposed to hot supersonic hydrogen gas (United States)

    Sharma, O. P.


    A theoretical model based on laminar boundary layer flow equations was developed to predict the erosion rate of a graphite (AGCarb-101) surface exposed to a hot supersonic stream of hydrogen gas. The supersonic flow in the nozzle outside the boundary layer formed over the surface of the specimen was determined by assuming one-dimensional isentropic conditions. An overall surface reaction rate expression based on experimental studies was used to describe the interaction of hydrogen with graphite. A satisfactory agreement was found between the results of the computation, and the available experimental data. Some shortcomings of the model and further possible improvements are discussed.

  20. Comparative proteomic analysis in Miscanthus sinensis exposed to antimony stress

    International Nuclear Information System (INIS)

    Xue, Liang; Ren, Huadong; Li, Sheng; Gao, Ming; Shi, Shengqing; Chang, Ermei; Wei, Yuan; Yao, Xiaohua; Jiang, Zeping; Liu, Jianfeng


    To explore the molecular basis of Sb tolerance mechanism in plant, a comparative proteomic analysis of both roots and leaves in Miscanthus sinensis has been conducted in combination with physiological and biochemical analyses. M. sinensis seedlings were exposed to different doses of Sb, and both roots and leaves were collected after 3 days of treatment. Two-dimensional gel electrophoresis (2-DE) and image analyses found that 29 protein spots showed 1.5-fold change in abundance in leaves and 19 spots in roots, of which 31 were identified by MALDI-TOF-MS and MALDI-TOF-TOF-MS. Proteins involved in antioxidant defense and stress response generally increased their expression all over the Sb treatments. In addition, proteins relative to transcription, signal transduction, energy metabolism and cell division and cell structure showed a variable expression pattern over Sb concentrations. Overall these findings provide new insights into the probable survival mechanisms by which M. sinensis could be adapting to Sb phytotoxicity. - Highlights: • Proteomics in Miscanthus sinensis leaves and roots exposed to Sb stress were studied. • There were 31 spots that were identified by mass spectrometry. • Most of these proteins were involved in antioxidant defense and stress response. • Our findings provide new insights into the tolerant mechanisms to Sb stress. - Miscanthus sinensis proteomic analysis under Sb stress reveals probable molecular mechanisms on Sb detoxification

  1. P300 brain potential among workers exposed to organic solvents

    Directory of Open Access Journals (Sweden)

    Bente E. Moen


    Full Text Available  SUMMARYThe P300 component of the auditory event-related brain potential was examined in a group of 11workers exposed to low levels of organic solvents in a paint factory and 11 unexposed controls beforeand after 3 weeks of summer vacation. The P300 latency time was found to be prolonged among theexposed workers compared to the reference group before the summer vacation, and to be significantlylonger before the vacation than after in the exposed group.The P300 component was also examined in a group of 85 seamen from chemical tankers, experiencingpeak exposures to organic solvents. They were compared to a reference group of unexposedseamen. Comparing these two groups, no difference was found in the P300 latency time. No relationshipbetween the P300 latency time and exposure was found in a multiple regression analysis, includingthe variables age, alcohol consumption, smoking and cerebral concussions.The study indicates the occurrence of an acute biological effect in the nervous system related toorganic solvent exposure, expressed by prolonged P300 latency time. This was found at very lowexposure levels and should be studied further.

  2. Experiences of being exposed to intimate partner violence during pregnancy

    Directory of Open Access Journals (Sweden)

    Kristin Engnes


    Full Text Available In this study a phenomenological approach was used in order to enter deeply into the experience of living with violence during pregnancy. The aim of the study was to gain a deeper understanding of women's experiences of being exposed to intimate partner violence (IPV during pregnancy. The data were collected through in-depth interviews with five Norwegian women; two during pregnancy and three after the birth. The women were between the age of 20 and 38 years. All women had received support from a professional research and treatment centre. The essential structure shows that IPV during pregnancy is characterized by difficult existential choices related to ambivalence. Existential choices mean questioning one's existence, the meaning of life as well as one's responsibility for oneself and others. Five constituents further explain the essential structure: Living in unpredictability, the violence is living in the body, losing oneself, feeling lonely and being pregnant leads to change. Future life with the child is experienced as a possibility for existential change. It is important for health professionals to recognize and support pregnant women who are exposed to violence as well as treating their bodies with care and respect.

  3. Experiences of being exposed to intimate partner violence during pregnancy. (United States)

    Engnes, Kristin; Lidén, Eva; Lundgren, Ingela


    In this study a phenomenological approach was used in order to enter deeply into the experience of living with violence during pregnancy. The aim of the study was to gain a deeper understanding of women's experiences of being exposed to intimate partner violence (IPV) during pregnancy. The data were collected through in-depth interviews with five Norwegian women; two during pregnancy and three after the birth. The women were between the age of 20 and 38 years. All women had received support from a professional research and treatment centre. The essential structure shows that IPV during pregnancy is characterized by difficult existential choices related to ambivalence. Existential choices mean questioning one's existence, the meaning of life as well as one's responsibility for oneself and others. Five constituents further explain the essential structure: Living in unpredictability, the violence is living in the body, losing oneself, feeling lonely and being pregnant leads to change. Future life with the child is experienced as a possibility for existential change. It is important for health professionals to recognize and support pregnant women who are exposed to violence as well as treating their bodies with care and respect.

  4. Ultrastructural and metabolic changes in osteoblasts exposed to uranyl nitrate

    International Nuclear Information System (INIS)

    Tasat, D.R.; Orona, N.S.; Mandalunis, P.M.; Cabrini, R.L.; Ubios, A.M.


    Exposure to uranium is an occupational hazard to workers who continually handle uranium and an environmental risk to the population at large. Since the cellular and molecular pathways of uranium toxicity in osteoblast cells are still unknown, the aim of the present work was to evaluate the adverse effects of uranyl nitrate (UN) on osteoblasts both in vivo and in vitro. Herein we studied the osteoblastic ultrastructural changes induced by UN in vivo and analyzed cell proliferation, generation of reactive oxygen species (ROS), apoptosis, and alkaline phosphatase (APh) activity in osteoblasts exposed to various UN concentrations (0.1, 1, 10, and 100 μM) in vitro. Cell proliferation was quantified by means of the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay, ROS was determined using the nitro blue tetrazolium test, apoptosis was morphologically determined using Hoechst 3332 and APh activity was assayed spectrophotometrically. Electron microscopy revealed that the ultrastructure of active and inactive osteoblasts exposed to uranium presented cytoplasmic and nuclear alterations. In vitro, 1-100 μM UN failed to modify cell proliferation ratio and to induce apoptosis. ROS generation increased in a dose-dependent manner in all tested doses. APh activity was found to decrease in 1-100 μM UN-treated cells vs. controls. Our results show that UN modifies osteoblast cell metabolism by increasing ROS generation and reducing APh activity, suggesting that ROS may play a more complex role in cell physiology than simply causing oxidative damage. (orig.)

  5. Exposing the cancer genome atlas as a SPARQL endpoint (United States)

    Deus, Helena F.; Veiga, Diogo F.; Freire, Pablo R.; Weinstein, John N.; Mills, Gordon B.; Almeida, Jonas S.


    The Cancer Genome Atlas (TCGA) is a multidisciplinary, multi-institutional effort to characterize several types of cancer. Datasets from biomedical domains such as TCGA present a particularly challenging task for those interested in dynamically aggregating its results because the data sources are typically both heterogeneous and distributed. The Linked Data best practices offer a solution to integrate and discover data with those characteristics, namely through exposure of data as Web services supporting SPARQL, the Resource Description Framework query language. Most SPARQL endpoints, however, cannot easily be queried by data experts. Furthermore, exposing experimental data as SPARQL endpoints remains a challenging task because, in most cases, data must first be converted to Resource Description Framework triples. In line with those requirements, we have developed an infrastructure to expose clinical, demographic and molecular data elements generated by TCGA as a SPARQL endpoint by assigning elements to entities of the Simple Sloppy Semantic Database (S3DB) management model. All components of the infrastructure are available as independent Representational State Transfer (REST) Web services to encourage reusability, and a simple interface was developed to automatically assemble SPARQL queries by navigating a representation of the TCGA domain. A key feature of the proposed solution that greatly facilitates assembly of SPARQL queries is the distinction between the TCGA domain descriptors and data elements. Furthermore, the use of the S3DB management model as a mediator enables queries to both public and protected data without the need for prior submission to a single data source. PMID:20851208

  6. Spatial variability of macrobenthic zonation on exposed sandy beaches (United States)

    Veiga, Puri; Rubal, Marcos; Cacabelos, Eva; Maldonado, Cristina; Sousa-Pinto, Isabel


    We analysed the consistence of vertical patterns of distribution (i.e. zonation) for macrofauna at different spatial scales on four intermediate exposed beaches in the North of Portugal. We tested the hypothesis that biological zonation on exposed sandy beaches would vary at the studied spatial scales. For this aim, abundance, diversity and structure of macrobenthic assemblages were examined at the scales of transect and beach. Moreover, the main environmental factors that could potentially drive zonation patterns were investigated. Univariate and multivariate analyses revealed that the number of biological zones ranged from two to three depending on the beach and from indistinct zonation to three zones at the scale of transect. Therefore, results support our working hypothesis because zonation patterns were not consistent at the studied spatial scales. The median particle size, sorting coefficient and water content were significantly correlated with zonation patterns of macrobenthic assemblages. However, a high degree of correlation was not reached when the total structure of the assemblage was considered.

  7. Error-related negativities during spelling judgments expose orthographic knowledge. (United States)

    Harris, Lindsay N; Perfetti, Charles A; Rickles, Benjamin


    In two experiments, we demonstrate that error-related negativities (ERNs) recorded during spelling decisions can expose individual differences in lexical knowledge. The first experiment found that the ERN was elicited during spelling decisions and that its magnitude was correlated with independent measures of subjects' spelling knowledge. In the second experiment, we manipulated the phonology of misspelled stimuli and observed that ERN magnitudes were larger when misspelled words altered the phonology of their correctly spelled counterparts than when they preserved it. Thus, when an error is made in a decision about spelling, the brain processes indexed by the ERN reflect both phonological and orthographic input to the decision process. In both experiments, ERN effect sizes were correlated with assessments of lexical knowledge and reading, including offline spelling ability and spelling-mediated vocabulary knowledge. These results affirm the interdependent nature of orthographic, semantic, and phonological knowledge components while showing that spelling knowledge uniquely influences the ERN during spelling decisions. Finally, the study demonstrates the value of ERNs in exposing individual differences in lexical knowledge. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. Differential Adjustment Among Rural Adolescents Exposed to Family Violence (United States)

    Sianko, Natallia; Hedge, Jasmine M.; McDonell, James R.


    This study examines differences in psychological adjustment in a sample of rural adolescents who have been exposed to family violence. Self-report questionnaires were administered to 580 adolescents and their primary caregivers. The results revealed that over two thirds of the study participants (68.8%) had been exposed to violence in their families. As hypothesized, cluster analysis identified several profiles among adolescents, distinguished by their psychological and emotional functioning: well adjusted (46.2%), moderately adjusted (44.3%), and struggling (9.5%). Discriminant function analysis confirmed the groupings and revealed that family functioning was among the most influential factors explaining adjustment differences. Multivariate analyses of variance (MANOVAs) further showed that adolescents from each of the three adjustment profiles reported significantly different levels of family social support, parental involvement, and perceived neighborhood safety. Overall, the results confirm heterogeneity of adolescent adaptation in the aftermath of family violence and provide insights into family and neighborhood factors that account for variability in adolescents’ reactions to violence. Implications for future research and practical interventions are discussed. PMID:27106255

  9. Lipid peroxidation in workers exposed to hexavalent chromium. (United States)

    Huang, Y L; Chen, C Y; Sheu, J Y; Chuang, I C; Pan, J H; Lin, T H


    The aim of this study was to investigate whether exposure to hexavalent chromium induces lipid peroxidation in human. This study involved 25 chrome-plating factory workers and a reference group of 28 control subjects. The whole-blood and urinary chromium concentrations were determined by graphite furnace atomic absorption spectrophotometry. Malondialdehyde (MDA), the product of lipid peroxidation, was determined by high-performance liquid chromatography, and the activities of protective enzymes were measured by ultraviolet-visible spectrophotometry. In the chrome-plating workers, the mean concentrations of chromium in blood and urine were 5.98 microg/L and 5.25 microg/g creatinine, respectively; the mean concentrations of MDA in blood and urine were 1.7 micromol/L and 2.24 micromol/g creatinine. The concentrations of both chromium and MDA in blood and urine were significantly higher in the chromium-exposed workers. The activities of superoxide dismutase (SOD), glutathione peroxidase (GPX), and catalase (CAT) were not markedly different between control and exposed workers. Data suggest that MDA may be used as a biomarker for occupational chromium exposure. Antioxidant enzymic activities are not a suitable marker for chromium exposure.

  10. The exposed proteomes of Brachyspira hyodysenteriae and B. pilosicoli.

    Directory of Open Access Journals (Sweden)

    Vanessa Casas


    Full Text Available B. hyodysenteriae and B. pilosicoli are well-known intestinal pathogens in pigs. B. hyodysenteriae is the causative agent of swine dysentery, a disease with an important impact on pig production while B. pilosicoli is responsible of a milder diarrheal disease in these animals, porcine intestinal spirochetosis. Recent sequencing projects have provided information for the genome of these species facilitating the search of vaccine candidates using reverse vaccinology approaches. However, practically no experimental evidence exists of the actual gene products being expressed and of those proteins exposed on the cell surface or released to the cell media. Using a cell-shaving strategy and a shotgun proteomic approach we carried out a large-scale characterization of the exposed proteins on the bacterial surface in these species as well as of peptides and proteins in the extracellular medium. The study included 3 strains of B. hyodysenteriae and 2 strains of B. pilosicoli and involved 148 LC-MS/MS runs on a high resolution Orbitrap instrument. Overall, we provided evidence for more than 29000 different peptides pointing to 1625 and 1338 different proteins in B. hyodysenteriae and B. pilosicoli, respectively. Many of the most abundant proteins detected corresponded to described virulence factors and vaccine candidates. The level of expression of these proteins, however, was different among species and strains, stressing the value of determining actual gene product levels as a complement of genomic-based approaches for vaccine design.

  11. Differential Adjustment Among Rural Adolescents Exposed to Family Violence. (United States)

    Sianko, Natallia; Hedge, Jasmine M; McDonell, James R


    This study examines differences in psychological adjustment in a sample of rural adolescents who have been exposed to family violence. Self-report questionnaires were administered to 580 adolescents and their primary caregivers. The results revealed that over two thirds of the study participants (68.8%) had been exposed to violence in their families. As hypothesized, cluster analysis identified several profiles among adolescents, distinguished by their psychological and emotional functioning: well adjusted (46.2%), moderately adjusted (44.3%), and struggling (9.5%). Discriminant function analysis confirmed the groupings and revealed that family functioning was among the most influential factors explaining adjustment differences. Multivariate analyses of variance (MANOVAs) further showed that adolescents from each of the three adjustment profiles reported significantly different levels of family social support, parental involvement, and perceived neighborhood safety. Overall, the results confirm heterogeneity of adolescent adaptation in the aftermath of family violence and provide insights into family and neighborhood factors that account for variability in adolescents' reactions to violence. Implications for future research and practical interventions are discussed. © The Author(s) 2016.

  12. The Immune System of HIV-Exposed Uninfected Infants. (United States)

    Abu-Raya, Bahaa; Kollmann, Tobias R; Marchant, Arnaud; MacGillivray, Duncan M


    Infants born to human immunodeficiency virus (HIV) infected women are HIV-exposed but the majority remains uninfected [i.e., HIV-exposed uninfected (HEU)]. HEU infants suffer greater morbidity and mortality from infections compared to HIV-unexposed (HU) peers. The reason(s) for these worse outcomes are uncertain, but could be related to an altered immune system state. This review comprehensively summarizes the current literature investigating the adaptive and innate immune system of HEU infants. HEU infants have altered cell-mediated immunity, including impaired T-cell maturation with documented hypo- as well as hyper-responsiveness to T-cell activation. And although prevaccination vaccine-specific antibody levels are often lower in HEU than HU, most HEU infants mount adequate humoral immune response following primary vaccination with diphtheria toxoid, haemophilus influenzae type b, whole cell pertussis, measles, hepatitis B, tetanus toxoid, and pneumococcal conjugate vaccines. However, HEU infants are often found to have lower absolute neutrophil counts as compared to HU infants. On the other hand, an increase of innate immune cytokine production and expression of co-stimulatory markers has been noted in HEU infants, but this increase appears to be restricted to the first few weeks of life. The immune system of HEU children beyond infancy remains largely unexplored.

  13. Thyroid neoplasia in Marshall Islanders exposed to nuclear fallout

    International Nuclear Information System (INIS)

    Hamilton, T.E.; van Belle, G.; LoGerfo, J.P.


    We studied the risk of thyroid neoplasia in Marshall Islanders exposed to radioiodines in nuclear fallout from the 1954 BRAVO thermonuclear test. We screened 7266 Marshall Islanders for thyroid nodules; the islanders were from 14 atolls, including several southern atolls, which were the source of the best available unexposed comparison group. Using a retrospective cohort design, we determined the prevalence of thyroid nodularity in a subgroup of 2273 persons who were alive in 1954 and who therefore were potentially exposed to fallout from the BRAVO test. For those 12 atolls previously thought to be unexposed to fallout, the prevalence of thyroid nodules ranged from 0.9% to 10.6%. Using the distance of each atoll from the test site as a proxy for the radiation dose to the thyroid gland, a weighted linear regression showed an inverse linear relationship between distance and the age-adjusted prevalence of thyroid nodules. Distance was the strongest single predictor in logistic regression analysis. A new absolute risk estimate was calculated to be 1100 excess cases/Gy/y/1 X 10(6) persons (11.0 excess cases/rad/y/1 million persons), 33% higher than previous estimates. We conclude that an excess of thyroid nodules was not limited only to the two northern atolls but extended throughout the northern atolls; this suggests a linear dose-response relationship


    Directory of Open Access Journals (Sweden)

    Tommaso Giordani


    Full Text Available In this work the response of Tomato plants cv. Micro-Tom to nanoparticles (NPs treatment was investigated. Tomato seedlings were grown in hydroponic condition and NPs treatments were carried out by adding Fe3O4 or TiO2 NPs to nutrient solution. At the end of treatments, NPs root uptake and tissue deposition were investigated using Environmental Scanning Electron Microscope, equipped with energy dispersive spectroscopy for chemical identification. At morphological level, one week after the beginning of NP treatment, seedlings grown with high concentration of TiO2 NPs showed an abnormal proliferation of root hairs, as compared to the control seedlings and to the seedlings exposed to Fe3O4 NPs, Shoot morphology did not differ in tomato seedlings grown under different conditions and no symptoms of toxicity were observed in NP-treated plants. In order to analyse genetic effects of NPs treatments, RNA transcription was studied in roots of NP-exposed and control plants by Illumina RNA sequencing, evidencing the induction of transposable elements.

  15. Ultrastructural changes of photodegradation of wood surfaces exposed to UV

    International Nuclear Information System (INIS)

    Kuo, M.L.; Hu, N.


    Red pine sapwood transverse and radial surfaces were exposed to ultraviolet (UV) light for 3 to 40 days. Effect of UV irradiation on ultrastructural changes of cell walls were studied by scanning (SEM) and transmission (TEM) electron microscopy. SEM study of transverse sections showed that during initial stages of UV irradiation, lignin in cell corners and in the compound middle lamellae was preferentially degraded and that the radial middle lamellae substained a greater rate of UV degradation than did the tangential middle lamellae. Massive cell wall degradation, as indicated by cell wall thinning, did not occur until surfaces were exposed to UV light for more than 10 days. TEM study of radial cell wall surfaces indicated that lignin lining the warty layer was removed by UV irradiation in 3 days and that warts were destroyed by a UV irradiation in 7 days. UV irradiation of cell wall surfaces produced a substantial amount of water-soluble degradation products. After 30 days of UV irradiation, the S3 layer was totally removed and revealed the very fragile S2 layer. (author)

  16. Prevalence of tinnitus in workers exposed to noise and organophosphates

    Directory of Open Access Journals (Sweden)

    Delecrode, Camila Ribas


    Full Text Available Introduction: Research on the workplace has emphasized the effects of noise exposure on workers' hearing, but has not considered the effects of agrochemicals. Aim: To evaluate and correlate the hearing level and tinnitus of workers exposed simultaneously to noise and organophosphates in their workplace and to measure tinnitus distress on their quality of life. Method: A retrospective clinical study. We evaluated 82 organophosphate sprinklers from the São Paulo State Regional Superintendence who were active in the fight against dengue and who were exposed to noise and organophosphates. We performed pure tone audiometry and applied the translated THI (Tinnitus Handicap Inventory questionnaire. Results: Of the sample, 28.05% reported current tinnitus or had presented tinnitus, and the workers with tinnitus had an increased incidence of abnormal audiometry. The average hearing threshold for the 4-8-kHz frequency range of the workers with current tinnitus was higher than that of the others, and was most affected at the 4-kHz frequency. The THI score ranged 0-84, with an average score of 13.1. Twelve (52.17% workers had THI scores consistent with discrete handicap. Conclusion: There is an increased incidence of abnormal pure tone audiometry in workers with tinnitus, and its impact on the workers' quality of life was discrete. The correlation between average hearing threshold and tinnitus distress was weak.

  17. Chromosomal aberrations in subjects exposed to ionizing radiation

    International Nuclear Information System (INIS)

    Jovicic, D.; Milacic, S.; Kovacevic, R.; Tanaskovic, I.


    Occupational exposure is particularly delicate because of chronic exposure to low doses of ionizing radiation and its cumulative effect, where it is important to consider the biological response of body to given conditions of exposure. The objective of this study was the observation of the recovery of the DNA damages in subjects working in the radiation area in two different intervals.Group I, consisting of 30 subjects, was exposed to ionizing radiation and unstable chromosomal aberrations were identified. Group II included the same, re-examined subjects (30) 9 months later. It was verified that 5 (16.67%) subjects still had unstable chromosomal aberrations, although they had been excluded from radiation area Controls groups (C) consisted of 64 subjects that were not exposed to mutagenic agents.The comparison of the control group with the two studied groups revealed the reduction of the unstable aberrations (p<0.05). The total effective doses, which increased with the years spent in radiation area, reflected the yield of chromosomal aberrations. The presence of chromosomal aberrations in some subjects, after the exclusion from the ionising radiation exposure, suggests that the time needed for the recovery of the DNA damages is different, which indicates the individual differences in radiosensitivity as well as different of the reparatory cellular response. (author)

  18. Cancer incidence among workers exposed to softwood dust in Lithuania. (United States)

    Smailyte, Giedre


    The aim of this study was to assess cancer incidence in a cohort of woodworkers exposed to softwood dust in a Lithuanian wooden joinery products factory. The study population consisted of 1518 workers (1080 men and 438 women) employed in the factory for at least 1 year between 1947 and 1996 and living in Lithuania on 1 January 1978, when the follow-up for cancer incidence began. The follow-up period for cancer was 1978-2007. Cancer risk was assessed by standardised incidence ratios (SIR) with reference to the national population. Overall cancer incidence was not increased among woodworkers. However, the number of mouth and pharynx cancer cases among male woodworkers was significantly increased compared with expected numbers (SIR 2.19, 95% CI 1.17 to 3.74). A higher risk was found for cancer of the buccal cavity than for pharyngeal cancer (SIRs 2.83 and 1.45, respectively). The SIR for larynx cancer was also elevated (SIR 1.39, 95% CI 0.64 to 2.64) among men, while the number of lung cancer cases was higher than expected only among women (SIR 2.07, 95% CI 00.57 to 5.31). This results of this study support the hypothesis that exposure to softwood dust may increase the risk of oral and pharyngeal cancer. No support was found for an increased risk of other respiratory cancers among workers exposed to softwood dust.

  19. Cytogenetic diagnostic of 3 populations of occupationally exposed personnel

    International Nuclear Information System (INIS)

    Guerrero C, C.; Arceo M, C.


    In the year 2000 the first service of biological dosimetry was requested to the Instituto Nacional de Investigaciones Nucleares (ININ), and until the year 2012 have been assisted 52 cases approximately. Most of the cases correspond to workers dedicated to the industrial radiography, followed by the occupationally exposed personnel either in the hospital area or health services and the minority corresponds to individuals linked to research institutions. The incident with more serious consequences to the individual happened to workers that ingested I-131 in the year 2003. Using the biological dosimetry to estimate exposure dose by damage in the lymphocyte chromosomes of each worker has been possible to establish the exposure dose in each one of them, or also to discard the supposed exposure. The dosimetry demonstrates to be an useful tool for situations with exposure suspicion, for example when the reading of thermoluminescent dosimeter of a occupationally exposed personnel does not correspond to the event, or when the personnel forgets to carry his dosimeter, the exposure dose can be determined. (Author)

  20. Image restorations constrained by a multiply exposed picture

    International Nuclear Information System (INIS)

    Breedlove, J.R. Jr.; Kruger, R.P.; Trussell, H.J.; Hunt, B.R.


    There are a number of possible industrial and scientific applications of nanosecond cineradiographs. While the technology exists to produce closely spaced pulses of x rays for this application, the quality of the time-resolved radiographs is severely limited. The limitations arise from the necessity of using a fluorescent screen to convert the transmitted x rays to light and then using electro-optical imaging systems to gate and to record the images with conventional high-speed cameras. It has been proposed that in addition to the time-resolved images, a conventional multiply-exposed radiograph be obtained. Simulations are used to demonstrate that the additional information supplied by the multiply-exposed radiograph can be used to improve the quality of digital image restorations of the time-resolved pictures over what could be achieved with the degraded images alone. Because of the need for image registration and rubber sheet transformations, this problem is one which can best be solved on a digital, as opposed to an optical, computer

  1. Direct assessment of cumulative aryl hydrocarbon receptor agonist activity in sera from experimentally exposed mice and environmentally exposed humans

    DEFF Research Database (Denmark)

    Schlezinger, Jennifer J; Bernard, Pamela L; Haas, Amelia


    (PCB)-exposed Faroe Islanders using an AhR-driven reporter cell line. To validate relationships between serum AhR agonist levels and biological outcomes, AhR agonist activity in mouse sera correlated with toxic end points. AhR agonist activity in unmanipulated ("neat") human sera was compared......, was associated with the frequency of recent pilot whale dinners, but did not correlate with levels of PCBs quantified by GC/MS. Surprisingly, significant "baseline" AhR activity was found in commercial human sera. CONCLUSIONS: An AhR reporter assay revealed cumulative levels of AhR activation potential in neat...

  2. Protein (Viridiplantae): 145354532 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  3. Protein (Viridiplantae): 1034215 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  4. Nasal biopsies of children exposed to air pollutants. (United States)

    Calderón-Garcidueñas, L; Rodriguez-Alcaraz, A; Valencia-Salazar, G; Mora-Tascareño, A; García, R; Osnaya, N; Villarreal-Calderón, A; Devlin, R B; Van Dyke, T


    Southwest Metropolitan Mexico City (SWMMC) atmosphere is a complex mixture of air pollutants, including ozone, particulate matter, and aldehydes. Children in SWMMC are exposed chronically and sequentially to numerous toxicants, and they exhibit significant nasal damage. The objective of this study was to assess p53 accumulation by immunohistochemistry in nasal biopsies of SWMMC children. We evaluated 111 biopsies from 107 children (83 exposed SWMMC children and 24 control children residents in a pollutant-compliant Caribbean island). Complete clinical histories and physical examinations, including an ear-nose-throat (ENT) exam were done. There was a significant statistical difference in the upper and lower respiratory symptomatology and ENT findings between control and exposed children (p < 0.001). Control children gave no respiratory symptomatology in the 3 months prior to the study; their biopsies exhibited normal ciliated respiratory epithelium and were p53-negative. SWMMC children complained of epistaxis, nasal obstruction. and crusting. Irregular areas of whitish-gray recessed mucosa over the inferior and middle turbinates were seen in 25% of SWMMC children, and their nasal biopsies displayed basal cell hyperplasia, decreased numbers of ciliated and goblet cells, neutrophilic epithelial infiltrates, squamous metaplasia. and mild dysplasia. Four of 21 SWMMC children with grossly abnormal mucosal changes exhibited strong transmural nuclear p53 staining in their nasal biopsies (p 0.005, odds ratio 26). In the context of lifetime exposures to toxic and potentially carcinogenic air pollutants, p53 nasal induction in children could potentially represent. a) a checkpoint response to toxic exposures, setting up a selective condition for p53 mutation, or b) a p53 mutation has already occurred as a result of such selection. Because the biological significance of p53 nuclear accumulation in the nasal biopsies of these children is not clear at this point, we strongly

  5. Genetic Analysis of Mice Skin Exposed by Hyper-Gravity (United States)

    Takahashi, Rika; Terada, Masahiro; Seki, Masaya; Higashibata, Akira; Majima, Hideyuki J.; Ohira, Yoshinobu; Mukai, Chiaki; Ishioka, Noriaki


    In the space environment, physiological alterations, such as low bone density, muscle weakness and decreased immunity, are caused by microgravity and cosmic radiation. On the other hand, it is known that the leg muscles are hypertrophy by 2G-gravity. An understanding of the effects on human body from microgravity to hyper-gravity is very important. Recently, the Japan Aerospace Exploration Agency (JAXA) has started a project to detect the changes on gene expression and mineral metabolism caused by microgravity by analyzing the hair of astronauts who stay in the international Space Station (ISS) for a long time. From these results of human hair’s research, the genetic effects of human hair roots by microgravity will become clear. However, it is unclear how the gene expression of hair roots was effected by hypergravity. Therefore, in this experiment, we analyzed the effect on mice skin contained hair roots by comparing microgravity or hypergravity exposed mice. The purpose of this experiment is to evaluate the genetic effects on mice skin by microgravity or 2G-gravity. The samples were taken from mice exposed to space flight (FL) or hypergravity environment (2G) for 3-months, respectively. The extracted and amplified RNA from these mice skin was used to DNA microarray analysis. in this experiment, we analyzed the effect of gravity by using mice skin contained hair roots, which exposed space (FL) and hyper-gravity (2G) for 3 months and each control. By DNA microarray analysis, we found the common 98 genes changed in both FL and 2G. Among these 98 genes, the functions and pathways were identified by Gene Ontology (GO) analysis and Ingenuity Pathways Analysis (IPA) software. Next, we focused the one of the identified pathways and compared the effects on each molecules in this pathways by the different environments, such as FL and 2G. As the results, we could detect some interesting molecules, which might be depended on the gravity levels. In addition, to investigate

  6. Analysing deterioration of marble stones exposed to underwater conditions (United States)

    Cámara, Beatriz; Álvarez de Buergo, Mónica; Bethencourt, Manuel; Freire-Lista, David; Fort, Rafael


    The peculiar conditions of the marine environment make the conservation of underwater archaeological sites an extremely complex procedure. This is due to the fact that the prevailing conditions in this environment promote the development of deterioration phenomena in submerged artefacts through the synergistic action of physical, chemical and biological factors. The objective of the present investigation was to determine how petrophysical properties of cultural heritage materials can be affected by being exposed to the specific underwater conditions of the sea bottom, and so, to evaluate how this can affect, in a long term, in their durability and evolution when they part of an archaeological site. For this purpose, two types of marble (the Italian Carrara and the Spanish Macael) were subjected to an experiment consisting of exposing stone materials for one and a half year to underwater conditions. The experimental test was located in an archaeological site in the Bay of Cadiz (southern Spain), Bajo del Chapitel (recognized as Cultural Interest), which includes remains of shipwrecks from different periods. In this site, samples were submerged to 12 m depth and placed in the sea bottom simulating the different positions in which underwater archaeological objects can be found (fully exposed, half buried and covered). Petrophysical characterisation involved determination of the apparent and bulk densities, water saturation (maximum water content a material may contain), open porosity (porosity accessible to water), chromatic parameters and ultrasonic velocity. Before measuring, samples were subjected to mechanical cleaning (in those samples with biological colonization) and to removal of salt deposits. Results showed significant differences in these petrophysical properties after underwater submersion, which were directly related to the type of underwater exposure condition. Comparative analysis of petrophysical properties, like the one conducted in this study

  7. Genotoxic damage in pathology anatomy laboratory workers exposed to formaldehyde

    International Nuclear Information System (INIS)

    Costa, Solange; Coelho, Patricia; Costa, Carla; Silva, Susana; Mayan, Olga; Silva Santos, Luis; Gaspar, Jorge; Teixeira, Joao Paulo


    Formaldehyde (FA) is a chemical traditionally used in pathology and anatomy laboratories as a tissue preservative. Several epidemiological studies of occupational exposure to FA have indicated an increased risk of nasopharyngeal cancers in industrial workers, embalmers and pathology anatomists. There is also a clear evidence of nasal squamous cell carcinomas from inhalation studies in the rat. The postulated mode of action for nasal tumours in rats was considered biologically plausible and considered likely to be relevant to humans. Based on the available data IARC, the International Agency for Research on Cancer, has recently classified FA as a human carcinogen. Although the in vitro genotoxic as well as the in vivo carcinogenic potentials of FA are well documented in mammalian cells and in rodents, evidence for genotoxic effects and carcinogenic properties in humans is insufficient and conflicting thus remains to be more documented. To evaluate the genetic effects of long-term occupational exposure to FA a group of 30 Pathological Anatomy laboratory workers was tested for a variety of biological endpoints, cytogenetic tests (micronuclei, MN; sister chromatid exchange, SCE) and comet assay. The level of exposure to FA was evaluated near the breathing zone of workers, time weighted average of exposure was calculated for each subject. The association between the biomarkers and polymorphic genes of xenobiotic metabolising and DNA repair enzymes was also assessed. The mean level of exposure was 0.44 ± 0.08 ppm (0.04-1.58 ppm). MN frequency was significantly higher (p = 0.003) in the exposed subjects (5.47 ± 0.76) when compared with controls (3.27 ± 0.69). SCE mean value was significantly higher (p < 0.05) among the exposed group (6.13 ± 0.29) compared with control group (4.49 ± 0.16). Comet assay data showed a significant increase (p < 0.05) of TL in FA-exposed workers (60.00 ± 2.31) with respect to the control group (41.85 ± 1.97). A positive correlation was

  8. Ionizing radiation and frequency of chromosomal aberrations in exposed personnel

    International Nuclear Information System (INIS)

    Spasojevic-Tisma, Vera; Pavlovic, Snezana


    Full text: Frequencies of chromosomal aberrations in lymphocytes of peripheral blood were investigated among the observed groups of subjects who were exposed to low radiation doses (external exposure) in comparison with the control group. The first group of subjects is involved in the production of radioisotope technetium, whose accumulated work exposure time ranges between 3 and 30 years. The second group works on inspection of the medical X-ray equipment, whose accumulated work exposure time is between 2 and 34 years. The third group worked on decontamination of the terrain from depleted uranium radioactive ammunition. These workers were involved in mechanical removal of the surface soil layer to a depth of 50 cm. They were selected out of a group of professionals otherwise exposed to radiation from confined sources in their daily work. The accumulated work exposure of this group ranged from 2 to 34 years. The control group consisted of individuals not working in the ionizing radiation zone. The average yearly absorbed dose measured by TL dosimeters for all three observed groups did not exceed 2 mSv. The chromosomal aberrations were analyzed by a modified Moorhead method. The objective of the study was to establish the existence of differences in the frequencies of chromosomal aberrations change with respect to the source type, i.e. type of radioactive emission. Comparisons of the chromosomal changes in the observed groups revealed that the group working on technetium production had an increase in the frequency of chromosomal aberrations with respect to control. The aberrations found were of the acentric fragment and chromosomal break types. A comparison of the exposed groups between each other, no statistically significant differences in the numbers of chromosomal aberrations were found. Soil decontamination from depleted uranium did not contribute to the relative radiation risk, since it lasted only a few months, and was done by the professionals fully clothed

  9. Ion irradiated graphite exposed to fusion-relevant deuterium plasma

    International Nuclear Information System (INIS)

    Deslandes, Alec; Guenette, Mathew C.; Corr, Cormac S.; Karatchevtseva, Inna; Thomsen, Lars; Ionescu, Mihail; Lumpkin, Gregory R.; Riley, Daniel P.


    Graphite samples were irradiated with 5 MeV carbon ions to simulate the damage caused by collision cascades from neutron irradiation in a fusion environment. The ion irradiated graphite samples were then exposed to a deuterium plasma in the linear plasma device, MAGPIE, for a total ion fluence of ∼1 × 10 24 ions m −2 . Raman and near edge X-ray absorption fine structure (NEXAFS) spectroscopy were used to characterize modifications to the graphitic structure. Ion irradiation was observed to decrease the graphitic content and induce disorder in the graphite. Subsequent plasma exposure decreased the graphitic content further. Structural and surface chemistry changes were observed to be greatest for the sample irradiated with the greatest fluence of MeV ions. D retention was measured using elastic recoil detection analysis and showed that ion irradiation increased the amount of retained deuterium in graphite by a factor of four

  10. Reduced recruitment in Hyalella azteca (Saussure, 1858) exposed to copper. (United States)

    Othman, M Shuhaimi; Pascoe, David


    Neonates of the amphipod Hyalella azteca were exposed for a 35-day period in the laboratory to a range of copper concentrations, nominally 18 microg/l, 40 microg/l, 70 microg/l and 260 microg/l. The reproductive status of the population was assessed by recording recruitment, the number of precopulatory pairs and number of gravid females. At the end of the experiment, the body lengths of individuals were measured using image analysis. There was a significant decrease in the final population size of H. azteca with increasing copper concentration and compared with the control. Copper significantly reduced recruitment of juveniles and length composition of the final population and there was also a trend toward reduced precopula number with increasing copper concentrations.

  11. Mothers and infants exposed to intimate partner violence compensate. (United States)

    Letourneau, Nicole; Morris, Catherine Young; Secco, Loretta; Stewart, Miriam; Hughes, Jean; Critchley, Kim


    Reasons for the developmental variability in children exposed to intimate partner violence (IPV) are unclear and under studied. This article presents exploratory findings on (a) the potential impact of IPV on mother-child relationships and child development and (b) the association between these maternal-child relationship impacts and child development. The fit of findings with compensatory, spillover, and compartmentalization hypotheses was explored. Participants were 49 mothers and 51 children younger than 3 years of age affected by IPV. Data were collected on maternal-child interactions, child development, social support, difficult life circumstances, family functioning, child temperament, and parental depression. The findings suggested developmental impacts on children in the sample, along with children's high sensitivity and responsiveness to their caregivers. Although some spillover effects were observed, the predominant observation was of mothers and infants compensating for exposure to IPV in their interactions.

  12. Exposing the QCD Splitting Function with CMS Open Data. (United States)

    Larkoski, Andrew; Marzani, Simone; Thaler, Jesse; Tripathee, Aashish; Xue, Wei


    The splitting function is a universal property of quantum chromodynamics (QCD) which describes how energy is shared between partons. Despite its ubiquitous appearance in many QCD calculations, the splitting function cannot be measured directly, since it always appears multiplied by a collinear singularity factor. Recently, however, a new jet substructure observable was introduced which asymptotes to the splitting function for sufficiently high jet energies. This provides a way to expose the splitting function through jet substructure measurements at the Large Hadron Collider. In this Letter, we use public data released by the CMS experiment to study the two-prong substructure of jets and test the 1→2 splitting function of QCD. To our knowledge, this is the first ever physics analysis based on the CMS Open Data.

  13. Supporting awareness in creative group work by exposing design rationale

    Directory of Open Access Journals (Sweden)

    Umer Farooq


    Full Text Available When creativity is taken as a long-term, complex, and collaborative activity, support for awareness is required for group members to monitor the development of ideas, track how these ideas became narrowed, and understand how alternatives are being implemented and integrated by colleagues. In this paper, we investigate the effects of exposing design rationale to convey awareness, specifically activity awareness, in group creativity. Through evaluating a prototype, we investigate status updates that convey design rationale, and to what consequences, in small groups in fully distributed collaboration. We found that status updates are used for a variety of purposes and that participants’ comments on their collaborators’ status updates provided feedback. Overall, results suggest that participants’ awareness about their collaborators’ future plans increased over time. Majority of participants found the status updates useful, particularly those with higher metacognitive knowledge. Based on our results, two design strategies for activity awareness are proposed.

  14. Own experiences in genetic counselling of radiation exposed persons

    International Nuclear Information System (INIS)

    Laude, G.; Bruening, L.


    An outline is given of genetic counselling provided to 46 radiation-exposed persons during the period from 1978 to 1994. The radiation exposure had, in most cases, been due to radiation-therapeutic measures (n=22). To a low extent, counselling was carried out because of fear of genetic consequences of the Chernobyl reactor accident (n=11), preceding radiation exposure from X-ray (n=9) and nuclear diagnosis (n=1) as well as occupation radiation exposure (n=3). During counselling, information was given on the genetic risk to be expected, taking into consideration the risk factor that is valid at present and the malformation doubling dose. After performance of radiation therapy, an avoidance of conception for 2 years has been recommended. After termination of this period, in the case of an urgent wish of having children, pregnancy was not discouraged if no further risk factors existed. (orig.) [de

  15. Patients exposed to therapeutic irradiation for benign conditions in childhood

    International Nuclear Information System (INIS)

    Carroll, R.G.


    In the United States there are over 1 million individuals who have been irradiated for benign conditions in the head and neck. Many recent reports document conclusively that individuals who have had head and neck radiation for benign conditions have markedly increased risk of thyroid, salivary, and perhaps breast cancer as compared to the general population. Although the relative risk as compared to the general population is high, the risk that any one individual who has had head or neck irradiation will develop a subsequent malignancy is relatively low. Identification of these patients through some type of screening procedure may be beneficial in terms of prevention of subsequent mortality and morbidity from cancer, especially thyroid and salivary cancer. The American Medical Association and the American Hospital Association issued a joint statement of October 17, 1975, urging hospitals and physicians to work together in their communities to develop guidelines and procedures for screening of exposed individuals and for public education

  16. Brain plasticity of rats exposed to prenatal immobilization stress

    Directory of Open Access Journals (Sweden)

    Badalyan B. Yu.


    Full Text Available Aim. This histochemical and immunohistochemical study was aimed at examining the brain cellular structures of newborn rats exposed to prenatal immobilization (IMO stress. Methods. Histochemical method on detection of Ca2+-dependent acid phosphatase activity and ABC immunohistochemical technique. Results. Cell structures with radial astrocytes marker GFAP, neuroepithelial stem cell marker gene nestin, stem-cells marker and the hypothalamic neuroprotective proline-rich polypeptide PRP-1 (Galarmin, a natural cytokine of a common precursor to neurophysin vasopressin associated glycoprotein have been revealed in several brain regions. Conclusions. Our findings indicate the process of generation of new neurons in response to IMO and PRP-1 involvement in this recovery mechanism, as PRP-1-Ir was detected in the above mentioned cell structures, as well as in the neurons and nerve fibers.

  17. Psychological distress of adolescents exposed to Hurricane Hugo. (United States)

    Hardin, S B; Weinrich, M; Weinrich, S; Hardin, T L; Garrison, C


    To ascertain the effects of a natural disaster on adolescents, 1482 South Carolina high school students who were exposed to Hurricane Hugo were surveyed 1 year after the disaster. Subjects completed a self-administered questionnaire measuring Hugo exposure, nonviolent and violent life events, social support, self-efficacy, and psychological distress. Results showed that the students reported minimal exposure to the hurricane and psychological distress variables approximated national norms. As exposure increased, adolescents reported increased symptoms of psychological distress; i.e., anger, depression, anxiety, and global mental distress. Females and white students experienced higher levels of distress. In most cases, other stressful life events were at least as strong a predictor of psychological distress as was exposure to the hurricane. Self-efficacy and social support were protective.

  18. Self-protection of unsealed anodised aluminium exposed to atmosphere

    International Nuclear Information System (INIS)

    Escudero, E.; Bartolome, M. J.; Lopez, V.; Simancas, J.; Gonalez, J. A.; Morcillo, M.; Otero, E.


    To confirm or refute the widely held idea that the sealing operation is vital to guarantee the good resistance of anodised aluminium to atmospheric corrosion, unsealed, anodised specimens with three different film thick messes were exposed in 9 atmospheres in Ibero america with salinity values of between 3.9 and 684 mg m''2 day ''-1 of chlorides. Using a wide variety of techniques, from scanning and transmission electron microscopy to direct measurements by gravimetry, and including indirect measurements by electrochemical techniques as well as standard sealing quality control tests, the self-sealing capacity of unsealed anodic coating during atmospheric exposure is demonstrated. Surprisingly, unlike other types of protective coatings, the quality of anodic films improves with ageing. (Author) 15 refs

  19. Protection of persons occupationally exposed to radiation and of patients

    International Nuclear Information System (INIS)

    Stieve, F.E.


    The experiences of the last ten years have shown that the measures of the First Radiation Protection Ordinance generally proved to be sufficient for the protection of the employed or of the patients. They had to be amended in so far as the exposure to radiation for those occupationally exposed can be reduced. This results in changes to the regulations so that certain groups of persons can also be effectively controlled. The recognition that medical supervision for radiation protection reasons is reasonable only if exposure has occurred should be additionally utilized in the regulations if the Euratom standards make this possible. The protection of patients attains some new rules which can be derived from handling and from therapeutical use. In this case too experience resulted in a more reasonable application of ionizing radiation and radioactive materials than was expected when the First Radiation Protection Ordinance was issued. (orig.) [de

  20. Medical examination of the workers occupationally exposed to ionizing radiation

    International Nuclear Information System (INIS)

    Kato, Toshio


    The hazardous effects of ionizing radiation to man are well recognized, and they are divided into two groups, the stochastic effects (hereditary and carcinogenic effect) and non-stochastic effects (somatic effects such as depression of hematopoiesis, chronic dermatitis and cataracta). The basic framework of the International Commission on Radiological Protection (ICRP) is intended to prevent the occurrence of non-stochastic effects, by keeping doses below the relevant thresholds, and to ensure that all reasonable aspects are taken to reduce the incidence of stochastic effects. In Japan, the regulatory provisions of radiological protection of the workers occupationally exposed to ionizing radiation are based on the recommendation of ICRP adopted in 1977. According to these regulations, the dose equivalent limits of occupational exposure of man has been decided at 50 mSv/year. The monitoring of exposure to the individual and the procedure of medical examination of the workers are briefly described and discussed. (author)

  1. Reproductive toxicity in boron exposed workers in Bandirma, Turkey. (United States)

    Başaran, Nurşen; Duydu, Yalçin; Bolt, Hermann M


    Boric acid and sodium borates have been considered as being "toxic to reproduction and development", following results of animal studies with high doses. However unfavorable effects of boron exposure on reproduction and development have not been proved in epidemiological studies so far. The aim of the present study was to investigate the reproductive toxicity indicators in highly exposed workers employed in a boric acid production plant in Bandırma, Turkey. Two hundred and four workers participated in this study. The mean blood boron concentration of the high exposure group of workers was 223.89 ± 69.49 (152.82-454.02)ng/g. Unfavorable effects of boron exposure on the reproductive toxicity indicators were not observed. Copyright © 2012 Elsevier GmbH. All rights reserved.

  2. The hearing of rural workers exposed to noise and pesticides. (United States)

    Sena, Tereza R R; Dourado, Solano S F; Lima, Lucas V; Antoniolli, Ângelo R


    n work environments, different physical and chemical agents that may pose a risk to workers' hearing health coexist. In this context, occupational hearing loss stands out. It has mostly been attributed to only noise exposure, although there are other agents, that is, pesticides that might contribute to occupational hearing loss. In this report, two cases will be presented that consider rural workers exposed to pesticides and intense noise generated by an adapted rudimentary vehicle. The noise measured in this vehicle was 88.3 dBA up to 93.4 dBA. Pure-tone audiometry, distortion product otoacoustic emissions, and high-frequency audiometry tests were performed. This report is unusual because of the short time of exposure to noise and pesticides and the hearing loss found, indicating a synergy between those agents.

  3. Hot spring therapy of atomic bomb exposed patients, (9)

    Energy Technology Data Exchange (ETDEWEB)

    Hatta, O [Balneogic Sanatorium for the Atomic Bomb Injured Beppu, Oita (Japan); Tsuji, H


    The following description shows the statistics and the results of medical examinatin concerning the patients utilized Beppu Atomic Bomb Center from April, 1977, to March, 1978. Number of persons utilized the center was 3904, and 20285 man-days in total. Number of case treated there was 268. Number of diseases amounted to 442 of 66 sorts, excluding temporary of acute diseases such as acute entergastritis and cold diseases, etc. According to the report by the Ministry of Health and Welfare, atomic bomb-exposed persons show twice as much rate of incidence as normal persons, and owing to aging, many of them have more than two kinds of diseases. Among the diseases, 60 cases were hypertension, 32 heart disease, 30 knee-arthritis, 26 diabetes, 25 hepatitis, 23 spondylosis deformans, etc. Among 268 cases treated by hot spring therapy, 6 were totally cured, and 252 showed alleviation, while 10 showed no change.

  4. NeuLand submodules exposed to fast neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Gasparic, Igor [Technische Univ. Darmstadt (Germany); Rudjer Boskovic Institute, Zagreb (Croatia); Aumann, Thomas [Technische Univ. Darmstadt (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Boretzky, Konstanze; Heil, Michael; Simon, Haik [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Jaehrling, Simon [Technische Univ. Darmstadt (Germany); Collaboration: R3B-Collaboration


    Within the R{sup 3}B collaboration (Reactions with Relativistic Radioactive Beams), a new neutron detector NeuLAND (New Large Area Neutron Detector) is being developed. The technical design was finalized in November 2011, a fully active scintillator concept was chosen. It will be a box-shaped 2.5 x 2.5 x 3 m{sup 3} detector consisting of 3000 scintillator bars arranged in 60 planes with mutually orthogonal orientation. An array of 150 NeuLAND bars was exposed to fast ''mono-energetic'' neutrons stemming from quasi-free deuteron breakup reactions on a CH{sub 2} target (250 to 1500 AMeV). The experiment carried out at GSI in Nov. 2012 aims for determination of both time resolution and efficiency of NeuLAND submodules. Preliminary results of the analysis are presented.

  5. Brain magnetic resonance imaging of infants exposed prenatally to buprenorphine

    International Nuclear Information System (INIS)

    Kahila, H.; Kivitie-Kallio, S.; Halmesmaki, E.; Valanne, L.; Autti, T.


    Purpose: To evaluate the brains of newborns exposed to buprenorphine prenatally. Material and Methods: Seven neonates followed up antenatally in connection with their mothers' buprenorphine replacement therapy underwent 1.5T magnetic resonance imaging (MRI) of the brain before the age of 2 months. The infants were born to heavy drug abusers. Four mothers were hepatitis C positive, and all were HIV negative. All mothers smoked tobacco and used benzodiazepines. All pregnancies were full term, and no perinatal asphyxia occurred. All but one neonate had abstinence syndrome and needed morphine replacement therapy. Results: Neither structural abnormalities nor abnormalities in signal intensity were recorded. Conclusion: Buprenorphine replacement therapy does not seem to cause any major structural abnormalities of the brain, and it may prevent known hypoxic-ischemic brain changes resulting from uncontrolled drug abuse. Longitudinal studies are needed to assess possible abnormalities in the brain maturation process

  6. Exposed Biologies and the Banking of Reproductive Vitality in China

    DEFF Research Database (Denmark)

    Wahlberg, Ayo


    The looming figures of smog-choked cities, cancer villages and contaminated food have become iconic of a modernising China: the tragic, perhaps unavoidable, side effects of a voracious economy. In this article, I examine how the sperm bank—jingzi ku—in China has emerged quite literally as a sanct......The looming figures of smog-choked cities, cancer villages and contaminated food have become iconic of a modernising China: the tragic, perhaps unavoidable, side effects of a voracious economy. In this article, I examine how the sperm bank—jingzi ku—in China has emerged quite literally...... as a sanctuary of vitality amidst concerns around food safety, air and water pollution, rising infertility and declining population quality. As a twist on Margaret Lock’s concept of ‘local biologies’, I argue that ‘exposed biologies’ have become a matter of concern in China in ways that have corroborated a place...

  7. Susceptible-infected-recovered and susceptible-exposed-infected models

    International Nuclear Information System (INIS)

    Tome, Tania; De Oliveira, Mario J


    Two stochastic epidemic lattice models, the susceptible-infected-recovered and the susceptible-exposed-infected models, are studied on a Cayley tree of coordination number k. The spreading of the disease in the former is found to occur when the infection probability b is larger than b c = k/2(k - 1). In the latter, which is equivalent to a dynamic site percolation model, the spreading occurs when the infection probability p is greater than p c = 1/(k - 1). We set up and solve the time evolution equations for both models and determine the final and time-dependent properties, including the epidemic curve. We show that the two models are closely related by revealing that their relevant properties are exactly mapped into each other when p = b/[k - (k - 1)b]. These include the cluster size distribution and the density of individuals of each type, quantities that have been determined in closed forms.

  8. Brain magnetic resonance imaging of infants exposed prenatally to buprenorphine

    Energy Technology Data Exchange (ETDEWEB)

    Kahila, H.; Kivitie-Kallio, S.; Halmesmaki, E.; Valanne, L.; Autti, T. [Dept. of Obstetrics and Gynecology, Dept. of Pediatrics, and Helsinki Medical Imaging Center, Helsinki Univ. Central Hospital (Finland)


    Purpose: To evaluate the brains of newborns exposed to buprenorphine prenatally. Material and Methods: Seven neonates followed up antenatally in connection with their mothers' buprenorphine replacement therapy underwent 1.5T magnetic resonance imaging (MRI) of the brain before the age of 2 months. The infants were born to heavy drug abusers. Four mothers were hepatitis C positive, and all were HIV negative. All mothers smoked tobacco and used benzodiazepines. All pregnancies were full term, and no perinatal asphyxia occurred. All but one neonate had abstinence syndrome and needed morphine replacement therapy. Results: Neither structural abnormalities nor abnormalities in signal intensity were recorded. Conclusion: Buprenorphine replacement therapy does not seem to cause any major structural abnormalities of the brain, and it may prevent known hypoxic-ischemic brain changes resulting from uncontrolled drug abuse. Longitudinal studies are needed to assess possible abnormalities in the brain maturation process.

  9. Radiation pneumonitis in a patient exposed to asbestos

    International Nuclear Information System (INIS)

    Ashford, R.F.U.; Maher, J.; Drury, A.; Pickering, D.


    A case report is presented of a 58 year old man who had for many years run an asbestos importing and fibreizing plant. He developed radiation pneumonitis following radiotherapy to a squamous cell carcinoma of the middle 3rd of the oesophagus. Detailed lung studies at autopsy revealed asbestos bodies associated with macrophages in many alveoli and areas of subpleural fibrosis typical of asbestos exposure. This was the most florid case of radiation seen in the Westminster Hospital for some years and the first seen in patients treated for carcinoma of the oesophagus using a three field technique. It is suggested that when planning radiotherapy to an asbestos-exposed patient, a possible increase in lung sensitivity to radiation should be considered when planning dosage. (U.K.)

  10. Action spectra in mammalian cells exposed to ultraviolet radiation

    International Nuclear Information System (INIS)



    A review is given of the literature published since 1977 on action spectra in mammalian cells exposed to ultraviolet radiation in the wavelength region above 220 nm. Action spectra for lethal events are discussed for cell inactivation in normal cells, growth arrested cells and photosensitive cells. Action spectra for non-lethal events are also discussed in relation to pyrimidine dimer formation, photoreactivation and the use of photosensitisers. It was concluded from these studies that damage to the DNA, and the extent of the repair of this damage, seems to determine a cell's response to such parameters as inactivation, mutation, transformation, latent viral activation, cellular viral capacity and ultraviolet enhanced viral reactivation. In addition to the direct effects of UV on DNA, photosensitization of cellular responses with chemicals such as 8-MOP extend the wavelength range at which damage can be demonstrated. (U.K.)

  11. Damage assessment in CFRP laminates exposed to impact fatigue loading

    International Nuclear Information System (INIS)

    Tsigkourakos, George; Silberschmidt, Vadim V; Ashcroft, I A


    Demand for advanced engineering composites in the aerospace industry is increasing continuously. Lately, carbon fibre reinforced polymers (CFRPs) became one of the most important structural materials in the industry due to a combination of characteristics such as: excellent stiffness, high strength-to-weight ratio, and ease of manufacture according to application. In service, aerospace composite components and structures are exposed to various transient loads, some of which can propagate in them as cyclic impacts. A typical example is an effect of the wind gusts during flight. This type of loading is known as impact fatigue (IF); it is a repetition of low-energy impacts. Such loads can cause various types of damage in composites: fibre breaking, transverse matrix cracking, de-bonding between fibres and matrix and delamination resulting in reduction of residual stiffness and loss of functionality. Furthermore, this damage is often sub-surface, which reinforces the need for more regular inspection. The effects of IF are of major importance due its detrimental effect on the structural integrity of components that can be generated after relatively few impacts at low force levels compared to those in a standard fatigue regime. This study utilises an innovative testing system with the capability of subjecting specimens to a series of repetitive impacts. The primary subject of this paper is to assess the damaging effect of IF on the behaviour of drilled CFRP specimens, exposed to such loading. A detailed damage analysis is implemented utilising an X-ray micro computed tomography system. The main findings suggested that at early stages of life damage is governed by o degree splits along the length of the specimens resulting in a 20% reduction of stiffness. The final failure damage scenario indicated that transverse crasks in the 90 degree plies are the main reason for complete delamination which can be translated to a 50% stiffness reduction.

  12. Exposing the cancer genome atlas as a SPARQL endpoint. (United States)

    Deus, Helena F; Veiga, Diogo F; Freire, Pablo R; Weinstein, John N; Mills, Gordon B; Almeida, Jonas S


    The Cancer Genome Atlas (TCGA) is a multidisciplinary, multi-institutional effort to characterize several types of cancer. Datasets from biomedical domains such as TCGA present a particularly challenging task for those interested in dynamically aggregating its results because the data sources are typically both heterogeneous and distributed. The Linked Data best practices offer a solution to integrate and discover data with those characteristics, namely through exposure of data as Web services supporting SPARQL, the Resource Description Framework query language. Most SPARQL endpoints, however, cannot easily be queried by data experts. Furthermore, exposing experimental data as SPARQL endpoints remains a challenging task because, in most cases, data must first be converted to Resource Description Framework triples. In line with those requirements, we have developed an infrastructure to expose clinical, demographic and molecular data elements generated by TCGA as a SPARQL endpoint by assigning elements to entities of the Simple Sloppy Semantic Database (S3DB) management model. All components of the infrastructure are available as independent Representational State Transfer (REST) Web services to encourage reusability, and a simple interface was developed to automatically assemble SPARQL queries by navigating a representation of the TCGA domain. A key feature of the proposed solution that greatly facilitates assembly of SPARQL queries is the distinction between the TCGA domain descriptors and data elements. Furthermore, the use of the S3DB management model as a mediator enables queries to both public and protected data without the need for prior submission to a single data source. Copyright © 2010 Elsevier Inc. All rights reserved.

  13. Neurodevelopmental delay in children exposed in utero to hyperemesis gravidarum. (United States)

    Fejzo, Marlena S; Magtira, Aromalyn; Schoenberg, Frederic Paik; Macgibbon, Kimber; Mullin, Patrick M


    The purpose of this study is to determine the frequency of emotional, behavioral, and learning disorders in children exposed in utero to hyperemesis gravidarum (HG) and to identify prognostic factors for these disorders. Neurodevelopmental outcomes of 312 children from 203 mothers with HG were compared to neurodevelopmental outcomes from 169 children from 89 unaffected mothers. Then the clinical profiles of patients with HG and a normal child outcome were compared to the clinical profiles of patients with HG and a child with neurodevelopmental delay to identify prognostic factors. Binary responses were analyzed using either a Chi-square or Fisher Exact test and continuous responses were analyzed using a t-test. Children exposed in utero to HG have a 3.28-fold increase in odds of a neurodevelopmental diagnosis including attention disorders, learning delay, sensory disorders, and speech and language delay (Pneurodevelopmental delay. We found no evidence for increased risk of 13 emotional, behavioral, and learning disorders, including autism, intellectual impairment, and obsessive-compulsive disorder. However, the study was not sufficiently powered to detect rare conditions. Medications, treatments, and preterm birth were not associated with an increased risk for neurodevelopmental delay. Women with HG are at a significantly increased risk of having a child with neurodevelopmental delay. Common antiemetic treatments were not linked to neurodevelopmental delay, but early symptoms may play a role. There is an urgent need to address whether aggressive treatment that includes vitamin and nutrient supplementation in women with early symptoms of severe nausea of pregnancy decreases the risk of neurodevelopmental delay. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  14. Clastogenic factors in the plasma of children exposed at Chernobyl

    International Nuclear Information System (INIS)

    Emerit, I.; Levy, A.; Cernjavski, L.; Alaoui-Youssefi, A.; Pogossian, A.; Quastel, M.; Goldsmith, J.; Merkin, L.; Riklis, E.


    Clastogenic factors (CFs), as they were described previously in accidentally or therapeutically irradiated persons, in A-bomb survivors and in liquidators of the Chernobyl nuclear power plant, were also detected in the plasma of Chernobyl-exposed children. A high percentage of plasma ultrafiltrates from 170 children, immigrated to Israel in 1990, exerted clastogenic effects in test cultures set up with blood from healthy donors. The differences were highly significant in comparison to children immigrated from 'clean' cities of the former Soviet Union or children born in Israel. The percentage of CF-positive children and the mean values of the adjusted clastogenic scores (ACS) were higher for those coming from Gomel and Mozyr, which are high exposure sites (IAEA measurements), compared to those coming from Kiev. There was no correlation between residual 137-Caesium body burden and presence of CFs. However, both measurements were not done at the same time (in 1990 and 1992-1994, respectively). Also no relationship could be revealed between enlargement of the thyroid gland and CF-positivity. CFs are not only observed after irradiation, but in a variety of chronic inflammatory diseases with autoimmune reactions. They were also described in the congenital breakage syndromes, which are hereditary diseases with the highest cancer incidence in humans. Whether the clastogenic effects continuously produced by circulating CFs represent a risk factor for malignant late effects deserves further study and follow-up. Since CF formation and CF action are mediated by superoxide radicals, prophylactic treatment with antioxidants may be suggested for Chernobyl-exposed children, whose plasma induces a strongly positive CF-test

  15. Viability and Virulence of Entomopathogenic Nematodes Exposed to Ultraviolet Radiation. (United States)

    Shapiro-Ilan, David I; Hazir, Selcuk; Lete, Luis


    Entomopathogenic nematodes (EPNs) can be highly effective biocontrol agents, but their efficacy can be reduced due to exposure to environmental stress such as from ultraviolet (UV) radiation. Our objectives were to 1) compare UV tolerance among a broad array of EPN species, and 2) investigate the relationship between reduced nematode viability (after exposure to UV) and virulence. Nematodes exposed to a UV radiation (254 nm) for 10 or 20 min were assessed separately for viability (survival) and virulence to Galleria mellonella. We compared 9 different EPN species and 15 strains: Heterorhabditis bacteriophora (Baine, fl11, Oswego, and Vs strains), H. floridensis (332), H. georgiana (Kesha), H. indica (HOM1), H. megidis (UK211), Steinernema carpocapsae (All, Cxrd, DD136, and Sal strains), S. feltiae (SN), S. rarum (17C&E), and S. riobrave (355). In viability assessments, steinernematids, particularly strains of S. carpocapsae, generally exhibited superior UV tolerance compared with the heterorhabditids. However, some heterorhabditids tended to be more tolerant than others, e.g., H. megidis and H. bacteriophora (Baine) were most susceptible and H. bacteriophora (Vs) was the only heterorhabditid that did not exhibit a significant effect after 10 min of exposure. All heterorhabditids experienced reduced viability after 20 min exposure though several S. carpocapsae strains did not. In total, after 10 or 20 min exposure, the viability of seven nematode strains did not differ from their non-UV exposed controls. In virulence assays, steinernematids (particularly S. carpocapsae strains) also tended to exhibit higher UV tolerance. However, in contrast to the viability measurements, all nematodes experienced a reduction in virulence relative to their controls. Correlation analysis revealed that viability among nematode strains is not necessarily related to virulence. In conclusion, our results indicate that the impact of UV varies substantially among EPNs, and viability alone

  16. Beta dosimetry in teeth from SR-90 exposed subjects

    International Nuclear Information System (INIS)

    Fattibene, P.; De Coste, V.; Onori, S.; Veronese, I.; Giussani, A.; Cantone, M.C.; Shishkina, E.


    Tooth enamel is a well recognized dosimeter for retrospective dose reconstruction of individuals accidentally exposed to ionizing radiation. The measurements of the absorbed dose in tooth enamel is conventionally carried out with the Electron Paramagnetic Resonance technique. Tooth enamel is sensitive to all kind of ionizing radiation. Its response to photons has been widely investigated. For application to contaminated teeth with 90 Sr, one of the most common osteo tropic radionuclides, the effectiveness of tooth enamel response to the β spectrum needs be evaluated. The response function to 90 Sr of the EPR/tooth enamel systems, its linearity and reproducibility have been investigated under a controlled geometry, and the results will be presented and compared to those obtained with photons. When the subject has been exposed to both external and internal radiation, a combined EPR/T.L. method can be used to distinguish the internal from the external contribution to the cumulative dose in tooth (Gosku et al., 2002;=Veronese et al. 2004, Shishkina et al. 2005). The T.L. measurement, performed putting thin ± Al 2 O 3 :C dosimeters at contact with the tooth surfaces, enables to estimate the beta dose rate due to the radionuclides present in tooth. The combination of this information with that coming from EPR allows, under specific assumptions, to evaluate separately the internal and external contribution to the tooth dose. In a previous work (Veronese et al., 2004) the dose in enamel measured by EPR in a tooth contaminated with 90 Sr of a Techa River resident was compared to the dose rate measured by TLDs. The test has been extended to a larger number of 90 Sr contaminated teeth. EPR measurements have been also performed in other portions of the teeth, i.e. tooth dentin and root. The correlation between the results, obtained from EPR and TLD measurements, and the evaluation of the relative proportion of internal and external dose are presented and discussed. (authors)

  17. Performance of Raphidocelis subcapitata exposed to heavy metal mixtures. (United States)

    Expósito, Nora; Kumar, Vikas; Sierra, Jordi; Schuhmacher, Marta; Giménez Papiol, Gemma


    Microalgae growth inhibition assays are candidates for referent ecotoxicological assays, and are a fundamental part in the strategy to reduce the use of fish and other animal models in aquatic toxicology. In the present work, the performance of Raphidocelis subcapitata exposed to heavy metals following standardized growth inhibition assays has been assessed in three different scenarios: 1) dilutions of single heavy metals, 2) artificial mixture of heavy metals at similar levels than those found in natural rivers and, 3) natural samples containing known mixtures of contaminants (heavy metals). Chemical speciation of heavy metals has been estimated with Eh-pH diagram and Visual MINTEQ software; heavy metal and free heavy metal ion concentrations were used as input data, together with microalgae growth inhibition, for Dr. Fit software. The final goal was to assess the suitability of the ecotoxicological test based on the growth inhibition of microalgae cultures, and the mathematic models based on these results, for regulatory and decision-making purposes. The toxicity of a given heavy metal is not only determined by its chemical speciation; other chemical and biological interaction play an important role in the final toxicity. Raphidocelis subcapitata 48h-h-EC50 for tested heavy metals (especially Cu and Zn) were in agreement with previous studies, when ion metal bioavailability was assumed to be 100%. Nevertheless, the calculated growth inhibition was not in agreement with the obtained inhibition when exposed to the artificial mixture of heavy metals or the natural sample. Interactions between heavy metal ions and the compounds of the culture media and/or the natural sample determine heavy metal bioavailability, and eventually their toxicity. More research is needed for facing the challenge posed by pollutant mixtures as they are present in natural environments, and make microalgae-based assays suitable for pollution management and regulatory purposes. Copyright

  18. Developmental dental defects in children exposed to PCBs

    Energy Technology Data Exchange (ETDEWEB)

    Jan, J. [Ljubljana Univ. (Slovenia). Fac. of Medicine; Sovcikova, E.; Kovrizhnykh, I.; Wimmerova, S.; Trnovec, T. [Slovak Medical Univ., Bratislava (Slovakia). Inst. of Preventive and Clinical Medicine; Kocan, A. [Institute of Preventive and Clinical Medicine, Bratislava (Slovakia). Dept. of Toxic Organic Pollutants


    Developing enamel is sensitive to a wide range of local and systemic disturbances. Because of the absolute metabolic stability of its structure, changes in enamel during its development are permanent in nature. Polychlorinated biphenyls (PCB) have been shown to disturb tooth development in experimental animals, but only limited amounts of data exist on their adverse effects in humans. Dental changes such as mottled, chipped, carious, and neonatal teeth have been reported in accidentally exposed humans. Nevertheless, co-contamination with polychlorinated dibenzo-furans (PCDFs) was largely responsible for the overall toxicity4. Alaluusua et al. found that developmental dental defects were correlated with the total exposure to polychlorinated aromatic hydrocarbons via mother's milk. The correlation was strong with exposure to prevailing levels of polychlorinated dibenzo-p-dioxins (PCDD) and furans (PCDF) but weak with exposure to PCBs alone. In our previous study we have shown developmental dental defects in children exposed to PCBs alone6, suggesting that the developing human teeth are vulnerable to PCBs. In the Michalovce region of eastern Slovakia, PCBs from a chemical plant manufacturing Delors contaminated the surrounding district7. The total serum PCB levels in samples from the general population there exceeded by several times the background levels in subjects living in a comparable unexposed Svidnik district. PCB levels in breast milk samples in the Michalovce region were the highest in Slovakia. Levels of toxic polychlorinated aromatics (PCDFs, PCNs, and planar PCBs) in technical Delors were high. The aim of this study was to evaluate the effects of long-term exposure to PCBs, measured at the individual level, on developmental dental defects in children in eastern Slovakia.

  19. Study of chromosome aberrations on the workers occupationally exposed to thorium and rare earth mixed dust

    International Nuclear Information System (INIS)

    Zhang Wei; Wang Chunyan; Lv Huiming; Zhang Cuilan; Hao Shuxia; Su Xu; Jia Kejun; Liu Yufei


    Objective: To study the effect of thorium and rare earth mixed dust on chromosome aberrations in the lymphocytes of occupational exposed workers. Methods: Analyses of unstable chromosome aberrations on 53 occupational exposed workers and 58 control workers were carried out by the conventional Giemsa staining method. Fluorescence in situ hybridization method was performed to analyze the chromosome stable aberrations on 10 occupational exposed workers and l0 control workers. Results: The frequencies of chromosomal aberration cells, dicentrics plus rings, total aberrations in exposed workers were significantly higher than those in controls. No significant difference was found in the frequency of acentric aberrations between exposed and non-exposed workers. No significant difference was found in the frequency of translocations between exposed and non-exposed workers. Conclusions: Chronically occupational exposure to thorium and rare earth mixed dust can increase the induction of unstable chromosome aberration, but the increase of stable chromosome aberrations (translocation) can not be observed. (authors)

  20. 9 CFR 73.8 - Cattle infected or exposed during transit. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle infected or exposed during... SCABIES IN CATTLE § 73.8 Cattle infected or exposed during transit. (a) Healthy cattle from unquarantined State exposed en route. Should healthy cattle in transit from a State not quarantined by the Secretary...

  1. Overview of the ISS Radiation Environment Observed during the ESA EXPOSE-R2 Mission in 2014-2016 (United States)

    Dachev, T. P.; Bankov, N. G.; Tomov, B. T.; Matviichuk, Yu. N.; Dimitrov, Pl. G.; Häder, D.-P.; Horneck, G.


    The radiation risk radiometer-dosimeter (R3D)-R2 solid-state detector performed radiation measurements at the European Space Agency EXPOSE-R2 platform outside of the Russian "Zvezda" module at the International Space Station (ISS) from 24 October 2014 to 11 January 2016. The ISS orbital parameters were average altitude of 415 km and 51.6° inclination. We developed special software and used experimentally obtained formulas to determine the radiation flux-to-dose ratio from the R3DR2 Liulin-type deposited-energy spectrometer. We provide for the first time simultaneous, long-term estimates of radiation dose external to the ISS for four source categories: (i) galactic cosmic ray particles and their secondary products; (ii) protons in the South Atlantic Anomaly region of the inner radiation belt (IRB); (iii) relativistic electrons and/or bremsstrahlung in the outer radiation belt (ORB); and (iv) solar energetic particle (SEP) events. The latter category is new in this study. Additionally, in this study, secondary particles (SP) resulting from energetic particle interaction with the detector and nearby materials are identified. These are observed continuously at high latitudes. The detected SPs are identified using the same sorting requirements as SEP protons. The IRB protons provide the highest consistent hourly dose, while the ORB electrons and SEPs provide the most extreme hourly doses. SEPs were observed 11 times during the study interval. The R3DR2 data support calculation of average equivalent doses. The 30 day and 1 year average equivalent doses are much smaller than the skin and eyes doses recommendations by the National Council on Radiation Protection (Report 132), which provides radiation protection guidance for Low Earth Orbit.

  2. Loi constitutive chimioplastique pour le beton expose aux hautes temperatures (United States)

    Hammoud, Rabah

    Concrete is the most widely used construction material in the world. Even though it has been used for several centuries, its behavior to high temperature remains to be understood. In the light of recent extreme events, including accidents, and arson, special attention has been focused on the performance of concrete in the fire safety assessment of buildings and tunnels. Fire represents one of the most severe conditions encountered during the life-time of a structure. Concrete exposed to high temperature can significantly jeopardize the structural integrity and load bearing capacity of the structure. Spalling of concrete remains one of the main issues to be addressed in the case of fire in buildings and tunnels. Successful modeling of this phenomenon depends not only on the accurate prediction of the temperature distribution through structural concrete but also on its mechanical response to the heating and boundaries restrains conditions and the migration of moisture and associated pore pressures. Therefore, it is necessary to develop a reliable formulation of concrete with all required information to understand its behavior during and after exposure to elevated temperature. It is also necessary to properly assess the effects of thermal degradation in order to develop predictive tools and validate design codes. Many structural problems can be adequately worthy by an elastoplastic model. The ultimate goal of this study is the development of a new constitutive model under a chemoplastic framework. To do this, an experimental program is carried out. The purpose of this program is twofold. First, it is essential to calibrate the proposed constitutive law that will be developed, and, second, for defining an inverse a problem. Usually, uniaxial and triaxial tests, conducted with confining pressure varied between 1.3 and 24 MPa and a temperature up to 700°C, allow us to identify the constitutive law parameters. This law reproduces the reduced field strength due to

  3. Durability of Selected Membrane Materials when Exposed to Chlorine Gas

    Energy Technology Data Exchange (ETDEWEB)

    Eikeland, Marianne Soerflaten


    This thesis is focusing on the durability of selected membrane materials when exposed to chlorine gas in the temperature range 30-100{sup o}C. Studies of the changes of membrane separation properties and the mechanisms promoting these changes have been studied. The selected membrane materials were poly(dimethylsioxane) (PDMS), Fluorel, fluorosilicone, and blends of PDMS and Fluorel. The thesis is organised in seven chapters. The first chapter gives an introduction to the background of the work. The second chapter presents the theory for gas separation using dense rubbery membranes. The properties of the selected membrane materials are presented in chapter three. The fourth chapter describes degradation mechanisms for polymeric materials in general and for the selected membrane materials in particular. Presentation of the experimental work is given in chapter five, while the results with discussions are presented in chapter six. The conclusions and recommendations for further studies are given in chapter seven. Five appendixes are attached: Appendix A describes the calculations of permeability and solubility coefficients and the accuracy of the experimental measurements. Appendix B summarises the measured values in tables and Appendix C describes the analytical methods. Appendix D gives the properties of the gases used in the experiments. Appendix E is the article ''Durability of Poly(dimethylsiloxane) when Exposed to Chlorine Gas'', submitted to the Journal of Applied Polymer Science. Highly crosslinked PDMS was found to have an initial high permeability for chlorine gas and a high Cl{sub 2}/O{sub 2} selectivity. However when exposed to chlorine gas the permeability decreased significantly. Crosslinking of the PDMS polymer chain and chlorination of the polymer gave a denser polymer structure and thus lower permeability. Fluorel showed very low permeabilities and selectivities for the gases in question and was thus not interesting for this

  4. Pulmonary nodules in workers exposed to urban stressor

    International Nuclear Information System (INIS)

    Sancini, A.; Fioravanti, M.; Ciarrocca, M.; Palermo, P.; Fiaschetti, M.; Schifano, M.P.; Tomei, G.; Tomei, F.


    By multilayer spiral low-dose computed tomography (LD-CT) of the chest this study assesses the early detection of lung lesions on a sample of 100 traffic policemen of a big Italian city professionally exposed to urban pollutants and 100 controls non-occupationally exposed to urban pollutants matched by sex, age, length of service and cigarette smoking habit. Exposure to urban pollutants in traffic policemen was characterized using the annual average concentrations of PM 10 , NO 2 and benzene in the period 1998-2008 measured by fixed monitoring stations located in different areas of the city. A significant and increasing number of suspicious lung nodules with diameters between 5 and 10 mm was observed: in traffic policemen (including smokers and non-smokers) vs. controls (including smokers and non-smokers); in total smokers (including traffic policemen and controls) vs. total non-smokers (traffic policemen and controls); in smoker traffic policemen vs. smoker controls and vs. non-smoker traffic policemen; in non-smoker traffic policemen vs. non-smoker controls. The RR of finding cases with at least one lung nodule with diameters between 5 and 10 mm in traffic policemen (including smokers and non-smokers) compared to controls (including smokers and non-smokers) is 1.94 (CI 1.13-3.31); in total smokers vs. non-smokers the RR is 1.96 (CI 1.20-3.19). The comparison between the interaction exposure and smoking shows an increase in smoker traffic policemen than in smoker controls (RR=2.14; CI 1.02-4.52). The RR for smoker traffic policemen was higher than in non-smoker traffic policemen (RR=2.09; CI 1.19-3.66). The results of our study show that: (1) while smoker workers have a higher risk for developing solid suspicious lung nodules, the simple routinely exposure to urban pollutants is unable to produce the same kind of increased risk; (2) the interaction of smoking and exposure to urban pollutants greatly increases the risk for the development of solid suspicious lung

  5. Pulmonary nodules in workers exposed to urban stressor

    Energy Technology Data Exchange (ETDEWEB)

    Sancini, A. [University of Rome ' Sapienza' , Department of Occupational Medicine, Viale Regina Elena 336, 00161 Rome (Italy); Fioravanti, M. [University of Rome ' Sapienza' , Department of Psychiatric Science and Psychological Medicine, Piazzale Aldo Moro 5, 00185 Rome (Italy); Ciarrocca, M.; Palermo, P.; Fiaschetti, M.; Schifano, M.P. [University of Rome ' Sapienza' , Department of Occupational Medicine, Viale Regina Elena 336, 00161 Rome (Italy); Tomei, G. [University of Rome ' Sapienza' , Department of Psychiatric Science and Psychological Medicine, Piazzale Aldo Moro 5, 00185 Rome (Italy); Tomei, F., E-mail: [University of Rome ' Sapienza' , Department of Occupational Medicine, Viale Regina Elena 336, 00161 Rome (Italy)


    By multilayer spiral low-dose computed tomography (LD-CT) of the chest this study assesses the early detection of lung lesions on a sample of 100 traffic policemen of a big Italian city professionally exposed to urban pollutants and 100 controls non-occupationally exposed to urban pollutants matched by sex, age, length of service and cigarette smoking habit. Exposure to urban pollutants in traffic policemen was characterized using the annual average concentrations of PM{sub 10}, NO{sub 2} and benzene in the period 1998-2008 measured by fixed monitoring stations located in different areas of the city. A significant and increasing number of suspicious lung nodules with diameters between 5 and 10 mm was observed: in traffic policemen (including smokers and non-smokers) vs. controls (including smokers and non-smokers); in total smokers (including traffic policemen and controls) vs. total non-smokers (traffic policemen and controls); in smoker traffic policemen vs. smoker controls and vs. non-smoker traffic policemen; in non-smoker traffic policemen vs. non-smoker controls. The RR of finding cases with at least one lung nodule with diameters between 5 and 10 mm in traffic policemen (including smokers and non-smokers) compared to controls (including smokers and non-smokers) is 1.94 (CI 1.13-3.31); in total smokers vs. non-smokers the RR is 1.96 (CI 1.20-3.19). The comparison between the interaction exposure and smoking shows an increase in smoker traffic policemen than in smoker controls (RR=2.14; CI 1.02-4.52). The RR for smoker traffic policemen was higher than in non-smoker traffic policemen (RR=2.09; CI 1.19-3.66). The results of our study show that: (1) while smoker workers have a higher risk for developing solid suspicious lung nodules, the simple routinely exposure to urban pollutants is unable to produce the same kind of increased risk; (2) the interaction of smoking and exposure to urban pollutants greatly increases the risk for the development of solid

  6. Airway inflammation among compost workers exposed to actinomycetes spores

    Directory of Open Access Journals (Sweden)

    Kari Kulvik Heldal


    Full Text Available Objectives. To study the associations between exposure to bioaerosols and work-related symptoms, lung function and biomarkers of airway inflammation in compost workers. Materials and method. Personal full-shift exposure measurements were performed on 47 workers employed at five windrow plants (n=20 and five reactor plants (n=27. Samples were analyzed for endotoxins, bacteria, fungal and actinomycetes spores. Health examinations were performed on workers and 37 controls before and after work on the day exposure was measured. The examinations included symptoms recorded by questionnaire, lung function by spirometry and nasal dimensions by acoustic rhinometry (AR. The pneumoproteins CC16, SP-D and SP-A were measured in a blood sample drawn at the end of the day. Results. The levels of endotoxins (median 3 EU/m[sup]3[/sup] , range 0–730 EU/m[sup]3[/sup] and actinomycetes spores (median 0.2 × 10[sup]6[/sup] spores/m[sup]3[/sup] , range 0–590 × 10[sup]6[/sup] spores/m[sup]3[/sup] were significantly higher in reactor plants compared to windrow plants. However, windrow composting workers reported more symptoms than reactor composting workers, probably due to use of respiratory protection. Exposure-response relationships between actinomycetes spores exposure and respiratory effects, found as cough and nose irritation during a shift, was significantly increased (OR 4.3, 95% CI 1.1–16, OR 6.1, 95% CI 1.5–25, respectively, p<0.05 among workers exposed to 0.02–0.3 × 10[sup]6[/sup] actinomycetes spores/m 3 , and FEV1/FVC% decreased cross shift (b=–3.2, SE=1.5%, p<0.01. Effects were weaker in the highest exposed group, but these workers used respiratory protection, frequently limiting their actual exposure. No relationships were found between exposure and pneumoprotein concentrations. Conclusions. The major agent in the aerosol generated at compost plants was actinomycetes spores which was associated with work related cough symptoms and work

  7. Frequency of marriage and live birth among survivors prenatally exposed to the atomic bomb

    International Nuclear Information System (INIS)

    Blot, W.J.; Shimizu, Y.; Kato, H.; Miller, R.W.


    Frequency of marriage and birth as of January 1973 was determined for persons exposed in utero to the atomic bombs in 1945 and for controls. The marriage rate was lower in persons heavily exposed in utero than in the non-exposed or lightly exposed. This difference is attributed partly to the lesser marriageability of persons with mental retardation who are significantly more numerous among the heavily exposed, and partly to unmeasured variables, possibly including social discrimination against survivors of the atomic bomb. No consistent relation was observed between radiation exposure and three reproductive indices: childless marriages, number of births, and interval between marriage and first birth

  8. The management of workers occupationally exposed to ionizing radiation

    International Nuclear Information System (INIS)


    In Canada, the regulation of radiation protection is a shared responsibility between the federal body (the Atomic Energy Control Board) and the appropriate provincial body (usually the Department of Health, or Department of Labour). The AECB is responsible, for example, for regulating the development, application and use of nuclear energy and radioisotopes, and the provinces are responsible for the regulation of all other forms of ionizing and non-ionizing radiations and for naturally-occurring radioactive material (NORM). Although there is consultation between the federal and provincial regulatory agencies, the division of jurisdictional authority has resulted in considerable differences in the approach towards implementation radiation protection programs in Canada. This is especially true in the management of workers occupationally exposed to ionizing radiation. These differences have produced unwarranted discrepancies in operating procedures and practices in the allocation of resources and manpower, and in the requirements governing radiological training, personnel monitoring and medical surveillance. In light of the General Amendments to the AEC Regulations, the 1990 Recommendations of the ICRP, and the IAEA recommendations on safety culture, the ACRP has considered it timely to undertake a study to examine the feasibility of establishing a more coherent approach to harmonize radiation protection practices within Canada. This study comprised an examination of the regulatory approach used in several countries: a review of the nature of radiation safety programs in various types of licensed institutions and facilities in Canada; and a review of recommendations of internationally-recognized authorities in radiation protection

  9. Psychological therapies for children and adolescents exposed to trauma. (United States)

    Gillies, Donna; Maiocchi, Licia; Bhandari, Abhishta P; Taylor, Fiona; Gray, Carl; O'Brien, Louise


    Children and adolescents who have experienced trauma are at high risk of developing post-traumatic stress disorder (PTSD) and other negative emotional, behavioural and mental health outcomes, all of which are associated with high personal and health costs. A wide range of psychological treatments are used to prevent negative outcomes associated with trauma in children and adolescents. To assess the effects of psychological therapies in preventing PTSD and associated negative emotional, behavioural and mental health outcomes in children and adolescents who have undergone a traumatic event. We searched the Cochrane Common Mental Disorders Group's Specialised Register to 29 May 2015. This register contains reports of relevant randomised controlled trials from The Cochrane Library (all years), EMBASE (1974 to date), MEDLINE (1950 to date) and PsycINFO (1967 to date). We also checked reference lists of relevant studies and reviews. We did not restrict the searches by date, language or publication status. All randomised controlled trials of psychological therapies compared with a control such as treatment as usual, waiting list or no treatment, pharmacological therapy or other treatments in children or adolescents who had undergone a traumatic event. Two members of the review group independently extracted data. We calculated odds ratios for binary outcomes and standardised mean differences for continuous outcomes using a random-effects model. We analysed data as short-term (up to and including one month after therapy), medium-term (one month to one year after therapy) and long-term (one year or longer). Investigators included 6201 participants in the 51 included trials. Twenty studies included only children, two included only preschool children and ten only adolescents; all others included both children and adolescents. Participants were exposed to sexual abuse in 12 trials, to war or community violence in ten, to physical trauma and natural disaster in six each and to

  10. Exposing region duplication through local geometrical color invariant features (United States)

    Gong, Jiachang; Guo, Jichang


    Many advanced image-processing softwares are available for tampering images. How to determine the authenticity of an image has become an urgent problem. Copy-move is one of the most common image forgery operations. Many methods have been proposed for copy-move forgery detection (CMFD). However, most of these methods are designed for grayscale images without any color information used. They are usually not suitable when the duplicated regions have little structure or have undergone various transforms. We propose a CMFD method using local geometrical color invariant features to detect duplicated regions. The method starts by calculating the color gradient of the inspected image. Then, we directly take the color gradient as the input for scale invariant features transform (SIFT) to extract color-SIFT descriptors. Finally, keypoints are matched and clustered before their geometrical relationship is estimated to expose the duplicated regions. We evaluate the detection performance and computational complexity of the proposed method together with several popular CMFD methods on a public database. Experimental results demonstrate the efficacy of the proposed method in detecting duplicated regions with various transforms and poor structure.

  11. Lung scintigraphy evaluation in workers exposed to abrasive dusts

    International Nuclear Information System (INIS)

    Terra Filho, Mario


    The production process of abrasives use aluminium, or silicon carbide a synthetic material with a hardness only slightly less than that of a diamond. It is popularly known as carborundum since it was first manufactured as an abrasive in 1891, produced by the fusion of high grade silica and petroleum coke with sawdust. For many years silicon carbide was thought not to give rise to pulmonary lesions. Recently several researchers suggested the existence of a carborundum pneumoconiosis. The aim of this study was to evaluate the role of the pulmonary clearance of 99m Technetium chelated to diethylene-triamine penta-acetate ( 99m Tc DTPA), and 67 Gallium lung scanning in workers exposed to abrasive dusts. Thirty seven subjects, 13 smokers and 24 nonsmokers and ex smokers were studied. In 32 (86,48%) 67 Gallium lung scanning was positive including 13 (40,62%) retired workers. We conclude that non smoking workers of abrasives plants have a pulmonary alveolar epithelial permeability disturbance similar as observed in smoking workers and smoking controls. Most workers, ex-workers of these industries and in patients with carborundum pneumoconiosis there is an evidence of pulmonary inflammation measured with abnormal 67 Gallium lung scan. (author)

  12. Studies on chromosome aberrations in workers occupationally exposed to radiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong Hyung; Oh, Hyeon Joo; Shim, Sun Bo; Roh, Hye Won; Lee, Hai Yong [Korea Food and Drug Administration, Seoul (Korea, Republic of); Kang, Soon Ja [Ewha Womens Univ., Seoul (Korea, Republic of)


    Cytogenetic assays for unstable chromosomes were performed on 54 medical radiation workers who are occupationally exposed to radiation and 42 controls. A total of 15,577 metaphase cells were scored. The frequencies of dicentrics and acentric chromosomes on controls were 0.52*10{sup -3} and 0.82*10{sup -2}, respectively. On radiation workers those were 2.28*10{sup -3} and 1.34*10{sup -2}, respectively. Though the frequencies of all types of chromosome aberrations in the workers were higher than those in the controls, the only significant difference was found in the case of dicentrics (P < 0.01). When we considered exposure dose of recent one year, duration of employment and smoking habit in radiation worker, a slight increase was shown in frequency of unstable chromosome aberrations on these workers, but no statistical differences were observed (P > 0.05) except exposure dose of recent one year (P < 0.05). These results could indicate that low level exposure to ionizing radiation can induce unstable chromosome aberrations in blood lymphocytes.

  13. Reproductive function in mice exposed to ancestral and direct irradiation

    International Nuclear Information System (INIS)

    Nash, D.J.; Sprackling, L.S.


    Reproduction was studied in 13 inbred strains of mice that had been exposed continuously to 60 Co gamma radiation for varying numbers of generations. At weaning the mice were removed from the irradiation chamber and were tested for reproductive performance. Ancestral and direct levels of irradiation were determined for each animal. Each irradiated or control female was scored as fertile or sterile, and in utero litter counts were made in pregnant females that were dissected past the 10th day of pregnancy. The number of resorptions, dead embryos, and live embryos were counted, and the ratio of living embryos to the total number of embryos was determined for each litter. The overall fertility curves were sigmoid in the range of doses below those which caused complete sterility, which indicated some sort of cumulative damage. In 11 of the 13 strains studied, an increase in ancestral and/or direct irradiation led to significant decreases in fertility. The means of the number alive in the litters for the control and irradiated mice in each strain showed a definite trend toward fewer live mice in utero after irradiation. Least-squares analyses of variance were made to detect possible effects of any of six irradiation variables (ancestral linear, ancestral quadratic, ancestral cubic, direct linear, direct quadratic, or direct cubic) or of strain differences on total litter size and on ratio. Strain effects were significant in each instance. Litter size was more likely to be affected by radiation variables than ratios were

  14. Photoactivation of corticosteroids in UVB-exposed skin. (United States)

    Miolo, G; Caffieri, S; Dalzoppo, D; Gallocchio, F; Fasani, E; Beyersbergen van Henegouwen, G M J


    The photodegradation of flumethasone (FM) and fluocinolone acetonide (FC) was studied in solution and in the pig skin. Both glucocorticosteroids applied to the pig skin were unstable under UVB light. The photoproducts formed in the skin were the lumi-, photolumi- and andro-derivatives for FM, the same found in vitro. Instead, FC hydroperoxide formed in solution was not found in the skin: the reactivity and oxidative ability of this photoproduct towards biological substrates (lipids, proteins) seems the reason of the lack of its detection in the ex vivo model. In fact, it demonstrated to quickly oxidize amino acids and peptides, and to react with BSA both in the dark and under irradiation. Moreover, the presence in the irradiated pig skin of the FC andro-derivative, which usually forms in H-donating environment, seems consistent with the mechanism of Norrish I fragmentation followed by H-abstraction, likely from the surrounding biological substrates. These findings indicate that photoreactivity of these compounds may take place in the skin of patients exposing themselves to sunlight and is a warning about possible skin damage as a result of that. Furthermore, photolability of these drugs in the skin might cause loss of their therapeutic activity. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. Exercise Training Reverses Extrapulmonary Impairments in Smoke-exposed Mice. (United States)

    Bowen, T Scott; Aakerøy, Lars; Eisenkolb, Sophia; Kunth, Patricia; Bakkerud, Fredrik; Wohlwend, Martin; Ormbostad, Anne Marie; Fischer, Tina; Wisloff, Ulrik; Schuler, Gerhard; Steinshamn, Sigurd; Adams, Volker; Bronstad, Eivind


    Cigarette smoking is the main risk factor for chronic obstructive pulmonary disease and emphysema. However, evidence on the extrapulmonary effects of smoke exposure that precede lung impairments remains unclear at present, as are data on nonpharmacological treatments such as exercise training. Three groups of mice, including control (n = 10), smoking (n = 10), and smoking with 6 wk of high-intensity interval treadmill running (n = 11), were exposed to 20 wk of fresh air or whole-body cigarette smoke. Exercise capacity (peak oxygen uptake) and lung destruction (histology) were subsequently measured, whereas the heart, peripheral endothelium (aorta), and respiratory (diaphragm) and limb (extensor digitorum longus and soleus) skeletal muscles were assessed for in vivo and in vitro function, in situ mitochondrial respiration, and molecular alterations. Smoking reduced body weight by 26% (P 0.05). Smoking impaired exercise capacity by 15% while inducing right ventricular dysfunction by ~20%, endothelial dysfunction by ~20%, and diaphragm muscle weakness by ~15% (all P exercise training (P smoking mice had normal limb muscle and mitochondrial function (cardiac and skeletal muscle fibers); however, diaphragm measures of oxidative stress and protein degradation were increased by 111% and 65%, respectively (P exercise training (P smoking reduced exercise capacity concomitant with functional impairments to the heart, peripheral endothelium, and respiratory muscle that preceded the development of overt emphysema. However, high-intensity exercise training was able to reverse these smoke-induced extrapulmonary impairments.

  16. Relaxation of microparticles exposed to hydrodynamic forces in microfluidic conduits. (United States)

    Janča, Josef; Halabalová, Věra; Polášek, Vladimír; Vašina, Martin; Menshikova, Anastasia Yu


    The behavior of microparticles exposed to gravitational and lift forces and to the velocity gradient in flow velocity profile formed in microfluidic conduits is studied from the viewpoint of the transient period (the relaxation) between the moment at which a particle starts to be transported by the hydrodynamic flow and the time at which it reaches an equilibrium position, characterized by a balance of all active forces. The theoretical model allowing the calculation of the relaxation time is proposed. The numerical calculus based on the proposed model is compared with the experimental data obtained under different experimental conditions, namely, for different lengths of microfluidic channels, different average linear velocities of the carrier liquid, and different sizes and densities of the particles used in the study. The results are important for the optimization of microfluidic separation units such as microthermal field-flow fractionation channels in which the separation or manipulation of the microparticles of various origin, synthetic, natural, biological, etc., is performed under similar experimental conditions but by applying an additional thermodynamic force.

  17. Optical flow estimation on image sequences with differently exposed frames (United States)

    Bengtsson, Tomas; McKelvey, Tomas; Lindström, Konstantin


    Optical flow (OF) methods are used to estimate dense motion information between consecutive frames in image sequences. In addition to the specific OF estimation method itself, the quality of the input image sequence is of crucial importance to the quality of the resulting flow estimates. For instance, lack of texture in image frames caused by saturation of the camera sensor during exposure can significantly deteriorate the performance. An approach to avoid this negative effect is to use different camera settings when capturing the individual frames. We provide a framework for OF estimation on such sequences that contain differently exposed frames. Information from multiple frames are combined into a total cost functional such that the lack of an active data term for saturated image areas is avoided. Experimental results demonstrate that using alternate camera settings to capture the full dynamic range of an underlying scene can clearly improve the quality of flow estimates. When saturation of image data is significant, the proposed methods show superior performance in terms of lower endpoint errors of the flow vectors compared to a set of baseline methods. Furthermore, we provide some qualitative examples of how and when our method should be used.

  18. Cytogenetic monitoring of nuclear workers occupationally exposed to ionising radiation

    International Nuclear Information System (INIS)

    Griciene, B.; Slapsyte, G.; Mierauskiene, J.


    Chromosome aberration (CA) analysis using Giemsa techniques was performed in blood lymphocytes of 84 nuclear workers with cumulative doses of 1-632 mSv during employment periods of 1-25 y. The control group comprised 82 healthy male donors. An estimated CA frequency in the total radiation-exposed group was significantly higher when compared with the controls (2.27 vs. 1.76 CA/100 cells, p 0.05). However, significant increase in the total CA frequency was determined in workers with additional internal exposure (2.54 CA/100 cells, p < 0.05) and those with registered neutron doses (2.95 CA/100 cells, p < 0.01). No correlation was found between CA frequency and occupational exposure dose. Borderline significant correlation was found between duration of employment and total CA (r = 0.218, p = 0.046, Fig. 2) and chromosome-type aberration (r = 0.265, p = 0.015) frequency. (authors)

  19. Synthesis of protein in intestinal cells exposed to cholera toxin

    International Nuclear Information System (INIS)

    Peterson, J.W.; Berg, W.D. Jr.; Coppenhaver, D.H.


    The mechanism by which cyclic adenosine monophosphate (AMP), formed by intestinal epithelial cells in response to cholera toxin, ultimately results in alterations in water and electrolyte transport is poorly understood. Several studies have indicated that inhibitors of transcription or translation block much of the transport of ions and water in the intestine and edema formation in tissue elicited by cholera toxin. Data presented in this study confirmed the inhibitory effects of cycloheximide on cholera toxin-induced fluid accumulation in the rabbit intestinal loop model. Neither cycloheximide nor actinomycin D altered the amount of cyclic AMP that accumulated in intestinal cells and Chinese hamster ovary cells exposed to cholera toxin. An increase in [ 3 H] leucine incorporation was readily demonstrable in intestinal epithelial cells from rabbits challenged with Vibrio cholerae. Similarly, intestinal epithelial cells incubated with cholera toxin for 4 hr synthesized substantially more protein than controls as determined by relative incorporation of [ 35 S] methionine. Most of the new protein synthesized in response to cholera toxin was membrane associated and of high molecular weight. The possible significance of the toxin-induced protein relative to cholera pathogenesis was discussed

  20. Melatonin protects uterus and oviduct exposed to nicotine in mice

    Directory of Open Access Journals (Sweden)

    Seyed Saadat Seyedeh Nazanin


    Full Text Available Smoking is associated with higher infertility risk. The aim of this study was to evaluate protective effects of melatonin on the uterus and oviduct in mice exposed to nicotine. Adult female mice (n=32 were divided into four groups. Group A: control animals received normal saline, Group B: injected with nicotine 40 μg/kg, Group C: injected with melatonin 10 μg, Group D: injected with nicotine 40 μg/kg and melatonin 10 μg. All animals were treated over 15 days intraperitoneally. On the 16th day, animals in the estrus phase were dissected and their uterus and oviducts were removed. Immunohistochemistry was recruited for studying apoptosis and for detection of estrogen receptor (ER alpha in luminal epithelium of the uterus and oviduct. Enzyme-linked immunosorbent assay was used for serum estradiol level determination. Nicotine in group B decreased estradiol level and ERalpha numbers both in the uterus and oviduct (p<0.05. Co-administration of melatonin-nicotine in Group D ameliorated the histology of the uterus and oviduct, increased ERalpha numbers and reduced apoptosis in the uterus and oviduct compared with the nicotine Group B (p<0.05. This study indicates that nicotine impairs the histology of the uterus and oviduct and co-administration of melatonin-nicotine ameliorates these findings, partly through alteration in ERalpha numbers and reduction of apoptosis

  1. Toward Exposing Timing-Based Probing Attacks in Web Applications. (United States)

    Mao, Jian; Chen, Yue; Shi, Futian; Jia, Yaoqi; Liang, Zhenkai


    Web applications have become the foundation of many types of systems, ranging from cloud services to Internet of Things (IoT) systems. Due to the large amount of sensitive data processed by web applications, user privacy emerges as a major concern in web security. Existing protection mechanisms in modern browsers, e.g., the same origin policy, prevent the users' browsing information on one website from being directly accessed by another website. However, web applications executed in the same browser share the same runtime environment. Such shared states provide side channels for malicious websites to indirectly figure out the information of other origins. Timing is a classic side channel and the root cause of many recent attacks, which rely on the variations in the time taken by the systems to process different inputs. In this paper, we propose an approach to expose the timing-based probing attacks in web applications. It monitors the browser behaviors and identifies anomalous timing behaviors to detect browser probing attacks. We have prototyped our system in the Google Chrome browser and evaluated the effectiveness of our approach by using known probing techniques. We have applied our approach on a large number of top Alexa sites and reported the suspicious behavior patterns with corresponding analysis results. Our theoretical analysis illustrates that the effectiveness of the timing-based probing attacks is dramatically limited by our approach.

  2. Mammalian cells exposed to ionizing radiation: structural and biochemical aspects

    International Nuclear Information System (INIS)

    Sabanero, M.; Flores V, L. L.; Azorin V, J. C.; Vallejo, M. A.; Cordova F, T.; Sosa A, M.; Castruita D, J. P.; Barbosa S, G.


    Acute or chronic exposure to ionizing radiation is a factor that may be hazardous to health. It has been reported that exposure to low doses of radiation (less than 50 mSv / year) and subsequently exposure to high doses have greater effects in people. However, it is unknown molecular and biochemical level alteration. This study, analyzes the susceptibility of a biological system (HeLa Atcc CCL-2 human cervix cancer cell line) to ionizing radiation (6 and 60 mSv/ 90). Our evaluate multiple variables such as: total protein profile, mitochondrial metabolic activity (XTT assay), cell viability (Trypan blue exclusion assay), cytoskeleton (actin micro filaments), nuclei (D API), genomic DNA. The results indicate, that cells exposed to ionizing radiation structurally show alterations in nuclear phenotype and aneuploidy, further disruption in the tight junctions and consequently on the distribution of actin micro filaments. Similar alterations were observed in cells treated with a genotoxic agent (200μM H 2 O 2 /1 h). In conclusion, this multi-criteria assessment enables precise comparisons of the effects of radiation between any biological systems. However, it is necessary to determine stress markers for integration of the effects of ionizing radiation. (Author)

  3. Men in nursing on television: exposing and reinforcing stereotypes. (United States)

    Weaver, Roslyn; Ferguson, Caleb; Wilbourn, Mark; Salamonson, Yenna


    To describe the results of a study of images of men in nursing on television. Previous research has highlighted stereotypical images around nursing, such as the battle-axe, naughty nurse and handmaiden. More recent research focuses on images of nurses who are men, because of the growing numbers of men in the nursing workforce. Given that negative images can harm recruitment and retention in the profession, it is important to interrogate how men in nursing are portrayed in popular culture. Representations on television are particularly critical to explore because of the medium's wide audience. Qualitative study. Five American medical television programmes appearing between 2007 and 2010 were analysed for their construction of men in nursing: Grey's Anatomy, Hawthorne, Mercy, Nurse Jackie and Private Practice. Men in nursing on television were portrayed in ways that engaged with explicit and implicit stereotypes. The men were often subject to questions about their choice of career, masculinity and sexuality and their role usually reduced to that of prop, minority spokesperson or source of comedy. Thus, rather contradictorily, although the programmes often sought to expose common stereotypes about men in nursing, they nonetheless often reinforced stereotypes in more implicit ways. This research has implications for better understanding not only the status of nursing in our society but also for nursing practice and education and attracting more men to the profession. © 2013 John Wiley & Sons Ltd.

  4. Runaway chemical reaction exposes community to highly toxic chemicals

    International Nuclear Information System (INIS)

    Kaszniak, Mark; Vorderbrueggen, John


    The U.S. Chemical Safety and Hazard Investigation Board (CSB) conducted a comprehensive investigation of a runaway chemical reaction at MFG Chemical (MFG) in Dalton, Georgia on April 12, 2004 that resulted in the uncontrolled release of a large quantity of highly toxic and flammable allyl alcohol and allyl chloride into the community. Five people were hospitalized and 154 people required decontamination and treatment for exposure to the chemicals. This included police officers attempting to evacuate the community and ambulance personnel who responded to 911 calls from residents exposed to the chemicals. This paper presents the findings of the CSB report (U.S. Chemical Safety and Hazard Investigation Board (CSB), Investigation Report: Toxic Chemical Vapor Cloud Release, Report No. 2004-09-I-GA, Washington DC, April 2006) including a discussion on tolling practices; scale-up of batch reaction processes; Process Safety Management (PSM) and Risk Management Plan (RMP) implementation; emergency planning by the company, county and the city; and emergency response and mitigation actions taken during the incident. The reactive chemical testing and atmospheric dispersion modeling conducted by CSB after the incident and recommendations adopted by the Board are also discussed

  5. End stage renal disease among ceramic workers exposed to silica. (United States)

    Rapiti, E; Sperati, A; Miceli, M; Forastiere, F; Di Lallo, D; Cavariani, F; Goldsmith, D F; Perucci, C A


    To evaluate whether ceramic workers exposed to silica experience an excess of end stage renal disease. On the basis of a health surveillance programme, a cohort of 2980 male ceramic workers has been enrolled during the period 1974-91 in Civitacastellana, Lazio, Italy. For each worker, employment history, smoking data, and x ray film readings were available. The vital status was ascertained for all cohort members. All 2820 people still alive and resident in the Lazio region as in June 1994 were searched for a match in the regional end stage renal diseases registry, which records (since June, 1994) all patients undergoing dialysis treatment in public and private facilities of the region. Expected numbers of prevalent cases from the cohort were computed by applying the rate of patients on dialysis treatment by the age distribution of the cohort. A total of six cases was detected when 1.87 were expected (observed/expected (O/E) = 3.21; 95% confidence interval (95% CI) 1.17 to 6.98). The excess risk was present among non-smokers (O = 2; O/E = 4.34) and smokers (O = 4; O/E = 2.83), as well as among workers without silicosis (O = 4; O/E = 2.78) and workers with silicosis (O = 2; O/E = 4.54). The risk was higher among subjects with 20 years. These results provide further evidence that exposure to silica dust among ceramic workers is associated with nephrotoxic effects.

  6. Toward Exposing Timing-Based Probing Attacks in Web Applications

    Directory of Open Access Journals (Sweden)

    Jian Mao


    Full Text Available Web applications have become the foundation of many types of systems, ranging from cloud services to Internet of Things (IoT systems. Due to the large amount of sensitive data processed by web applications, user privacy emerges as a major concern in web security. Existing protection mechanisms in modern browsers, e.g., the same origin policy, prevent the users’ browsing information on one website from being directly accessed by another website. However, web applications executed in the same browser share the same runtime environment. Such shared states provide side channels for malicious websites to indirectly figure out the information of other origins. Timing is a classic side channel and the root cause of many recent attacks, which rely on the variations in the time taken by the systems to process different inputs. In this paper, we propose an approach to expose the timing-based probing attacks in web applications. It monitors the browser behaviors and identifies anomalous timing behaviors to detect browser probing attacks. We have prototyped our system in the Google Chrome browser and evaluated the effectiveness of our approach by using known probing techniques. We have applied our approach on a large number of top Alexa sites and reported the suspicious behavior patterns with corresponding analysis results. Our theoretical analysis illustrates that the effectiveness of the timing-based probing attacks is dramatically limited by our approach.

  7. Thermoluminescent behavior of diamond thin films exposed to ultraviolet radiation

    International Nuclear Information System (INIS)

    Barboza F, M.; Gastelum, S.; Melendrez, R.; Chernov, V.; Bernal, R.; Cruz V, C.; Brown, F.


    In this work the thermoluminescent properties of diamond thin films are discussed which are grown up through the chemical vapor method exposed to ultraviolet radiation of 200-280 nm. The films with thickness 3, 6, 9, 12, 180 and 500 microns were grown up using a precursor gas formed of H 2 -CH 4 -CO excited through microwave energy or hot filament.The structure and morphology of the films were examined through scanning electron microscopy, indicating the formation of different diamond polycrystal structures which depend on the type of heating of the precursor gas used as well as the film dimensions. In general, the brilliance curve depends on the sample and the wavelength of the irradiation ultraviolet light, however it presents clearly thermoluminescence bands in 148, 160, 272, 304, 320 and 324 C degrees. The maximum of the thermoluminescence efficiency is obtained for the case of sample exposure with light of 214 nm. The sample of 500 microns is what exhibits greater thermoluminescent efficiency of those studied samples. The thermoluminescent behavior in function of radiation dose presents regions of linearity and supra linearity for higher and small doses respectively. The disappearance of the thermoluminescent signal depends on the characteristics of the film and it can reach until a 30 % of loss before to reach the stability. (Author)

  8. Mammalian cells exposed to ionizing radiation: structural and biochemical aspects

    Energy Technology Data Exchange (ETDEWEB)

    Sabanero, M.; Flores V, L. L. [Universidad de Guanajuato, Departamento de Biologia, DCNE, Noria Alta s/n, 36250 Guanajuato, Gto. (Mexico); Azorin V, J. C.; Vallejo, M. A.; Cordova F, T.; Sosa A, M. [Universidad de Guanajuato, Departamento de Ingenieria Fisica, DCI, Loma del Bosque 103, Col. Lomas del Campestre, 37150 Leon, Guanajuato (Mexico); Castruita D, J. P. [Universidad de Guadalajara, Departamento de Ecologia, CUCBA, Las Agujas, 45100 Zapopan, Jalisco (Mexico); Barbosa S, G., E-mail: [Universidad de Guanajuato, Departamento de Ciencias Medicas, DCS, 20 de Enero No. 929, Col. Obregon, 37000 Leon, Guanajuato (Mexico)


    Acute or chronic exposure to ionizing radiation is a factor that may be hazardous to health. It has been reported that exposure to low doses of radiation (less than 50 mSv / year) and subsequently exposure to high doses have greater effects in people. However, it is unknown molecular and biochemical level alteration. This study, analyzes the susceptibility of a biological system (HeLa Atcc CCL-2 human cervix cancer cell line) to ionizing radiation (6 and 60 mSv/ 90). Our evaluate multiple variables such as: total protein profile, mitochondrial metabolic activity (XTT assay), cell viability (Trypan blue exclusion assay), cytoskeleton (actin micro filaments), nuclei (D API), genomic DNA. The results indicate, that cells exposed to ionizing radiation structurally show alterations in nuclear phenotype and aneuploidy, further disruption in the tight junctions and consequently on the distribution of actin micro filaments. Similar alterations were observed in cells treated with a genotoxic agent (200μM H{sub 2}O{sub 2}/1 h). In conclusion, this multi-criteria assessment enables precise comparisons of the effects of radiation between any biological systems. However, it is necessary to determine stress markers for integration of the effects of ionizing radiation. (Author)

  9. The effect of kinetin on wheat seedlings exposed to boron. (United States)

    Eser, Ahmet; Aydemir, Tülin


    The objective of this study was to examine relationship between boron (B) induced oxidative stress and antioxidant system in boron sensitive and tolerant wheat cultivars Bezostaya and Kutluk, and also to investigate whether Kinetin (KN) enhances the level of antioxidant system, relative growth, concentration of hydrogen peroxide (H 2 O 2 ), malondialdehyde (MDA) and proline and chlorophyll content in both cultivars exposed to B stress. B treatments diminished growth and chlorophyll content whereas, it enhanced accumulation of H 2 O 2 , MDA and proline, and various antioxidant enzymes such as superoxide dismutase (SOD), catalase (CAT), ascorbate peroxidase (APX), guaiacol peroxidase (GPX) and lipoxygenase (LOX) in the shoot and root of both cultivars. However, the follow-up application of KN to the B stressed plants improved growth and chlorophyll content and further enhanced the mentioned antioxidant enzymes and level of H 2 O 2 , MDA and proline. This study thus suggests that KN improves B tolerance of the studied cultivars grown under B toxicity. Copyright © 2016. Published by Elsevier Masson SAS.

  10. Neurophysiological findings in vibration-exposed male workers. (United States)

    Strömberg, T; Dahlin, L B; Rosén, I; Lundborg, G


    Fractionated nerve conduction, vibrotactile sense, and temperature thresholds were studied in 73 symptomatic vibration-exposed male workers. Three symptomatic groups were distinguished: patients with isolated sensorineural symptoms; with isolated vasospastic problems; and with both. Clinical carpal tunnel syndrome occurred in 14 patients and abnormal cold intolerance (without blanching of the fingers) in 23. In the group as a whole, nerve conduction studies were abnormal in the median nerve but not in the ulnar nerve and vibration perception and temperature thresholds were impaired. Of the three symptomatic groups, patients with isolated sensorineural symptoms differed from controls. No differences were seen between patients with and without clinical carpal tunnel syndrome. With severe sensorineural symptoms the vibration perception thresholds, but not the values of the nerve conduction studies, were further impaired. The results indicated two injuries that are easily confused: one at receptor level in the fingertips and one in the carpal tunnel. Careful clinical assessment, neurophysiological testing, and examination of vibrotactile sense are required before carpal tunnel release should be considered in these patients.

  11. Decreased antibody formation in mice exposed to lead

    Energy Technology Data Exchange (ETDEWEB)

    Koller, L D; Kovacic, S


    Swiss Webster mice were given 1375, 137.5, or 13.75 ppM lead acetate in deionized water for 56 days. The control group was given deionized water orally. There were 120 mice in each group. The diet fed to all the mice was contaminated with 1.12 ppM lead. After 56 days, all mice were inoculated intraperitoneally with 0.2 ml of a 2% suspension of sheep red blood cells. Ten mice in each group were killed on days 3 to 7 to measure primary immune response (19S or IgM antibody) and on days 9 to 14 for the secondary response (7S or IgG antibody) after a second inoculation of sheep red blood cells while they remained on 137.5 ppM lead. The number of plaque forming cells was measured in the spleen. Erythrocytes were observed for basophilic stippling, packed cell volume was measured, serum was collected for hemolysin titration, and kidneys were examined for lead. Chronic exposure to lead produced a significant decrease in antibody synthesis, particularly IgG, indicating that the memory cell was involved. The results also indicated that the reduced antibody synthesis was responsible for the increased mortality from bacterial and viral diseases in animals that were chronically exposed to lead. Other environmental contaminants such as polychlorinated biphenyls, cadmium, mercury, DDT, and sulfur dioxide have also resulted in reduction of circulating antibodies in animals, in other experiments.

  12. Neurovegetative disturbances in workers exposed to 50 Hz electromagnetic fields

    International Nuclear Information System (INIS)

    Bortkiewicz, A.; Gadzicka, E.; Zmyslony, M.; Szymczak, W.


    Since the circulatory and nervous systems are composed of of electrically excitable tissues, it is plausible that they can be stimulated by electromagnetic fields (EMF). No clinical studies have as been carried out to explain whether and how occupational exposure to 50 Hz EMF can influence the neurovegetative regulation of the cardiovascular function. The present project was undertaken to assess the the autonomic function in workers occupationally exposed to 50 Hz EMF, by analyzing the heart rate variability. The study group comprised 63 workers of switchyard substations, aged 22-67 years (39.2±10.0 years), and the control group 42 workers of radio link stations, aged 20-68 years (40.7±9.2 years), employed at workposts free from EMF exposure. The age range and employment duration in both groups did not differ significantly. To assess the neurovegetative regulation of the cardiac function, heart rate variability HRV) analysis was made based on 512 normal heart beats recorded at rest. The analysis, performed using fast Fourier transformation, concerned the time - and frequency-domain HRV parameters. Power spectrum in the very low (VLF), low (LF) and high (HF) frequency bands was determined. The relative risk of decreased HRV (STD R-R ) was significantly higher in the study group than in control (65% vs. 47%). It was concluded that occupational exposure to 50 Hz EMF could influence the neurovegetative regulation of the cardiovascular system. (author)

  13. Long-term study on workers occupationally exposed to ethylbenzene. (United States)

    Bardodĕj, Z; Círek, A


    Ethylbenzene is synthesized from benzene; subject to catalytic dehydrogenation it yields styrene, a raw material for the production of synthetic rubber and plastics. Long-term biomonitoring of occupational ethylbenzene exposures, carried out in the past 20 years in some 200 ethylbenzene-production workers, revealed this substance to pose little hazard to human health. As it turned out, mandelic acid concentrations in these workers' urine never exceeded 3.25 mmol.l-1 and none of the exposed showed damage to hematopoiesis and/or liver tissue. Over the last 10 years no case of malignancy has been recorded in this industrial facility belonging to a larger chemical complex where the overall incidence of cancer is about 3 times the national average. Today's low-level ethylbenzene exposures would make it fully justifiable if the present-day MAC limits, both whole-shift (200 mg.m-3) and peak (1,000 mg.m-3), were to be halved, i.e. to be lowered to 100 mg.m3 and 500 mg.m3 respectively. These newly recommended limit values are no more exceeded nowadays.

  14. Possible weathering of the brick matrix when exposed to water

    DEFF Research Database (Denmark)

    Rörig-Dalgaard, Inge


    The main reasons for deterioration of bricks are frost, crystallization pressure and chemical exposure. Despite of this the effect of chemical exposure is limited clarified. Depending on the brick type the original pH of bricks are 9-10. Though bricks can to subjected to water in shape of acid rain...... with different well-defined pH values are examined to investigate the long term effect of acid rain or other reasons causing pH changes to bricks (as e.g. electrokinetic treatment). Through capillary suction, macro pictures from the exposed surfaces, measurement of the pH and electrical conductivity it seemed...... that there is a consistence with the literature of the glassy phase describing ion exchange at low pH and break down of the lattice in the glassy structure at high pH. At present remains examination of polished sections with SEM/EDX, measurements of each of the ionic contents in the brick matrix and new series with a longer...

  15. Bio-dosimetry for radiation-exposed individuals

    International Nuclear Information System (INIS)

    Sauvaigo, Sylvie; Chapuis, Violaine; Caillat, Sylvain; Sarrazy, Fanny; Breton, Jean


    Exposure of civil populations to genotoxic chemicals or radioactive hazard is an increased concern. It is not only an industrial risk (chemistry plant accident for example) but also a national security problem due to the threat of radiological and nuclear terrorism. It is important to anticipate the need of a bio-dosimetry tool aimed at identifying exposed population in the absence of acute syndrome, in order to assure the medical care that would prevent carcinogenic consequences. DNA repair is a bio-marker of exposure to geno-toxics in individuals. A DNA repair signature can be assessed from Peripheral Blood Mononuclear Cells (PBMCs) that reflects the exposure history of the individuals, using a functional enzymatic assay on bio-chip. A proof of concept was obtained using PBMCs from patients undergoing radiotherapy regimen. We identified two classes of responses among patients, if we except a very atypical signature in one patient that could reflect defects in DNA repair. Interestingly, repair of the major oxidative lesions increased during the course of the radiotherapy. We propose to implement this fast, quantitative, possibly automatized assay to identify bio-markers of exposure to geno-toxics and to validate the exposure bio-markers through ex vivo exposure of blood from volunteers. (authors)

  16. The efficiency of photovoltaic cells exposed to pulsed laser light (United States)

    Lowe, R. A.; Landis, G. A.; Jenkins, P.


    Future space missions may use laser power beaming systems with a free electron laser (FEL) to transmit light to a photovoltaic array receiver. To investigate the efficiency of solar cells with pulsed laser light, several types of GaAs, Si, CuInSe2, and GaSb cells were tested with the simulated pulse format of the induction and radio frequency (RF) FEL. The induction pulse format was simulated with an 800-watt average power copper vapor laser and the RF format with a frequency-doubled mode-locked Nd:YAG laser. Averaged current vs bias voltage measurements for each cell were taken at various optical power levels and the efficiency measured at the maximum power point. Experimental results show that the conversion efficiency for the cells tested is highly dependent on cell minority carrier lifetime, the width and frequency of the pulses, load impedance, and the average incident power. Three main effects were found to decrease the efficiency of solar cells exposed to simulated FEL illumination: cell series resistance, LC 'ringing', and output inductance. Improvements in efficiency were achieved by modifying the frequency response of the cell to match the spectral energy content of the laser pulse with external passive components.

  17. Effects of Ionizing Radiation in Atopic Patients Exposed to Radiation

    International Nuclear Information System (INIS)

    Radwan, N.K.A.


    Atopic dermatitis is a chronic relapsing inflammatory skin disease that arises most commonly during early infancy, and is characterized by severe pruritus, age-dependant skin manifestations, and a fluctuating clinical course. Hereditary, environmental and immunological factors are involved in the aetiopathogenesis of AD. Also the differentiation of helper T- cells, local cytokine profile, IgE, infectious agents and superantigens are factors identified as being involved in the pathogenesis of AD. One hundred patients with AD were selected from the outpatient clinic of the National Center for Radiation Research and Technology in Cairo, Egypt. They were divided into 2 groups; group 1 included radiation workers in the Hall of gamma irradiation unit and group 2 included workers outside controlled area and not exposed to radiation with comparable age and sex. The severity of the disease was evaluated according to the grade of atopic dermatitis. Total and specific serum IgE was measured and Complete Blood Count was also carried out. Four Malassezia species were isolated from AD patients M. globosa, M. furfur, M. sympodialis and M. obtusa. The clinical isolates consisted of two bacterial strains, S. aureus and S. epidermidis. The significant increase of AD severity seems to be more closely related to the prevalence of S. aureus and Malassezia on the skin of radiation workers. This was proved by the presence of high IgE and eosinophils in radiation workers. So, the interactions of low gamma radiation and skin seems to further complicate the risk of assessments of atopic dermatitis

  18. Atmospheric deposition exposes Qinling pandas to toxic pollutants. (United States)

    Chen, Yi-Ping; Zheng, Ying-Juan; Liu, Qiang; Song, Yi; An, Zhi-Sheng; Ma, Qing-Yi; Ellison, Aaron M


    The giant panda (Ailuropoda melanoleuca) is one of the most endangered animals in the world, and it is recognized worldwide as a symbol for conservation. A previous study showed that wild and captive pandas, especially those of the Qinling subspecies, were exposed to toxicants in their diet of bamboo; the ultimate origin of these toxicants is unknown. Here we show that atmospheric deposition is the most likely origin of heavy metals and persistent organic pollutants (POPs) in the diets of captive and wild Qinling pandas. Average atmospheric deposition was 199, 115, and 49 g·m -2 ·yr -1 in the center of Xi'an City, at China's Shaanxi Wild Animal Research Center (SWARC), and at Foping National Nature Reserve (FNNR), respectively. Atmospheric deposition of heavy metals (As, Cd, Cr, Pb, Hg, Co, Cu, Zn, Mn, and Ni) and POPs was highest at Xi'an City, intermediate at SWARC, and lowest at FNNR. Soil concentrations of the aforementioned heavy metals other than As and Zn also were significantly higher at SWARC than at FNNR. Efforts to conserve Qinling pandas may be compromised by air pollution attendant to China's economic development. Improvement of air quality and reductions of toxic emissions are urgently required to protect China's iconic species. © 2017 by the Ecological Society of America.

  19. Yangjing Capsule Ameliorates Spermatogenesis in Male Mice Exposed to Cyclophosphamide

    Directory of Open Access Journals (Sweden)

    Hongle Zhao


    Full Text Available Yangjing capsule (YC, a traditional Chinese compound herbal preparation, has been proven as an effective drug to improve spermatogenesis in clinical practice. However, its pharmacological mechanisms were not fully clarified. This study was designed to investigate the protective effects of YC on spermatogenesis in the mouse model of spermatogenesis dysfunction induced by cyclophosphamide (CP. The administration of YC significantly increased the epididymal index, sperm count, and sperm motility of model mice. Histopathological changes demonstrated that CP caused obvious structural damage to testis, which were reversed by the administration of YC. Results from TUNEL assay showed that treatment with YC dramatically decreased the apoptosis of spermatogenic cell induced by CP. Moreover, YC treatment could inhibit the mRNA and protein expression of Bax to Bcl-2 and also raised expression of AR at both mRNA and protein levels. These data suggest that YC might ameliorate spermatogenesis in male mice exposed to CP through inhibiting the apoptosis of spermatogenic cell and enhancing the actions of testosterone in spermatogenesis.

  20. Brain dysfunctions in Wistar rats exposed to municipal landfill leachates

    Directory of Open Access Journals (Sweden)

    Chibuisi G. Alimba


    Full Text Available Brain damage induced by Olusosun and Aba-Eku municipal landfill leachates was investigated in Wistar rats. Male rats were orally exposed to 1–25% concentrations of the leachates for 30 days. Catalase (CAT and superoxide dismutase (SOD activities, and malondialdehyde (MDA concentrations in the brain and serum of rats were evaluated; body and brain weight gain and histopathology were examined. There was significant (p < 0.05 decrease in body weight gain and SOD activity but increase in absolute and relative brain weight gain, MDA concentration and CAT activity in both brain and serum of treated rats. The biochemical parameters, which were more altered in the brain than serum, corroborated the neurologic lesions; neurodegeneration of purkinje cells with loss of dendrites, perineural vacuolations of the neuronal cytoplasm (spongiosis and neuronal necrosis in the brain. The concentrations of Cr, Cu, Pb, As, Cd, Mn, Ni, sulphates, ammonia, chloride and phosphate in the leachate samples were above standard permissible limits. The interactions of the neurotoxic constituents of the leachates induced the observed brain damage in the rats via oxidative damage. This suggests health risk in wildlife and human populations.

  1. OPC Paste Samples Exposed To Aggressive Solutions. Cementitious Barriers Partnership

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    The study presented in this report focused on a low-activity wasteform containing a high-pH pore solution with a significant level of sulfate. The purpose of the study was to improve understanding of the complex concrete/wasteform reactive transport problem, in particular, the role of pH in sulfate attack. Paste samples prepared at three different water-to-cement ratios were tested. The mixtures were prepared with ASTM Type I cement, without additional admixtures. The samples were exposed to two different sodium sulfate contact solutions. The first solution was prepared at 0.15M Na2SO4. The second solution also incorporated 0.5M NaOH, to mimic the high pH conditions found in Saltstone. The data collected indicated that, in Na2SO4 solution, damage occurs to the pastes. In the case of the high-pH sulfate solution (Na2SO4 + NaOH), no signs of damage were observed on any of the paste mixtures. These results indicate that the high sulfate content found in the wasteform pore solution will not necessarily lead to severe damage to concrete. Good-quality mixtures could thus prove durable over the long term, and act as an effective barrier to prevent radionuclides from reaching the environment.

  2. Psychosocial consequences of the Chernobyl disaster (A survey of Chernobyl accidental exposed and a non-exposed population sample)

    International Nuclear Information System (INIS)

    Havenaar, J.M.; Savelkoul, T.J.F.; Bout, J. van-den; Bootsma, P.A.


    The importance of psychological factors in the aftermath of industrial disasters is being recognized increasingly. Two field studies (total N=3084) were conducted in two regions of the former Soviet Union, to investigate the long-term psychosocial consequences of the Chernobyl nuclear power plant disaster in 1986. A sub sample of the respondents (N=449) was studied using a standardized physical and psychiatric examination. The first study took place in the Gomel region (Belarus) in the direct vicinity of the damaged nuclear plant. A control study was conducted in the Tver region (the Russian Federation), about 250 km north-west of Moscow. The results of the study indicate significantly higher levels of psychological distress, poorer subjective health and higher medical consumption in the exposed population. These findings were most prominent in risk groups such as evacuated people and mothers with children. No significant differences in overall levels of psychiatric or physical morbidity were found. Radiation related diseases could not account for the poor health perception in the investigated sample. These results indicate that psychological factors following the Chernobyl disaster had a marked effect upon psychological well being, on perceived health and on subsequent illness behavior. Fears about future health play a key role in determining this response. The provision of adequate information to the public as well as to the public health services may be important to counteract these fears

  3. Exposing SAMOS Data and Vocabularies within the Semantic Web (United States)

    Dockery, Nkemdirim; Elya, Jocelyn; Smith, Shawn


    As part of the Ocean Data Interoperability Platform (ODIP), we at the Center for Ocean-Atmospheric Prediction Studies (COAPS) will present the development process for the exposure of quality-controlled data and core vocabularies managed by the Shipboard Automated Meteorological Oceanographic System (SAMOS) initiative using Semantic Web technologies. Participants in the SAMOS initiative collect continuous navigational (position, course, heading, speed), meteorological (winds, pressure, temperature, humidity, radiation), and near-surface oceanographic (sea temperature, salinity) parameters while at sea. One-minute interval observations are packaged and transmitted back to COAPS via daily emails, where they undergo standardized formatting and quality control. The authors will present methods used to expose these daily datasets. The Semantic Web, a vision of the World Wide Web Consortium, focuses on extending the principles of the web from connecting documents to connecting data. The creation of a web of Linked Data that can be used across different applications in a machine-readable way is the ultimate goal. The Resource Description Framework (RDF) is the standard language and format used in the Semantic Web. RDF pages may be queried using the SPARQL Protocol and RDF Query Language (SPARQL). The authors will showcase the development of RDF resources that map SAMOS vocabularies to internationally served vocabularies such as those found in the Natural Environment Research Council (NERC) Vocabulary Server. Each individual SAMOS vocabulary term (data parameter and quality control flag) will be described in an RDF resource page. These RDF resources will define each SAMOS vocabulary term and provide a link to the mapped vocabulary term (or multiple terms) served externally. Along with enhanced retrieval by parameter, time, and location, we will be able to add additional parameters with the confidence that they follow an international standard. The production of RDF

  4. Psychosomatic health status of children exposed to the Chernobyl accident

    International Nuclear Information System (INIS)

    Korol, N.; Shibata, Yoshisada; Nakane, Yoshibumi


    Childhood victims were investigated focussing on the psychosomatic disorders. The subjects were some of the 3834 children who evacuated from the Chernobyl zone to Kiev (evacuees) and 200 children who have been living in Kiev since prior to the accident (comparison group). A psychological test administered to 504 evacuees aged 12-14 years at the time of the accident and the comparison group indicated that the frequencies of neutroticism, high level of anxiety and conflicts were significantly higher in the evacuees than in the comparison group (p<0.001). Another psychological test administered at puberty to the 504 evacuees and 200 other evacuees exposed to the accident at 4-6 years of age indicated that the psycho-emotional portrait of evacuated teenagers significantly changed with time since the accident. The effects of the Chernobyl accident on the health of the vegetative dystonia observed in 1987-1990 and 1990-1995 were higher in the evacuees than in the comparison group, although they were not statistically significant. Furthermore, a significant (p<0.001) association of the vegetative dystonia with peptic and cardiovascular disorders was observed. The present study indicates that the vegetative dystonia is still highly prevalent among childhood victims and deems to support that the vegetative dystonia may be a precursor of several diseases such as cardiovascular and peptic disorders. It should be emphasized that a health promotion program to produce a change in psychological and social problems after the Chernobyl accident is necessary to decrease the health impact among Ukrainian people. (author)

  5. Respiratory damage in children exposed to urban pollution. (United States)

    Calderón-Garcidueñas, Lilian; Mora-Tiscareño, Antonieta; Fordham, Lynn A; Valencia-Salazar, Gildardo; Chung, Charles J; Rodriguez-Alcaraz, Antonio; Paredes, Rogelio; Variakojis, Daina; Villarreal-Calderón, Anna; Flores-Camacho, Lourdes; Antunez-Solis, Angelina; Henríquez-Roldán, Carlos; Hazucha, Milan J


    Southwest Metropolitan Mexico City (SWMMC) children are chronically exposed to complex mixtures of air pollutants. In a cross-sectional arm of our study, we investigated the association between exposure to SWMMC atmosphere and nasal abnormalities, hyperinflation, and interstitial markings assessed by chest X-rays, lung function changes, several serum cytokines, and endothelin-1 in 174 children aged 5-17 years vs. 27 control children residents in low-polluted areas. Control children had no nasal lesions, and only one child showed an abnormal chest X-ray. SWMMC children exhibited nasal abnormalities (22%), hyperinflation (67%), interstitial markings (49%), and a mild restrictive pattern by spirometry (10%). Interstitial markings were associated with a decrease in predicted values of FEF(25-75), FEF(75), and the FEV(1)/FVC ratio. Boys had a higher probability of developing interstitial markings with age (P = 0.004). Blood smear findings included toxic granulations in neutrophils and schistocytes. SWMMC children had more serum IL10 and IL6 and less IL8 than controls. In a longitudinal arm of our study, we found a significant seasonal drop in FVC and FEV(1) associated with a 6-month period of high ozone and PM(10) levels. Our data strongly suggest that a lifelong exposure to urban air pollution causes respiratory damage in children. Moreover, a cytokine network becomes imbalanced, with a shift towards upregulation of anti-inflammatory cytokines. Consequently, these children are potentially at risk for developing chronic lung disease and other systemic effects later in life. Copyright 2003 Wiley-Liss, Inc.

  6. Ethnic minority health in Vietnam: a review exposing horizontal inequity

    Directory of Open Access Journals (Sweden)

    Mats Målqvist


    Full Text Available Background: Equity in health is a pressing concern and reaching disadvantaged populations is necessary to close the inequity gap. To date, the discourse has predominately focussed on reaching the poor. At the same time and in addition to wealth, other structural determinants that influence health outcomes exist, one of which is ethnicity. Inequities based on group belongings are recognised as ‘horizontal’, as opposed to the more commonly used notion of ‘vertical’ inequity based on individual characteristics. Objective: The aim of the present review is to highlight ethnicity as a source of horizontal inequity in health and to expose mechanisms that cause and maintain this inequity in Vietnam. Design: Through a systematic search of available academic and grey literature, 49 publications were selected for review. Information was extracted on: a quantitative measures of health inequities based on ethnicity and b qualitative descriptions explaining potential reasons for ethnicity-based health inequities. Results: Five main areas were identified: health-care-seeking and utilization, maternal and child health, nutrition, infectious diseases, and oral health and hygiene. Evidence suggests the presence of severe health inequity in health along ethnic lines in all these areas. Research evidence also offers explanations derived from both external and internal group dynamics to this inequity. It is reported that government policies and programs appear to be lacking in culturally adaptation and sensitivity, and examples of bad attitudes and discrimination from health staff toward minority persons were identified. In addition, traditions and patriarchal structures within ethnic minority groups were seen to contribute to the maintenance of harmful health behaviors within these groups. Conclusion: Better understandings of the scope and pathways of horizontal inequities are required to address ethnic inequities in health. Awareness of ethnicity as a

  7. Polyamines and polyamine biosynthesis in cells exposed to hyperthermia

    Energy Technology Data Exchange (ETDEWEB)

    Gerner, E.W.; Stickney, D.G.; Herman, T.S.; Fuller, D.J.


    The issue of how polyamines act to sensitize cultured cells to the lethal effects of hyperthermia was investigated using Chinese hamster cells which were induced to express thermotolerance. Intracellular levels of these naturally occurring polycations were manipulated in certain situations by treating whole cells with methylglyoxal bis-(guanylhydrazone), an inhibitor of the S-adenosyl-L-methionine decarboxylases. Exogenous spermine as low as 100 in the culture media dramatically sensitized cells expressing thermotolerance to the lethal effects of subsequent 42/sup 0/C exposures. When thermotolerance was differentially induced in cultures exposed to 42.4/sup 0/C by varying the rate of heating from 37 to 42.4/sup 0/C, the most resistant cells and the highest levels of intracellular spermidine and spermine. This finding was explainable in part by the observation that the putrescine-dependent S-adenosyl-L-methionine decarboxylase activity was minimally affected in cells expressng the greatest degree of thermotolerance. When this enzyme activity was inhibited by drug, lowered intracellular polyamine levels did not correspond with subsequent survival responses to heat. Interestingly, cultures treated with methylglyoxal bis-(guanylhydrazone) 24 hr previous to heat exposure showed a reduced capacity to express rate of heating-induced thermotolerance. Together, these results demonstrate that the polyamines, especially spermidine and spermine, enhance hyperthermia-induced cell killing by some mechanism involving the plasma membrane. Further, our data suggest that methylglyoxal bis-(guanylhydrazone) can act to affect thermal responses by a mechanism(s) other than modification of intracellular polyamine levels.

  8. Characterization of serrated yielding in service exposed Inconel 625 alloy

    International Nuclear Information System (INIS)

    Chatterjee, Arnomitra; Sharma, Garima; Chakravartty, J.K.


    The Alloy-625 is an austentic alloy which is being used for a variety of components in the aerospace, marine, chemical and nuclear industries. Tensile tests have been carried out on service exposed Inconel 625 ammonia cracker tube used at heavy water production plant to study the effect of microstructure on the mechanical properties of the material. Owing to temperature gradient during in service condition the microstructure was different in top (T), middle (M) and bottom (B) sections of the tube. The stress-strain curve obtained from conventional tensile test was found to exhibit serrated yielding with in an intermediate temperature regime of 250-600 °C. Both normal and inverse Portevin-Le Chatelier (PLC) effect could be identified at lower and higher temperature regime respectively. The normal behavior was associated with type (A+B) serrations and interstitial atom C was held responsible for the aging of dislocations in this region. On the contrary, the serrations were of type C in nature in inverse PLC regime and were attributed to the locking of dislocations by substitutional Mo atoms. Further analyses of activation energy and transition temperature for normal to inverse PLC dynamics, supported with Transmission Electron Microscopy (TEM) observation revealed that the basic deformation mechanism was different in M and B samples than that in the T samples. While the deformation in T samples were achieved by usual dislocation migration, in M and B samples it was through the propagation of stacking faults in large γ” precipitates. The transition temperature from normal to inverse PLC dynamics also varied appreciably in T samples than that of the M and B ones which could be explained in terms of the delayed depletion of Mo solutes in solution for T samples. (author)

  9. Increased oxidative stress in preschool children exposed to passive smoking. (United States)

    Yıldırım, Faruk; Sermetow, Kabil; Aycicek, Ali; Kocyigit, Abdurrahim; Erel, Ozcan


    To study the effect of passive cigarette smoking on plasma oxidative and antioxidative status in passive smoking preschool children and to compare them with controls. Thirty-four passive smoking (five to 50 cigarettes per day) preschool children (study group) and 32 controls who had never been exposed to cigarette smoke were randomly chosen from children aged from 4 to 6 years. Urinary cotinine and plasma indicators of oxidative and antioxidative status, i.e., total oxidant status (TOS), total antioxidant capacity (TAC), and oxidative stress index (OSI), were determined. Mean environmental cigarette consumption was 22±13 cigarettes per day in passive smoking children. Mean urinary cotinine levels were 77.6±41.4 ng/mL and 11.9±2.3 ng/mL in the study and control groups, respectively (p < 0.001). Mean plasma TAC levels were 0.95±0.13 mmol Trolox equivalent/L and 1.01±0.09 mmol Trolox equivalent/L, respectively (p = 0.039). Mean plasma TOS levels were 28.6±7.9 µmol H2O2 equivalent/L and 18.5±6.3 µmol H2O2 equivalent/L, respectively (p < 0.001). Mean OSI levels were 3.08±0.98 arbitrary units and 1.84±0.64 arbitrary units, respectively (p < 0.001). A small amount of cigarette smoke (five to 10 cigarettes per day) causes considerable oxidative stress. There were significant correlations between number of cigarettes consumed and oxidant status and OSI levels. Passive smoke is a potent oxidant in preschool children. Its deleterious effects are not limited just to heavy passive smoking, but also occur with exposure to small amounts of smoke.

  10. Reactions of macrophages exposed to particles <10 μm

    International Nuclear Information System (INIS)

    Monn, Christian; Naef, Roland; Koller, Theo


    This study describes experiments on cytotoxic effects and the production of oxidative radicals and the proinflammatory cytokine tumor growth factor alpha (TNFα) in a cell line of rat lung macrophages exposed to aqueou extracts from ambient air particles 10 ) collected on Teflon filters. The particles were collected during the four seasons at two urban sites, one rural site, and one alpine site in Switzerland. Cytotoxic effects determined as a reduction in the metabolic activity, were found in particle extracts from all sites and seasons. Taking together the data from all site and seasons, a dose-response function was observed between the particle mass on the filter and toxicity (r 2 =0.633, linear regression). The release of the pro-inflammatory cytokine TNFα as well as of oxidative radicals was most pronounced in particles collected in spring-summer and autumn. While a Montana (alpine), the stimulation of the cells was positively correlated with the particle mass on the filters, this correlation was negative at the urban sites Zuerich and Lugano. It is interpreted that at high PM 10 levels, as in these cities, macrophages are inhibited by increasing air pollution due to toxic effects. Cytotoxic effects and the release of oxidative radicals could be inhibited when the extracts were treated with an endotoxin-neutralizing protein. This suggests that endotoxin, a cell-wall constituent of gram-negative bacteria, is one of the factors which modulates macrophag activity. All together, the experiments indicate that in the PM 10 fraction water-soluble macrophage-toxic and macrophage-stimulating compounds ar present. The data offer an explanation for at least some of the known harmful effects of PM 10 , and confirm endotoxin as a possible reactant

  11. Simulation of processes in a SSNTD exposed by monoenergetic neutrons (United States)

    Meyer, P.; Fromm, M.; Groetz, J. E.; Torrealba, F.; Chambaudet, A.


    The nuclear track technique is based on the registering of latent track ions in a solid state dielectric material (Solid State Nuclear Track Detector) which will be chemically etched in order to be observed and analysed using microscopic analysis tools. The purpose of this study is to observe how a polymeric detector irradiated by a neutron fluence can explain the intensity of ionizing radiations to which structures, electronic components or living organism are exposed. To do this, it is necessary to take into account on the one hand the production of ionizing particles in the detector, and on the other hand the efficacy of their detection. The model we propose must be able to link the number of etched tracks and their parameters to the neutron fluence. The use of both a Monte Carlo code which determines the number of recoil nuclei and a computed model of etched track parameters calculations is needed. The Monte Carlo code performs a simulation of neutron-nucleus elastic collision in the detector. We compute the number of recoil nuclei produced between the surface and a depth of 20 μm in the detector. The computer code assigns six pseudo-random numbers ( xE, zE, a, b, c, α) to each neutron having an energy EN and an angle of incidence and give the results of calculations. We used statistical tests (the moments of the origin of order n and of the average of order n, the χ2 test, the gap test, the Pearson test, the run-up run-down test and the serial test) to check the quality of our pseudo-random number generator. Finally, we will compare the calculated results of the response of the SSNTD (tracks cm -2) with the experimental ones to validate the simulation.

  12. Internal dosimetry for occupationally exposed personnel in nuclear medicine

    International Nuclear Information System (INIS)

    Garcia, M.T.; Alfaro, L.M.M.; Angeles, C.A.


    Internal dosimetry plays an important role in nuclear medicine dosimetry control of personnel occupationally exposed, and that in recent years there has been a large increase in the use of radionuclides both in medical diagnosis as radiotherapy. But currently, in Mexico and in many parts of the world, this internal dosimetry control is not performed. The Instituto Nacional de lnvestigaciones Nucleares de Mexico (ININ) together with the Centro Oncologico de Toluca (ISEMMYM) have developed a simple and feasible methodology for monitoring of personnel working in these facilities. It was aimed to carry out the dosimetry of the personnel, due to the incorporation of I-131, using the spectrometric devices that the hospital has, a gamma camera. The first step in this methodology was to make a thyroid phantom to meet the specifications of the ninth ANSI. This phantom is compared under controlled conditions with RMC- II phantom used for system calibration of the ININ internal dosimetry (ACCUSCAN - Ll), and with another phantom developed in Brazil with ANSI specifications, in order to determine the variations in measurements due to the density of the material of each of the phantoms and adjust to the system ACCUSCAN, already certificate. Furthermore, necessary counts were performed with the gamma camera of the phantom developed at ININ, with a standard source of 133 Ba which simulates the energy of 131 I. With these data, were determined the counting efficiencies for a distance of 15 to 20 cm between the surface of the phantom and the the plate of the detectors. Another important aspect was to determine the lower limit of detection (LLD). In this paper we present the results obtained from the detectors calibration of the gamma camera of the hospital.

  13. Ethnic minority health in Vietnam: a review exposing horizontal inequity (United States)

    Målqvist, Mats; Hoa, Dinh Thi Phuong; Liem, Nguyen Thanh; Thorson, Anna; Thomsen, Sarah


    Background Equity in health is a pressing concern and reaching disadvantaged populations is necessary to close the inequity gap. To date, the discourse has predominately focussed on reaching the poor. At the same time and in addition to wealth, other structural determinants that influence health outcomes exist, one of which is ethnicity. Inequities based on group belongings are recognised as ‘horizontal’, as opposed to the more commonly used notion of ‘vertical’ inequity based on individual characteristics. Objective The aim of the present review is to highlight ethnicity as a source of horizontal inequity in health and to expose mechanisms that cause and maintain this inequity in Vietnam. Design Through a systematic search of available academic and grey literature, 49 publications were selected for review. Information was extracted on: a) quantitative measures of health inequities based on ethnicity and b) qualitative descriptions explaining potential reasons for ethnicity-based health inequities. Results Five main areas were identified: health-care-seeking and utilization, maternal and child health, nutrition, infectious diseases, and oral health and hygiene. Evidence suggests the presence of severe health inequity in health along ethnic lines in all these areas. Research evidence also offers explanations derived from both external and internal group dynamics to this inequity. It is reported that government policies and programs appear to be lacking in culturally adaptation and sensitivity, and examples of bad attitudes and discrimination from health staff toward minority persons were identified. In addition, traditions and patriarchal structures within ethnic minority groups were seen to contribute to the maintenance of harmful health behaviors within these groups. Conclusion Better understandings of the scope and pathways of horizontal inequities are required to address ethnic inequities in health. Awareness of ethnicity as a determinant of health, not

  14. Psychosomatic health status of children exposed to the Chernobyl accident

    Energy Technology Data Exchange (ETDEWEB)

    Korol, N. [Scientific Center for Radiation Medicine, Kiev (Ukraine); Shibata, Yoshisada; Nakane, Yoshibumi


    Childhood victims were investigated focussing on the psychosomatic disorders. The subjects were some of the 3834 children who evacuated from the Chernobyl zone to Kiev (evacuees) and 200 children who have been living in Kiev since prior to the accident (comparison group). A psychological test administered to 504 evacuees aged 12-14 years at the time of the accident and the comparison group indicated that the frequencies of neutroticism, high level of anxiety and conflicts were significantly higher in the evacuees than in the comparison group (p<0.001). Another psychological test administered at puberty to the 504 evacuees and 200 other evacuees exposed to the accident at 4-6 years of age indicated that the psycho-emotional portrait of evacuated teenagers significantly changed with time since the accident. The effects of the Chernobyl accident on the health of the vegetative dystonia observed in 1987-1990 and 1990-1995 were higher in the evacuees than in the comparison group, although they were not statistically significant. Furthermore, a significant (p<0.001) association of the vegetative dystonia with peptic and cardiovascular disorders was observed. The present study indicates that the vegetative dystonia is still highly prevalent among childhood victims and deems to support that the vegetative dystonia may be a precursor of several diseases such as cardiovascular and peptic disorders. It should be emphasized that a health promotion program to produce a change in psychological and social problems after the Chernobyl accident is necessary to decrease the health impact among Ukrainian people. (author)

  15. Asymmetric Hearing Loss in Chinese Workers Exposed to Complex Noise. (United States)

    Wang, Xiaoxiao; Li, Nan; Zeng, Lin; Tao, Liyuan; Zhang, Hua; Yang, Qiuling; Qiu, Wei; Zhu, Liangliang; Zhao, Yiming


    Evaluate the audiometric asymmetry in Chinese industrial workers and investigate the effects of noise exposure, sex, and binaural average thresholds on audiometric asymmetry. Data collected from Chinese industrial workers during a cross-sectional study were reanalyzed. Of the 1388 workers, 266 met the inclusion criteria for this study. Each subject underwent a physical examination and an otologic examination and completed a health-related questionnaire. χ and t tests were used to examine the differences between the asymmetric and symmetric hearing loss groups. One hundred thirty-one subjects (49.2%) had a binaural hearing threshold difference of 15 dB or more for at least one frequency, and there was no statistically significant difference between the left and right ears. The asymmetric hearing loss group was not exposed to higher cumulative noise levels (t = 0.522, p = 0.602), and there was no dose-response relation between asymmetry and cumulative noise levels (χ = 6.502, p = 0.165). Men were 1.849 times more likely to have asymmetry than women were (95% confidence interval, 1.051 to 3.253). Among the workers with higher high-frequency hearing thresholds, audiometric asymmetry was 1.024 times more prevalent than that among those with lower high-frequency hearing thresholds (95% confidence interval, 1.004 to 1.044). The results indicated that occupational noise exposure contributed minimally to asymmetry, whereas sex and binaural average thresholds significantly affected audiometric asymmetry. There was no evidence that the left ears were worse than the right ears.

  16. Immunotoxicity Monitoring in a Population Exposed to Polychlorinated Biphenyls

    Directory of Open Access Journals (Sweden)

    Hajo Haase


    Full Text Available The relationship between polychlorinated biphenyl (PCB burden and several indicators of immune function was investigated as part of the HELPcB (Health Effects in High-Level Exposure to PCB program, offering bio-monitoring to workers, relatives, and neighbors exposed to PCBs by a German transformers and capacitors recycling company. The present retrospective observational study evaluates the correlation of plasma levels of total PCBs, five indicator congeners (28, 101, 138, 153, 180, and seven dioxin-like congeners (105, 114, 118, 156, 157, 167, 189 with several parameters of immune function. The cross-sectional study was performed immediately after the end of exposure (258 subjects, and one (218 subjects, and two (177 subjects years later. At the first time point, measurements showed significant positive correlation between congeners with low to medium chlorination and the relative proportion of CD19 positive B-cells among lymphocytes, as well as a negative correlation of PCB114 with serum IgM, and of PCB 28 with suppressor T-cell and NK-cell numbers. Congeners with a high degree of chlorination, in particular PCB157 and 189, were positively associated with expression of the activation marker CD25 on T-cells in the cohort of the second time point. No associations between PCB levels and IFN-y production by T-cells and killing by NK-cells were found. In conclusion, there were several effects on the cellular composition of adaptive immunity, affecting both T- and B-cells. However, the values were not generally outside the reference ranges for healthy adult individuals and did not indicate overt functional immunodeficiency, even in subjects with the uppermost PCB burden.

  17. Adenine nucleotide depletion from endothelial cells exposed to xanthine oxidase

    International Nuclear Information System (INIS)

    Aalto, T.K.; Raivio, K.O.


    Hypoxia causes breakdown of cellular nucleotides, accumulation of hypoxanthine (HX), and conversion of xanthine dehydrogenase into xanthine oxidase (XO). Upon reoxygenation, the HX-XO reaction generates free radicals, one potential mechanism of tissue damage. Because endothelial cells contain XO and are exposed to circulating HX, they are a likely target for damage. We studied the effect of XO and/or HX at physiologically relevant concentrations on nucleotide metabolism of cultured endothelial cells from human umbilical veins. Cells were labeled with [14C]adenine and incubated for up to 6 h with HX, XO, or both, in the absence or presence of serum. Adenine nucleotides from cell extracts and nucleotide breakdown products (HX, xanthine, and urate) from the medium were separated and counted. HX alone had no effect. XO (80 mU/ml) alone caused a 70% (no serum) or 40% (with serum) fall in adenine nucleotides and an equivalent increase of xanthine and urate. The combination of HX and XO caused a 90% (no serum) or 70% (with serum) decrease in nucleotides, decrease in energy charge, and detachment of cells from the culture plate. Nucleotide depletion was not accounted for by proteolytic activity in the XO preparation. Albumin was only half as effective as serum in preventing nucleotide loss. Thus exogenous XO, in the presence of endogenous HX, triggers adenine nucleotide catabolism, but endogenous XO activity is too low to influence nucleotide levels even at high exogenous HX concentrations. Serum limits the catabolic effect of XO and thus protects cells from free radical damage

  18. Limited transcriptional responses of Rickettsia rickettsii exposed to environmental stimuli.

    Directory of Open Access Journals (Sweden)

    Damon W Ellison

    Full Text Available Rickettsiae are strict obligate intracellular pathogens that alternate between arthropod and mammalian hosts in a zoonotic cycle. Typically, pathogenic bacteria that cycle between environmental sources and mammalian hosts adapt to the respective environments by coordinately regulating gene expression such that genes essential for survival and virulence are expressed only upon infection of mammals. Temperature is a common environmental signal for upregulation of virulence gene expression although other factors may also play a role. We examined the transcriptional responses of Rickettsia rickettsii, the agent of Rocky Mountain spotted fever, to a variety of environmental signals expected to be encountered during its life cycle. R. rickettsii exposed to differences in growth temperature (25 degrees C vs. 37 degrees C, iron limitation, and host cell species displayed nominal changes in gene expression under any of these conditions with only 0, 5, or 7 genes, respectively, changing more than 3-fold in expression levels. R. rickettsii is not totally devoid of ability to respond to temperature shifts as cold shock (37 degrees C vs. 4 degrees C induced a change greater than 3-fold in up to 56 genes. Rickettsiae continuously occupy a relatively stable environment which is the cytosol of eukaryotic cells. Because of their obligate intracellular character, rickettsiae are believed to be undergoing reductive evolution to a minimal genome. We propose that their relatively constant environmental niche has led to a minimal requirement for R. rickettsii to respond to environmental changes with a consequent deletion of non-essential transcriptional response regulators. A minimal number of predicted transcriptional regulators in the R. rickettsii genome is consistent with this hypothesis.

  19. Magnetic behavioural change of silane exposed graphene nanoflakes

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Sekhar C., E-mail: [Department of Physics, College of Science, Engineering and Technology, University of South Africa, Private Bag X6, Florida, 1710, Science Campus, Christiaan de Wet and Pioneer Avenue, Florida Park, Johannesburg 1710 (South Africa); Mishra, D. K. [Department of Physics, College of Science, Engineering and Technology, University of South Africa, Private Bag X6, Florida, 1710, Science Campus, Christiaan de Wet and Pioneer Avenue, Florida Park, Johannesburg 1710 (South Africa); Department of Physics, Institute of Technical Research and Education, Siksha ‘O’ Anusandhan University, Khandagiri Square, Bhubaneswar 751030, Odisha (India); Strydom, A. M. [Highly Correlated Matter Research Group, Physics Department, University of Johannesburg, PO Box 524, Auckland Park 2006 (South Africa); Papakonstantinou, P. [Nanotechnology and Integrated Bioengineering Center (NIBEC), School of Engineering, University of Ulster, Jordanstown Campus, Newtownabbey BT37 0QB (United Kingdom)


    The electronic structures and magnetic properties of graphene nanoflakes (GNFs) exposed to an organo-silane precursor [tetra-methyl-silane, Si(CH{sub 3}){sub 4}] were studied using atomic force microscopy, electron field emission (EFE), x-ray photoelectron spectroscopy (XPS), and magnetization. The result of XPS indicates that silyl radical based strong covalent bonds were formed in GNFs, which induced local structural relaxations and enhanced sp{sup 3} hybridization. The EFE measurements show an increase in the turn-on electric field from 9.8 V/μm for pure GNFs to 26.3 V/μm for GNFs:Si having highest Si/(Si + C) ratio ( ≅ 0.35) that also suggests an enhancement of the non-metallic sp{sup 3} bonding in the GNFs matrix. Magnetic studies show that the saturation magnetization (Ms) is decreased from 172.53 × 10{sup −6} emu/g for pure GNFs to 13.00 × 10{sup −6} emu/g for GNFs:Si with the highest Si/(Si + C) ratio 0.35, but on the other side, the coercivity (Hc) increases from 66 to 149 Oe due to conversion of sp{sup 2} → sp{sup 3}-hybridization along with the formation of SiC and Si-O bonding in GNFs. The decrease in saturation magnetization and increase in coercivity (Hc) in GNFs on Si-functionalization are another routes to tailor the magnetic properties of graphene materials for magnetic device applications.

  20. Droplet impaction on solid surfaces exposed to impinging jet fires

    Energy Technology Data Exchange (ETDEWEB)

    Kazemi, Zia


    The thermal response of hot surfaces exposed to impinging jet fire and subsequent impacting water droplets is investigated. The research was done mainly experimentally by utilizing three different concepts. This included experiments on a laboratory scale steel plate and large outdoor fire tests with a quadratic steel channel and steel plates. Besides the horizontal jet flame itself was characterized in a comprehensive study. As a comparative study, the last three types of the experiment were additionally modeled by the CFD-code Kameleon FireEx for validation of results. The purpose of the experiments done on bench scale steel plate (L x W x T : 300 x 200 x 8 mm) was mainly to map data on wetting temperature, water droplet size, droplet impingement angle, and droplet velocity prior to large scale jet fire tests. The droplet release angle normal to hot surface gives best cooling effect, when the surface is oriented in upright position. The partial wetting begins at about 165 degrees C. When the surface is positioned in horizontal plane, the droplet of about 5 mm in diameter wets the hot surface partially at around 240-250 degrees C within an impaction distance of 20 cm. At about 150 degrees C, the droplet is entirely attached to the surface with almost zero contact angle, and cools down the solid at a critical heat flux equivalent to 1750 kW/m{sup 2}. The cooling effectiveness is about 8 % with a Weber number of 68. Although in the event of horizontal channel (L x W x T : 1000 x 200 x 8 mm) water droplets were not applied, however, the knowledge gained with jet fire tests gave valuable information about temperature progress in solids (steels and insulation) and their response to impinging jet fire during long duration experiments. The temperature of the insulated area of the channel keeps 200 degrees C below that of the exposed surface, as long as the insulation material remained intact. Upon long test fire durations, the insulation either burns or degrades despite

  1. Respiratory tract toxicity in rats exposed to Mexico City air. (United States)

    Moss, O R; Gross, E A; James, R A; Janszen, D B; Ross, P W; Roberts, K C; Howard, A M; Harkema, J R; Calderón-Garcidueñas, L; Morgan, K T


    The rat has been used extensively as a health sentinel, indicator, or monitor of environmental health hazards, but this model has not been directly validated against human exposures. Humans in Mexico City show upper respiratory tract lesions and evidence of pulmonary damage related to their environmental inhalation exposure. In this study, male and female F344 rats were exposed (23 hr/day) in Mexico City to local Mexico City air (MCA)* for up to seven weeks. Controls were maintained at the same location under filtered air. Prior to these exposures, several steps were taken. First, the nasal passages of normal male rats shipped from the United States and housed in Mexico City were examined for mycoplasma infection; no evidence of infection was found. In addition, a mobile exposure and monitoring system was assembled and, with an ozone (O3) exposure atmosphere, was tested along with supporting histopathology techniques and analysis of rat nasal and lung tissues. Last, the entire exposure model (equipment and animals) was transported to Mexico City and validated for a three-week period. During the seven-week study there were 18 one-hour intervals during which the average O3 concentration of MCA in the exposure chamber exceeded the US National Ambient Air Quality Standard (NAAQS) of 0.120 ppm 03 (hourly average, not to be exceeded more than once per year). This prolonged exposure of healthy F344 rats to MCA containing episodically low to moderate concentrations of 03 (as well as other urban air pollutants) did not induce inflammatory or epithelial lesions in the nasal airways or lung as measured by qualitative histologic techniques or quantitative morphometric techniques. These findings agree with those of previous controlled O3 inhalation studies, but they are in contrast to reports indicating that O3-polluted MCA causes significant nasal mucosal injury in adults and children living in southwestern Mexico City. Taken together, these findings may suggest that human

  2. Hippocampal phosphoproteomics of F344 rats exposed to 1-bromopropane

    International Nuclear Information System (INIS)

    Huang, Zhenlie; Ichihara, Sahoko; Oikawa, Shinji; Chang, Jie; Zhang, Lingyi; Hu, Shijie; Huang, Hanlin; Ichihara, Gaku


    1-Bromopropane (1-BP) is neurotoxic in both experimental animals and human. To identify phosphorylated modification on the unrecognized post-translational modifications of proteins and investigate their role in 1-BP-induced neurotoxicity, changes in hippocampal phosphoprotein expression levels were analyzed quantitatively in male F344 rats exposed to 1-BP inhalation at 0, 400, or 1000 ppm for 8 h/day for 1 or 4 weeks. Hippocampal protein extracts were analyzed qualitatively and quantitatively by Pro-Q Diamond gel staining and SYPRO Ruby staining coupled with two-dimensional difference in gel electrophoresis (2D-DIGE), respectively, as well as by matrix-assisted laser-desorption ionization time-of-flight (MALDI-TOF) mass spectrometry (MS) to identify phosphoproteins. Changes in selected proteins were further confirmed by Manganese II (Mn 2+ )-Phos-tag SDS-polyacrylamide gel electrophoresis (SDS-PAGE). Bax and cytochrome c protein levels were determined by western blotting. Pro-Q Diamond gel staining combined with 2D-DIGE identified 26 phosphoprotein spots (p < 0.05), and MALDI-TOF/MS identified 18 up-regulated proteins and 8 down-regulated proteins. These proteins are involved in the biological process of response to stimuli, metabolic processes, and apoptosis signaling. Changes in the expression of phosphorylated 14-3-3 θ were further confirmed by Mn 2+ -Phos-tag SDS-PAGE. Western blotting showed overexpression of Bax protein in the mitochondria with down-regulation in the cytoplasm, whereas cytochrome c expression was high in the cytoplasm but low in the mitochondria after 1-BP exposure. Our results suggest that the pathogenesis of 1-BP-induced hippocampal damage involves inhibition of antiapoptosis process. Phosphoproteins identified in this study can potentially serve as biomarkers for 1-BP-induced neurotoxicity. - Highlights: • 1-BP modified hippocampal phosphoproteome in rat and 23 altered proteins were identified. • 1-BP changed phosphorylation of GRP78

  3. Hippocampal phosphoproteomics of F344 rats exposed to 1-bromopropane

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Zhenlie [Guangdong Provincial Key Laboratory of Occupational Disease Prevention and Treatment, Guangdong Province Hospital for Occupational Disease Prevention and Treatment, Guangzhou 510-300 (China); Department of Occupational and Environmental Health, Nagoya University Graduate School of Medicine, Nagoya 466-8550 (Japan); Ichihara, Sahoko [Graduate School of Regional Innovation Studies, Mie University, Tsu 514-8507 (Japan); Oikawa, Shinji [Department of Environmental and Molecular Medicine, Mie University Graduate School of Medicine, Mie 514-8507 (Japan); Chang, Jie [Department of Occupational and Environmental Health, Nagoya University Graduate School of Medicine, Nagoya 466-8550 (Japan); Graduate School of Regional Innovation Studies, Mie University, Tsu 514-8507 (Japan); Zhang, Lingyi [Department of Occupational and Environmental Health, Nagoya University Graduate School of Medicine, Nagoya 466-8550 (Japan); Department of Occupational and Environmental Health, Faculty of Pharmaceutical Sciences, Tokyo University of Science, Noda 278-8510 (Japan); Hu, Shijie [Guangdong Provincial Key Laboratory of Occupational Disease Prevention and Treatment, Guangdong Province Hospital for Occupational Disease Prevention and Treatment, Guangzhou 510-300 (China); Huang, Hanlin, E-mail: [Guangdong Provincial Key Laboratory of Occupational Disease Prevention and Treatment, Guangdong Province Hospital for Occupational Disease Prevention and Treatment, Guangzhou 510-300 (China); Ichihara, Gaku, E-mail: [Department of Occupational and Environmental Health, Nagoya University Graduate School of Medicine, Nagoya 466-8550 (Japan); Department of Occupational and Environmental Health, Faculty of Pharmaceutical Sciences, Tokyo University of Science, Noda 278-8510 (Japan)


    1-Bromopropane (1-BP) is neurotoxic in both experimental animals and human. To identify phosphorylated modification on the unrecognized post-translational modifications of proteins and investigate their role in 1-BP-induced neurotoxicity, changes in hippocampal phosphoprotein expression levels were analyzed quantitatively in male F344 rats exposed to 1-BP inhalation at 0, 400, or 1000 ppm for 8 h/day for 1 or 4 weeks. Hippocampal protein extracts were analyzed qualitatively and quantitatively by Pro-Q Diamond gel staining and SYPRO Ruby staining coupled with two-dimensional difference in gel electrophoresis (2D-DIGE), respectively, as well as by matrix-assisted laser-desorption ionization time-of-flight (MALDI-TOF) mass spectrometry (MS) to identify phosphoproteins. Changes in selected proteins were further confirmed by Manganese II (Mn{sup 2+})-Phos-tag SDS-polyacrylamide gel electrophoresis (SDS-PAGE). Bax and cytochrome c protein levels were determined by western blotting. Pro-Q Diamond gel staining combined with 2D-DIGE identified 26 phosphoprotein spots (p < 0.05), and MALDI-TOF/MS identified 18 up-regulated proteins and 8 down-regulated proteins. These proteins are involved in the biological process of response to stimuli, metabolic processes, and apoptosis signaling. Changes in the expression of phosphorylated 14-3-3 θ were further confirmed by Mn{sup 2+}-Phos-tag SDS-PAGE. Western blotting showed overexpression of Bax protein in the mitochondria with down-regulation in the cytoplasm, whereas cytochrome c expression was high in the cytoplasm but low in the mitochondria after 1-BP exposure. Our results suggest that the pathogenesis of 1-BP-induced hippocampal damage involves inhibition of antiapoptosis process. Phosphoproteins identified in this study can potentially serve as biomarkers for 1-BP-induced neurotoxicity. - Highlights: • 1-BP modified hippocampal phosphoproteome in rat and 23 altered proteins were identified. • 1-BP changed phosphorylation

  4. Integrity of Disposable Nitrile Exam Gloves Exposed to Simulated Movement (United States)

    Phalen, Robert N.; Wong, Weng Kee


    Every year, millions of health care, first responder, and industry workers are exposed to chemical and biological hazards. Disposable nitrile gloves are a common choice as both a chemical and physical barrier to these hazards, especially as an alternative to natural latex gloves. However, glove selection is complicated by the availability of several types or formulations of nitrile gloves, such as low-modulus, medical-grade, low-filler, and cleanroom products. This study evaluated the influence of simulated movement on the physical integrity (i.e., holes) of different nitrile exam glove brands and types. Thirty glove products were evaluated out-of-box and after exposure to simulated whole-glove movement for 2 hr. In lieu of the traditional 1-L water-leak test, a modified water-leak test, standardized to detect a 0.15 ± 0.05 mm hole in different regions of the glove, was developed. A specialized air inflation method simulated bidirectional stretching and whole-glove movement. A worst-case scenario with maximum stretching was evaluated. On average, movement did not have a significant effect on glove integrity (chi-square; p=0.068). The average effect was less than 1% between no movement (1.5%) and movement (2.1%) exposures. However, there was significant variability in glove integrity between different glove types (p ≤ 0.05). Cleanroom gloves, on average, had the highest percentage of leaks, and 50% failed the water-leak test. Low-modulus and medical-grade gloves had the lowest percentages of leaks, and no products failed the water-leak test. Variability in polymer formulation was suspected to account for the observed discrepancies, as well as the inability of the traditional 1-L water-leak test to detect holes in finger/thumb regions. Unexpectedly, greater than 80% of the glove defects were observed in the finger and thumb regions. It is recommended that existing water-leak tests be re-evaluated and standardized to account for product variability. PMID:21476169

  5. Polymorphic trial in oxidative damage of arsenic exposed Vietnamese

    International Nuclear Information System (INIS)

    Fujihara, Junko; Soejima, Mikiko; Yasuda, Toshihiro; Koda, Yoshiro; Kunito, Takashi; Iwata, Hisato; Tanabe, Shinsuke; Takeshita, Haruo


    Arsenic causes DNA damage and changes the cellular capacity for DNA repair. Genes in the base excision repair (BER) pathway influence the generation and repair of oxidative lesions. Single nucleotide polymorphisms (SNPs) in human 8-oxoguanine DNA glycosylase (hOGG1) Ser326Cys; apurinic/apyrimidinic endonuclease (APE1) Asp148Glu; X-ray and repair and cross-complementing group 1 (XRCC1) Arg280His and Arg399Gln in the BER genes were analyzed, and the relationship between these 4 SNPs and the urinary 8-hydroxy-2'-deoxyguanosine (8-OHdG) concentrations of 100 Vietnamese population exposed to arsenic was investigated. Individuals with hOGG1 326Cys/Cys showed significantly higher urinary 8-OHdG concentrations than did those with 326 Ser/Cys and Ser/Ser. As for APE1 Asp148Glu, heterozygous subjects showed significantly higher urinary 8-OHdG concentrations than did those homozygous for Asp/Asp. Moreover, global ethnic comparison of the allelic frequencies of the 4SNPs was performed in 10 population and previous reported data. The mutant allele frequencies of hOGG1 Ser326Cys in the Asian populations were higher than those in the African and Caucasian populations. As for APE1 Asp148Glu, Caucasians showed higher mutant frequencies than those shown by African and Asian populations. Among Asian populations, the Bangladeshi population showed relatively higher mutant allele frequencies of the APE1 Asp148Glu polymorphism. This study is the first to demonstrate the existence of genetic heterogeneity in a worldwide distribution of SNPs (hOGG1 Ser326Cys, APE1 Asp148Glu, XRCC1 Arg280His, and XRCC1 Arg399Gln) in the BER genes. - Highlights: → We showed that hOGG1 and APE1 are associated with urinary 8-OHdG concentrations. → We showed the existence of inter-ethnic differences in hOGG1 and APE1 polymorphism. → These polymorphisms is a genetic marker of susceptibility to oxidative stress.

  6. Influence of Some Pesticides on Humoral and Cellular Immunity of Exposed Workers in Pesticides Industries

    International Nuclear Information System (INIS)

    Osely, E.Sh.M.


    Pesticide poisoning is a major public health problem in developing countries. In most of these countries organophosphate pesticides constitute the most widely used pesticides. The main toxicity of OPs is neurotoxicity, which is caused by the inhibition of acetylcholinesterase. OPs also affect the immune response, including effects on cellular and humoral immunity. Our study examined the effect of organophosphorus compounds on humoral and cellular immunity of exposed workers in pesticides industries. The study was conducted into 40 subjects. They were 2 groups; 20 exposed workers from Gharbeia and Kafr Elsheikh at 2008 and 2009 and 20 unexposed individuals as a control group at the same period of time. We examined some immune parameters; pseudocholinesterase, WBCs count, CD4%, CD8%, CD4/CD8, CD56%, Interleukin 2, IgG and IgM. Also we take history and clinical examination for them. We reported a highly significant decrease in pseudo cholinesterase level among the exposed group in comparison to the control group, highly significant increase in percentage of CD8 in the exposed group in comparison to control group, highly significant decrease in CD4 / CD8 ratio in the exposed group in comparison to control group, highly significant decrease in percentage of CD56 in the exposed group in comparison to control group and a highly significant increase in IgG level in the exposed group in comparison to control group. On the other hand, we reported no significant change in white blood cells count between the exposed and control groups, no significant change in percentage of CD4 among the exposed and control group, no significant change in Interleukin 2 level among the exposed and control group and no significant change in IgM level among the exposed and control group. We concluded that pesticides extensively affect the humoral and cellular immune system of occupationally exposed workers.

  7. Pulmonary function and oxidative stress in workers exposed to styrene in plastic factory: occupational hazards in styrene-exposed plastic factory workers. (United States)

    Sati, Prakash Chandra; Khaliq, Farah; Vaney, Neelam; Ahmed, Tanzeel; Tripathi, Ashok K; Banerjee, Basu Dev


    Styrene is a volatile organic compound used in factories for synthesis of plastic products. The pneumotoxicity of styrene in experimental animals is known. The aim of the present study was to study the effect of styrene on lung function and oxidative stress in occupationally exposed workers in plastic factory. Thirty-four male workers, between 18 and 40 years of age, exposed to styrene for atleast 8 hours a day for more than a year were studied, while 30 age- and sex-matched healthy subjects not exposed to styrene served as controls. Assessment of lung functions showed a statistically significant reduction (p volumes, capacities (FVC, FEV(1), VC, ERV, IRV, and IC) and flow rates (PEFR, MEF(75%), and MVV) in the study group (workers) as compared to controls. Malondialdehyde (MDA) was observed to be significantly high (p < 0.05) while ferric-reducing ability of plasma (FRAP) was significantly low (p < 0.05) in styrene-exposed subjects. Reduced glutathione (GSH) level was significantly depleted in exposed subjects as compared to control group. The mean value of serum cytochrome c in styrene-exposed subjects was found to be 1.1 ng/ml (0.89-1.89) while in control its levels were under detection limit (0.05 ng/ml). It shows that styrene inhalation by workers leads to increased level of oxidative stress, which is supposed to be the cause of lung damage.

  8. Potassium ion influx measurements on cultured Chinese hamster cells exposed to 60-hertz electromagnetic fields

    International Nuclear Information System (INIS)

    Stevenson, A.P.; Tobey, R.A.


    Potassium ion influx was measured by monitoring 42 KCl uptake by Chinese hamster ovary (CHO) cells grown in suspension culture and exposed in the culture medium to 60-Hz electromagnetic fields up to 2.85 V/m. In the presence of the field CHO cells exhibited two components of uptake, the same as previously observed for those grown under normal conditions; both these components of influx were decreased when compared to sham-exposed cells. Although decreases were consistently observed in exposed cells when plotted as loge of uptake, the differences between the means of the calculated fluxes of exposed and sham-exposed cells were quite small (on the order of 4-7%). When standard deviations were calculated, there was no significant difference between these means; however, when time-paired uptake data were analyzed, the differences were found to be statistically significant. Cells exposed only to the magnetic field exhibited similar small decreases in influx rates when compared to sham-exposed cells, suggesting that the reduction in K+ uptake could be attributed to the magnetic field. Additionally, intracellular K+ levels were measured over a prolonged exposure period (96 h), and no apparent differences in intracellular K+ levels were observed between field-exposed and sham-exposed cultures. These results indicate that high-strength electric fields have a small effect on the rate of transport of potassium ions but no effect on long-term maintenance of intracellular K+

  9. Cytokine mRNA profiles in pigs exposed prenatally and postnatally to Schistosoma japonicum

    DEFF Research Database (Denmark)

    Techau, Michala E.; Johansen, Maria V.; Aasted, Bent


    of septal fibrosis were significantly higher in the postnatal group compared to the prenatal group (P prenatally infected animals compared to the control...... group (P prenatal group showed higher levels of TGF-beta 1 in the liver compared with the postnatally infected group (P control group (P prenatally exposed pigs.......The pig is a natural host for Schistosoma japonicum and a useful animal model of human infection. The aim of the present study was to assess the differences between the cytokine profiles in prenatally or postnatally S. japonicum exposed pigs. Seven prenatally exposed pigs, 7 postnatally exposed...

  10. The affect of the space environment on the survival of Halorubrum chaoviator and Synechococcus (Nägeli): data from the Space Experiment OSMO on EXPOSE-R (United States)

    Mancinelli, R. L.


    We have shown using ESA's Biopan facility flown in Earth orbit that when exposed to the space environment for 2 weeks the survival rate of Synechococcus (Nägeli), a halophilic cyanobacterium isolated from the evaporitic gypsum-halite crusts that form along the marine intertidal, and Halorubrum chaoviator a member of the Halobacteriaceae isolated from an evaporitic NaCl crystal obtained from a salt evaporation pond, were higher than all other test organisms except Bacillus spores. These results led to the EXPOSE-R mission to extend and refine these experiments as part of the experimental package for the external platform space exposure facility on the ISS. The experiment was flown in February 2009 and the organisms were exposed to low-Earth orbit for nearly 2 years. Samples were either exposed to solar ultraviolet (UV)-radiation (λ > 110 nm or λ > 200 nm, cosmic radiation (dosage range 225-320 mGy), or kept in darkness shielded from solar UV-radiation. Half of each of the UV-radiation exposed samples and dark samples were exposed to space vacuum and half kept at 105 pascals in argon. Duplicate samples were kept in the laboratory to serve as unexposed controls. Ground simulation control experiments were also performed. After retrieval, organism viability was tested using Molecular Probes Live-Dead Bac-Lite stain and by their reproduction capability. Samples kept in the dark, but exposed to space vacuum had a 90 +/- 5% survival rate compared to the ground controls. Samples exposed to full UV-radiation for over a year were bleached and although results from Molecular Probes Live-Dead stain suggested ~10% survival, the data indicate that no survival was detected using cell growth and division using the most probable number method. Those samples exposed to attenuated UV-radiation exhibited limited survival. Results from of this study are relevant to understanding adaptation and evolution of life, the future of life beyond earth, the potential for interplanetary

  11. The Affect of the Space Environment on the Survival of Halorubrum Chaoviator and Synechococcus (Nageli): Data from the Space Experiment OSMO on EXPOSE-R (United States)

    Mancinelli, R. L.


    We have shown using ESA's Biopan facility flown in Earth orbit that when exposed to the space environment for 2 weeks the survival rate of Synechococcus (Nageli), a halophilic cyanobacterium isolated from the evaporitic gypsum-halite crusts that form along the marine intertidal, and Halorubrum chaoviator a member of the Halobacteriaceae isolated from an evaporitic NaCl crystal obtained from a salt evaporation pond, were higher than all other test organisms except Bacillus spores. These results led to the EXPOSE-R mission to extend and refine these experiments as part of the experimental package for the external platform space exposure facility on the ISS. The experiment was flown in February 2009 and the organisms were exposed to low-Earth orbit for nearly 2 years. Samples were either exposed to solar ultraviolet (UV)-radiation (lambda is greater than 110 nm or lambda is greater than 200 nm, cosmic radiation (dosage range 225-320 mGy), or kept in darkness shielded from solar UV-radiation. Half of each of the UV-radiation exposed samples and dark samples were exposed to space vacuum and half kept at 105 pascals in argon. Duplicate samples were kept in the laboratory to serve as unexposed controls. Ground simulation control experiments were also performed. After retrieval, organism viability was tested using Molecular Probes Live-Dead Bac-Lite stain and by their reproduction capability. Samples kept in the dark, but exposed to space vacuum had a 90 +/- 5% survival rate compared to the ground controls. Samples exposed to full UV-radiation for over a year were bleached and although results from Molecular Probes Live-Dead stain suggested approximately 10% survival, the data indicate that no survival was detected using cell growth and division using the most probable number method. Those samples exposed to attenuated UV-radiation exhibited limited survival. Results from of this study are relevant to understanding adaptation and evolution of life, the future of life

  12. SCM Paste Samples Exposed To Aggressive Solutions. Cementitious Barriers Partnership

    International Nuclear Information System (INIS)

    Foster, T.


    This report summarizes experimental work performed by SIMCO Technologies Inc. (SIMCO) as part of the Cementitious Barriers Partnership (CBP) project. The test series followed an experimental program dedicated to the study of ordinary Portland cement (OPC) hydrated cement pastes exposed to aggressive solutions. In the present study, the scope is extended to hydrated cement pastes incorporating supplementary cementitious materials (SCM) such as fly ash and ground granulated blast furnace slag (GGBFS). Also, the range of aggressive contact solutions was expanded. The experimental program aimed at testing aggressive contact solutions that more closely mimic the chemical composition of saltstone pore solution. Five different solutions, some of which incorporated high levels of carbonate and nitrate, were placed in contact with four different hydrated cement paste mixes. In all solutions, 150 mmol/L of SO 4 2- (14 400 ppm) were present. The solutions included different pH conditions and different sodium content. Two paste mixes were equivalent to Vault 1/4 and Vault 2 concrete mixes used at SRS in storage structures. Two additional paste mixes, cast at the same water-to-cement ratio and using the same cements but without SCMs, were also tested. The damage evolution in samples was monitored using ultrasonic pulse velocity (UPV) and mass measurements. After three and twelve months of exposure conditions, samples were taken out of solution containers and analyzed to perform migration tests and porosity measurements. Globally, results were in line with the previous study and confirmed that high pH may limit the formation of some deleterious phases like gypsum. In this case, ettringite may form but is not necessarily associated with damage. However, the high concentration of sodium may be associated with the formation of an AFm-like mineral called U-phase. The most significant evidences of damage were all associated with the Vault 2 paste analog. This material

  13. Durability of reinforced adobe exposed to chloride ions

    Directory of Open Access Journals (Sweden)

    Giménez, A.


    Full Text Available One of the primary shortcomings of adobe, a dried mudblock stabilized with sisal hemp and cement widely used across all of Latin America, is its dimensional instability when exposed to water or aggressive environments. The present paper evaluates the electrochemical performance of reinforced adobe block after 1,000 days of exposure to a simulated marine environment. The specimens used were adobe blocks internally reinforced with 3/8-inch steel bars. The specimens were watered every two weeks: one group with potable water to simulate a natural urban environment and the other with a 3% sodium chloride solution to simulate a marine environment.Chloride penetration in powder extracted from the specimens was determined using the Mohr method. Electrochemical measurements included Gecor 6 electric potential(Eº and corrosion intensity (icorr readings. The final conclusion drawn from an analysis of the results was that in all cases the amount of free chlorides present sufficed to depassivate reinforcing steel and that the system component providing the most effective protection was the rough casting mortar. Consequently, this type of adobe mixes is not recommended for use in marine or industrial environments.La tierra-cemento-sisal es un material cuyo uso se encuentra muy difundido en toda Latinoamérica, entre sus principales limitaciones está la inestabilidad volumétrica ante el agua y ambientes agresivos. Por tal motivo, en este trabajo se evaluó el comportamiento electroquímico de bloques de tierra-cemento-sisal armado expuestos durante 1.000 días a un ambiente marino simulado. Las probetas utilizadas fueron bloques de tierra-cemento-sisal incorporándole internamente barras de acero de 3/8 de pulg. Las probetas se sometieron a un rociado quincenal: las de ambiente natural urbano con agua potable y las de ambiente marino simulado con una solución al 3% de cloruro de sodio. La penetración de cloruros se determinó extrayendo polvillo y

  14. SCM Paste Samples Exposed To Aggressive Solutions. Cementitious Barriers Partnership

    Energy Technology Data Exchange (ETDEWEB)

    Foster, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    This report summarizes experimental work performed by SIMCO Technologies Inc. (SIMCO) as part of the Cementitious Barriers Partnership (CBP) project. The test series followed an experimental program dedicated to the study of ordinary Portland cement (OPC) hydrated cement pastes exposed to aggressive solutions. In the present study, the scope is extended to hydrated cement pastes incorporating supplementary cementitious materials (SCM) such as fly ash and ground granulated blast furnace slag (GGBFS). Also, the range of aggressive contact solutions was expanded. The experimental program aimed at testing aggressive contact solutions that more closely mimic the chemical composition of saltstone pore solution. Five different solutions, some of which incorporated high levels of carbonate and nitrate, were placed in contact with four different hydrated cement paste mixes. In all solutions, 150 mmol/L of SO42– (14 400 ppm) were present. The solutions included different pH conditions and different sodium content. Two paste mixes were equivalent to Vault 1/4 and Vault 2 concrete mixes used at SRS in storage structures. Two additional paste mixes, cast at the same water-to-cement ratio and using the same cements but without SCMs, were also tested. The damage evolution in samples was monitored using ultrasonic pulse velocity (UPV) and mass measurements. After three and twelve months of exposure conditions, samples were taken out of solution containers and analyzed to perform migration tests and porosity measurements. Globally, results were in line with the previous study and confirmed that high pH may limit the formation of some deleterious phases like gypsum. In this case, ettringite may form but is not necessarily associated with damage. However, the high concentration of sodium may be associated with the formation of an AFm-like mineral called U-phase. The most significant evidences of damage were all associated with the Vault 2 paste analog. This

  15. Methylomic changes in individuals with psychosis, prenatally exposed to endocrine disrupting compounds: Lessons from diethylstilbestrol.

    Directory of Open Access Journals (Sweden)

    Fabrice Rivollier

    Full Text Available In the Western world, between 1940 and 1970, more than 2 million people were exposed in utero to diethylstilbestrol (DES. In exposed individuals, and in their descendants, adverse outcomes have been linked to such exposure, including cancers, genital malformations, and less consistently, psychiatric disorders. We aimed to explore whether prenatal DES exposure would be associated with DNA methylation changes, and whether these epigenetic modifications would be associated with increased risk of psychosis.From 247 individuals born from mothers exposed to DES, we selected 69 siblings from 30 families. In each family, at least one sibling was exposed in utero to DES. We performed a methylome-wide association study using HumanMethylation450 DNA Analysis BeadChip® in peripheral blood. We analyzed methylation changes at individual CpGs or regions in exposed (n = 37 versus unexposed individuals (n = 32. We also compared exposed individuals with (n = 7 and without psychosis (n = 30.There were more individuals with schizophrenia in the DES-exposed group. We found no significant differences between exposed and unexposed individuals with respect to differentially methylated CpGs or regions. The largest difference was in a region near the promoter of an ADAMTS proteoglycanase gene (ADAMTS9. Compared to exposed individuals without psychosis, exposed individuals with psychosis had differential methylation in the region encompassing the gene encoding the zinc finger protein 57 (ZFP57.In utero exposure to DES was not associated with methylation changes at specific CpG or regions. In exposed individuals, however, psychosis was associated with specific methylomic modifications that could impact neurodevelopment and neuroplasticity.

  16. Cytogenetics observation and radiation influence evaluation of exposed persons in a discontinuous radiation exposure event

    International Nuclear Information System (INIS)

    Chen Ying; Liu Xiulin; Yang Guoshan; Ge Shili; Jin Cuizhen; Yao Bo


    The cytogenetics results and dose estimation of exposed and related persons in an discontinuous radiation exposure event were reported in this paper. According to dicentrics + ring and micronucleus results combined with clinical data, slight (middle) degree of subacute radiation symptom of the victim was diagnosed. A part of 52 examined persons were exposed to radiation in a certain degree

  17. Effects of Vitamin C on Kidney and Bone of Rats Exposed to Low ...

    African Journals Online (AJOL)

    ABSTRACT: In this study, the effect of vitamin C on cadmium-induced toxicity was investigated. Wister rats were exposed to ... and muscles of cadmium exposed rats (1.0- ..... Fauci, A.S., Braunwald, K., Isselbacher, K.J., Wilson,. J.D., Martin ...

  18. Modeling lung cancer risks in laboratory dogs exposed to inhaled plutonium

    International Nuclear Information System (INIS)

    Gilbert, E.S.; Park, J.F.; Buschbom, R.L.


    These analyses are based on data from a lifespan study of beagle dogs exposed to inhaled plutonium being conducted at Pacific Northwest Laboratory. An important goal of this study is to increase understanding of health risk resulting from this exposure, with particular attention to lung cancer risks. Data on humans exposed to plutonium are inadequate for achieving this goal

  19. Differentiation of peripheral lymphocyte population in Pu-exposed beagle dogs

    International Nuclear Information System (INIS)

    Morris, J.E.


    The percentage of peripheral lymphocytes binding fluorescent-labeled anticanine antibodies was measured in plutonium-oxide-exposed and unexposed beagle dogs. With this assay system, there was a significant decrease in the percentage of lymphocytes binding the labeled antibody in exposed animals compared to control animals

  20. 30 CFR 75.521 - Lightning arresters; ungrounded and exposed power conductors and telephone wires. (United States)


    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Lightning arresters; ungrounded and exposed... Electrical Equipment-General § 75.521 Lightning arresters; ungrounded and exposed power conductors and... leads underground shall be equipped with suitable lightning arresters of approved type within 100 feet...

  1. 76 FR 67761 - Establishment of the Attorney General's National Task Force on Children Exposed to Violence (United States)


    ... the Attorney General's National Task Force on Children Exposed to Violence AGENCY: Office of Juvenile.... SUMMARY: The Attorney General's National Task Force on Children Exposed to Violence (the Task Force) is....C., App. 2. The Task Force will provide the Attorney General with valuable advice on a broad array...

  2. Hepatitis B immunisation in persons not previously exposed to hepatitis B or with unknown exposure status

    DEFF Research Database (Denmark)

    Mathew, Joseph L; El Dib, Regina; Mathew, Preethy J


    The benefits and harms of hepatitis B vaccination in persons not previously exposed to hepatitis B infection or with unknown exposure status have not been established.......The benefits and harms of hepatitis B vaccination in persons not previously exposed to hepatitis B infection or with unknown exposure status have not been established....

  3. 46 CFR 169.721 - Storm sails and halyards (exposed and partially protected waters only). (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Storm sails and halyards (exposed and partially... § 169.721 Storm sails and halyards (exposed and partially protected waters only). (a) Unless clearly unsuitable, each vessel must have one storm trysail of appropriate size. It must be sheeted independently of...

  4. Optimization of radiological surveillance of occupationally-exposed workers in the Republic of Cuba

    International Nuclear Information System (INIS)


    This works analyzes the results of the dosimetric control to occupationally-exposed workers. during the 1987-1990 period. It states a criterium for knowing when it will be necessary to give or not an individual dosimeter to occupationally-exposed workers. It also proposes to take the dosimeter away to a number of workers as a result of such criterium

  5. Project VALOR: Trajectories of Change in PTSD in Combat-Exposed Veterans (United States)


    Post - traumatic stress disorder ( PTSD ), military sexual trauma (MST), suicide, combat-exposed veterans, PTSD ...develop the first longitudinal registry of combat-exposed men and women with post - traumatic stress disorder ( PTSD ), 1649 participants from across the...Keane, T. M. (2012). Project VALOR: Design and methods of a longitudinal registry of post - traumatic stress disorder ( PTSD ) in

  6. Evaluation of selenium in biological sample of arsenic exposed female skin lesions and skin cancer patients with related to non-exposed skin cancer patients

    Energy Technology Data Exchange (ETDEWEB)

    Kolachi, Nida F.; Kazi, Tasneem G., E-mail:; Wadhwa, Sham K.; Afridi, Hassan I.; Baig, Jameel A.; Khan, Sumaira; Shah, Faheem


    The antagonistic effects between selenium (Se) and arsenic (As) suggest that low Se status plays an important role in arsenism development. The objective of present study was to assess Se contents in biological samples of As exposed females have skin lesions and cancer with related to non-exposed skin cancer patients. The biological samples (blood and scalp hair) of As exposed group comprises, female skin cancer (ESC) patients admitted in cancer hospitals have skin lesions (ESL) and exposed referents have not both diseases (ER), belongs to As exposed area of Pakistan. For comparative purposes, age matched female skin cancerous patient (RP) and non-cancerous females (NER) belong to non-exposed areas were also selected. The As and Se in acid digests of biological samples were pre-concentrated by complexing with chelating agent (ammonium pyrrolidinedithiocarbamate), and resulted complexes were extracted into non-ionic extractant (Triton X-114), prior to analysis by electrothermal atomic absorption spectrometry. The enhancement factor of about 25 was obtained by pre-concentrating 10 mL of sample solutions. The accuracy of the optimized procedure was evaluated by using certified reference material (BCR 397) with certified values for Se and As and standard addition method at three concentration levels in real samples. No significant differences was observed (p > 0.05) when comparing the values obtained by the proposed method, added and certified values of both elements. The biological samples of ESC patients had 2-3 folds higher As and lower Se levels as compared to RP (p < 0.001). Understudied exposed referents have high level of As and lower Se contents as compared to referents subjects of non-exposed area (p < 0.01). The higher concentration of As and lower levels of Se in biological samples of cancerous patients are consisted with reported studies. - Research Highlights: {yields} Advance extraction method for the enrichment of arsenic and selenium in biological

  7. Evaluation of selenium in biological sample of arsenic exposed female skin lesions and skin cancer patients with related to non-exposed skin cancer patients

    International Nuclear Information System (INIS)

    Kolachi, Nida F.; Kazi, Tasneem G.; Wadhwa, Sham K.; Afridi, Hassan I.; Baig, Jameel A.; Khan, Sumaira; Shah, Faheem


    The antagonistic effects between selenium (Se) and arsenic (As) suggest that low Se status plays an important role in arsenism development. The objective of present study was to assess Se contents in biological samples of As exposed females have skin lesions and cancer with related to non-exposed skin cancer patients. The biological samples (blood and scalp hair) of As exposed group comprises, female skin cancer (ESC) patients admitted in cancer hospitals have skin lesions (ESL) and exposed referents have not both diseases (ER), belongs to As exposed area of Pakistan. For comparative purposes, age matched female skin cancerous patient (RP) and non-cancerous females (NER) belong to non-exposed areas were also selected. The As and Se in acid digests of biological samples were pre-concentrated by complexing with chelating agent (ammonium pyrrolidinedithiocarbamate), and resulted complexes were extracted into non-ionic extractant (Triton X-114), prior to analysis by electrothermal atomic absorption spectrometry. The enhancement factor of about 25 was obtained by pre-concentrating 10 mL of sample solutions. The accuracy of the optimized procedure was evaluated by using certified reference material (BCR 397) with certified values for Se and As and standard addition method at three concentration levels in real samples. No significant differences was observed (p > 0.05) when comparing the values obtained by the proposed method, added and certified values of both elements. The biological samples of ESC patients had 2-3 folds higher As and lower Se levels as compared to RP (p < 0.001). Understudied exposed referents have high level of As and lower Se contents as compared to referents subjects of non-exposed area (p < 0.01). The higher concentration of As and lower levels of Se in biological samples of cancerous patients are consisted with reported studies. - Research Highlights: → Advance extraction method for the enrichment of arsenic and selenium in biological matrices

  8. Psychophysical Evaluation of Achromatic and Chromatic Vision of Workers Chronically Exposed to Organic Solvents

    International Nuclear Information System (INIS)

    Lacerda, E.M.D.B.; Lima, M.G.; Silveira, L.C.D.S.; Rodrigues, A.R.; Teixeira, C.E.C.; De Lima, L.J.B.; Silveira, L.C.D.S.; Ventura, D.F.; Ventura, D.F.


    The purpose of this paper was to evaluate achromatic and chromatic vision of workers chronically exposed to organic solvents through psychophysical methods. Thirty-one gas station workers (31.5 ± 8.4 years old) were evaluated. Psychophysical tests were achromatic tests (Snellen chart, spatial and temporal contrast sensitivity, and visual perimetry) and chromatic tests (Ishihara's test, color discrimination ellipses, and Farnsworth-Munsell 100 hue test FM100). Spatial contrast sensitivities of exposed workers were lower than the control at spatial frequencies of 20 and 30 cpd whilst the temporal contrast sensitivity was preserved. Visual field losses were found in 10-30 degrees of eccentricity in the solvent exposed workers. The exposed workers group had higher error values of FM100 and wider color discrimination ellipses area compared to the controls. Workers occupationally exposed to organic solvents had abnormal visual functions, mainly color vision losses and visual field constriction

  9. Genetic and demographic responses of mosquitofish (Gambusia holbrooki) populations exposed to mercury for multiple generations

    Energy Technology Data Exchange (ETDEWEB)

    Tatara, C.P.; Mulvey, M.; Newman, M.C.


    Genetic and demographic responses of mosquitofish were examined after multiple generations of exposure to mercury. Previous studies of acute lethal exposures of mosquitofish to either mercury or arsenic demonstrated a consistent correlation between time to death and genotype at the glucosephosphate isomerase-2 (Gpi-2) locus. A mesocosm study involving mosquitofish populations exposed to mercury for 111 d showed significant female sexual selection and fecundity selection at the Gpi-2 locus. Here the mesocosm study was extended to populations exposed to mercury for several (approx. four) generations. After 2 years, control and mercury-exposed populations met Hardy-Weinberg expectations and showed no evidence of genetic bottlenecks. The mean number of heterozygous loci did not differ significantly between the mercury-exposed and control populations. Significant differences in allele frequencies at the Gpi-2 locus were observed between the mercury-exposed and control populations. Relative to the initial and control allele frequencies, the GPI-2{sup 100} allele frequency was lower, the Gpi-2{sup 66} allele frequency increased, but the Gpi-2{sup 38} allele frequency did not change in mercury-exposed populations. No significant differences were found in standard length, weight, sex ratio, or age class ratio between the control and mercury-exposed populations. Allele frequency changes at the Gpi-2 locus suggest population-level response to chronic mercury exposure. Changes in allele frequency may be useful as indicators of population response to contaminants, provided that the population in question is well understood.

  10. Analysis of emotionality and locomotion in radio-frequency electromagnetic radiation exposed rats. (United States)

    Narayanan, Sareesh Naduvil; Kumar, Raju Suresh; Paval, Jaijesh; Kedage, Vivekananda; Bhat, M Shankaranarayana; Nayak, Satheesha; Bhat, P Gopalakrishna


    In the current study the modulatory role of mobile phone radio-frequency electromagnetic radiation (RF-EMR) on emotionality and locomotion was evaluated in adolescent rats. Male albino Wistar rats (6-8 weeks old) were randomly assigned into the following groups having 12 animals in each group. Group I (Control): they remained in the home cage throughout the experimental period. Group II (Sham exposed): they were exposed to mobile phone in switch-off mode for 28 days, and Group III (RF-EMR exposed): they were exposed to RF-EMR (900 MHz) from an active GSM (Global system for mobile communications) mobile phone with a peak power density of 146.60 μW/cm(2) for 28 days. On 29th day, the animals were tested for emotionality and locomotion. Elevated plus maze (EPM) test revealed that, percentage of entries into the open arm, percentage of time spent on the open arm and distance travelled on the open arm were significantly reduced in the RF-EMR exposed rats. Rearing frequency and grooming frequency were also decreased in the RF-EMR exposed rats. Defecation boli count during the EPM test was more with the RF-EMR group. No statistically significant difference was found in total distance travelled, total arm entries, percentage of closed arm entries and parallelism index in the RF-EMR exposed rats compared to controls. Results indicate that mobile phone radiation could affect the emotionality of rats without affecting the general locomotion.

  11. Cigarette smoke-exposed saliva suppresses cellular and humoral immune responses in an animal model

    International Nuclear Information System (INIS)

    Jafarzadeh, A.; Bakhshi, H.; Rezayati, M.T.; Nemati, M.


    To evaluate the effects of cigarette smoke (CS)-exposed saliva on cellular and antibody responses in an animal model. The stimulatory and non-stimulatory saliva samples were collected from 10 healthy subjects and were then exposed to CS for 20 or 80 minutes. The CS-exposed saliva samples were administrated intraperitoneally (i.p) to male Balb/c mice. Then the delayed type hypersensitivity (DTH) and antibody responses to sheep red blood cell (SRBC) was assessed. Moreover, the total white blood cells (WBC) counts and the blood lymphocytes counts were determined. The mean of DTH responses of animal groups received 20 minutes or 80 minutes CS-exposed saliva samples was significantly lower than that observed in control group. Moreover, The mean titer of anti-SRBC antibody was significantly lower in animal groups who received 80 minutes CS-exposed stimulatory or non-stimulatory saliva as compared to control group (P<0.04 and P<0.002, respectively). The mean counts of blood lymphocytes in 80 minutes CS exposed-stimulatory saliva group was also significantly lower as compared to control group (P<0.05). These results show that the CS-exposed saliva samples have profound suppressive effects on both cellular and humoral immune response in a mouse animal model (JPMA 59:760; 2009). (author)

  12. Oxidative stress biomarkers and aggressive behavior in fish exposed to aquatic cadmium contamination

    Directory of Open Access Journals (Sweden)

    Jeane A. Almeida

    Full Text Available The objective of this study was to investigate the possible link between cadmium exposure, hepatic markers of oxidative stress and aggressive behavior in Nile tilapia (Oreochromis niloticus. Fish were first exposed to 0.75 mg/L CdCl2 for 15 days (12 isolated fish for each group and afterward a behavioral test was performed. Fish from the control and cadmium-exposed groups were paired for 1 h (6 pairs of fish per group for determination of aggressiveness parameters. Immediately after the behavioral test, the animals were sacrificed and the liver was used to determine biochemical parameters. Cadmium decreased aggression in Nile tilapia. Subordinate animals exposed to cadmium showed decreased glutathione peroxidase (GSH-Px activity compared to dominant ones. No alterations were observed in selenium-dependent glutathione peroxidase Se-GSH-P and Cu-Zn superoxide dismutase activities, but total superoxide dismutase activity was increased in subordinate animals exposed to cadmium compared to subordinate control. Catalase activity was increased in cadmium-exposed fish. Lipoperoxide concentrations also increased in cadmium exposed fish indicating that cadmium toxicity may affect oxidative stress biomarkers in Nile tilapia. Social stress induced lipoperoxidation in Nile tilapia, and subordinate animals exposed to cadmium responded with lower activities of liver antioxidant enzymes compared to dominant fish. The present study shows that cadmium exposure is capable of inducing changes in the social status and oxidative stress parameters in this species.

  13. Technical Nuances of Exposing Rat Common Carotid Arteries for Practicing Microsurgical Anastomosis. (United States)

    Tayebi Meybodi, Ali; Aklinski, Joseph; Gandhi, Sirin; Lawton, Michael T; Preul, Mark C


    Animal models are commonly used in training protocols for microsurgical vascular anastomosis. Rat common carotid arteries (CCAs) are frequently used for this purpose. Much attention has been paid to the technical details of various anastomosis configurations using these arteries. However, technical nuances of exposing rat CCAs have been understudied. The purpose of this study is to describe nuances of technique for safely and efficiently exposing rat CCAs in preparation for a vascular anastomosis. Bilateral CCAs were exposed and prepared for anastomosis in 10 anesthetized Sprague-Dawley rats through a midline cervical incision. The exposed length of the CCA was measured. Additionally, technical nuances of exposure and surgically relevant anatomic details were recorded. The CCAs were exposed from the sternoclavicular joint to their bifurcation (average length, 19.1 ± 2.8 mm). Tenets important for a safe and efficient exposure of the CCAs included 1) generous subcutaneous dissection to expose the external jugular veins (EJVs), 2) avoiding injury to or compression of the EJVs, 3) superior mobilization of the salivary glands, 4) division of internal jugular veins, 5) opening the carotid sheath at its midlevel and from medial to lateral, and 6) avoiding injury to the vagus nerve or sympathetic trunk. Using the principles introduced in this study, trainees may safely and efficiently expose rat CCAs in preparation for a bypass. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. Effect of Nanoparticles Exposure on Fractional Exhaled Nitric Oxide (FENO in Workers Exposed to Nanomaterials

    Directory of Open Access Journals (Sweden)

    Wei-Te Wu


    Full Text Available Fractional exhaled nitric oxide (FENO measurement is a useful diagnostic test of airway inflammation. However, there have been few studies of FENO in workers exposed to nanomaterials. The purpose of this study was to examine the effect of nanoparticle (NP exposure on FENO and to assess whether the FENO is increased in workers exposed to nanomaterials (NM. In this study, both exposed workers and non-exposed controls were recruited from NM handling plants in Taiwan. A total of 437 subjects (exposed group = 241, non-exposed group = 196 completed the FENO and spirometric measurements from 2009–2011. The authors used a control-banding (CB matrix to categorize the risk level of each participant. In a multivariate linear regression analysis, this study found a significant association between risk level 2 of NP exposure and FENO. Furthermore, asthma, allergic rhinitis, peak expiratory flow rate (PEFR, and NF-κB were also significantly associated with FENO. When the multivariate logistic regression model was adjusted for confounders, nano-TiO2 in all of the NM exposed categories had a significantly increased risk in FENO > 35 ppb. This study found associations between the risk level of NP exposure and FENO (particularly noteworthy for Nano-TiO2. Monitoring FENO in the lung could open up a window into the role nitric oxide (NO may play in pathogenesis.

  15. DNA damage and cytotoxicity in pathology laboratory technicians exposed to organic solvents

    Directory of Open Access Journals (Sweden)



    Full Text Available The aim of this study was to evaluate potential DNA damage and cytotoxicity in pathology laboratory technicians exposed to organic solvents, mainly xylene. Peripheral blood and buccal cells samples were collected from 18 technicians occupationally exposed to organic solvents and 11 non-exposed individuals. The technicians were sampled at two moments: Monday and Friday. DNA damage and cytotoxicity were evaluated using the Comet Assay and the Buccal Micronucleus Cytome assay. Fifteen subjects (83.5% of the exposed group to solvents complained about some symptom probably related to contact with vapours of organic solvents. DNA damage in the exposed group to solvents was nearly 2-fold higher on Friday than on Monday, and in both moments the individuals of this group showed higher levels of DNA damage in relation to controls. No statistical difference was detected in buccal cell micronucleus frequency between the laboratory technicians and the control group. However, in the analysis performed on Friday, technicians presented higher frequency (about 3-fold of karyolytic and apoptotic-like cells (karyorrhectic and pyknotic in relation to control group. Considering the damage frequency and the working time, a positive correlation was found in the exposed group to solvents (r=0.468; p=0.05. The results suggest that pathology laboratory workers inappropriately exposed to organic solvents have increased levels of DNA damage.

  16. Incidence of brain tumours in rats exposed to an aerosol of 239PuO2

    International Nuclear Information System (INIS)

    Sanders, C.L.; Dagle, G.E.; Mahaffey, J.A.


    Incidence of brain tumours was investigated in 3390 female and male Wistar rats exposed to an aerosol of 239 PuO 2 , or as sham-exposed controls. Lung doses ranged from 0.05 to 22 Gy. In females, six brain tumours were found in 1058 control rats (incidence, 0.6%) and 24 brain tumours in 2134 rats exposed to Pu (incidence, 1.1%); the survival-adjusted level of significance was p = 0.29 for comparing control with exposed females. In males, two brain tumours were found in 60 control rats (incidence, 3.3%) and seven brain tumours in 138 rats exposed to Pu (incidence, 5.1%); the survival-adjusted level of significance was p = 0.33. Brain tumour incidence was about five times greater in male than in female rats (p = 0.0001), a highly significant sex difference in brain tumour incidence. Tumour types were distributed similarly among control and Pu-exposed groups of both sexes; most were astrocytomas. Mean lifespans for rats with brain tumours were not significantly different between control and Pu-exposed rats. (author)

  17. Fracture behaviour of the 14Cr ODS steel exposed to helium and liquid lead

    Energy Technology Data Exchange (ETDEWEB)

    Hojna, Anna, E-mail: [Centrum Vyzkumu Rez s.r.o., UJV Group, Rez 130, 250 68 Husinec (Czech Republic); Di Gabriele, Fosca [Centrum Vyzkumu Rez s.r.o., UJV Group, Rez 130, 250 68 Husinec (Czech Republic); Hadraba, Hynek; Husak, Roman; Kubena, Ivo [CEITEC IPM, Institute of Physics of Materials, Academy of Sciences of the Czech Republic, Zizkova 22, 616 62 Brno (Czech Republic); Rozumova, Lucia; Bublikova, Petra; Kalivodova, Jana [Centrum Vyzkumu Rez s.r.o., UJV Group, Rez 130, 250 68 Husinec (Czech Republic); Matejicek, Jiri [Institute of Plasma Physics, Academy of Sciences of the Czech Republic, Za Slovankou 1782/3, 182 00 Praha (Czech Republic)


    This work describes the fracture behaviour of the 14Cr ODS steel produced by mechanical alloying process, after high temperature exposures. Small specimens were exposed to helium gas in a furnace at 720 °C for 500 h. Another set of specimens was exposed to flowing liquid lead in the COLONRI II loop at 650 °C for 1000 h. All specimens were tested for the impact and tensile behaviour. The impact test results are compared to other sets of specimens in the as received state and after isothermal annealing at 650 °C for 1000 h. The impact curves of the exposed materials showed positive shifts on the transition temperature. While the upper shelf value did not change in the Pb exposed ODS steel, it significantly increased in the He exposed one. The differences are discussed in terms of surface and subsurface microscopy observation. The embrittlement can be explained as the effect of a slight change in the grain boundary and size distribution combined with the depletion of sub-surface region from alloying elements forming oxide scale on the surface. - Highlights: •We compared the impact energy curves of as received, isothermally aged and He/Pb exposed ODS steel samples. •The highest transition temperature showed the ODS steel exposed to liquid Pb at 650 °C for 1000 h. •We observed the higher tendency of the He exposed samples to crack arrester delamination than the Pb exposed ones. •The crack arrested delamination induced apparent increase of impact energies.

  18. Studies on the hazard of leukaemia and cancer in persons occupationally exposed to radiation

    International Nuclear Information System (INIS)

    Streffer, C.


    The mortality rates of British radiologists in dependence of the duration of their radiation work are compared with the general mortality rate in England and Wales, the mortality rates of men of the social class 1 and the mortality rates of practicing physicians. It turns out that the mortality by malignant diseases (leukemia and cancer) of persons exposed to radiation at work in nuclear plants is not considerably higher than it is for comparable groups of persons not exposed to radiation. Tumour entities of the GI tract have not been found either in the British radiologists exposed to radiation. (DG) [de

  19. Nocardia brasiliensis endophthalmitis in a patient with an exposed Ahmed glaucoma drainage implant. (United States)

    Stewart, Michael W; Bolling, James P; Bendel, Rick E


    To report a case of endophthalmitis due to Nocardia brasiliensis in an eye with an exposed, infected Ahmed glaucoma drainage implant (GDI). Retrospective case report. A patient with an exposed GDI experienced recurrent episodes of endophthalmitis despite repeated intravitreal injections of antibiotics and steroids. The tube was initially repositioned and finally removed. Whereas repeated cultures from the anterior chamber and vitreous were negative, cultures from the removed tube grew Nocardia brasiliensis. Despite oral trimethoprim-sulfamethoxazole and intravitreal amikacin the eye became phthisical and lost light perception. An exposed GDI may lead to endophthalmitis due to Nocardia brasiliensis and may require explantation to establish a diagnosis.

  20. Sister chromatid exchanges and micronuclei analysis in lymphocytes of men exposed to simazine through drinking water. (United States)

    Suárez, Susanna; Rubio, Arantxa; Sueiro, Rosa Ana; Garrido, Joaquín


    In some cities of the autonomous community of Extremadura (south-west of Spain), levels of simazine from 10 to 30 ppm were detected in tap water. To analyse the possible effect of this herbicide, two biomarkers, sister chromatid exchanges (SCE) and micronuclei (MN), were used in peripheral blood lymphocytes from males exposed to simazine through drinking water. SCE and MN analysis failed to detect any statistically significant increase in the people exposed to simazine when compared with the controls. With respect to high frequency cells (HFC), a statistically significant difference was detected between exposed and control groups.

  1. Contribution to the problem of biological dose assessment in occupationally exposed personnel

    International Nuclear Information System (INIS)

    Anger, H.; Jacobsohn, E.


    Chromosome studies were made on lymphocytes taken from the peripheral blood of occupationally exposed personnel (4 groups, exposure < 5 rems). In all exposed individuals the rate of aberration was found to be higher compared to the controls, with maximum values observed in those who had been additionally exposed to acute partial body irradiation. In order to get statistically significant differences over the controls, it is necessary, however, to calculate the frequency of the various aberrations in terms of a 'point system' rather than in per cent. (author)

  2. The fate of chromosomal aberrations in 137Cs-exposed individuals in the Goiania radiation accident

    International Nuclear Information System (INIS)

    Ramalho, A.T.; Nascimento, A.C.


    Following the Goiania radiation accident, lymphocytes from 110 exposed or potentially exposed individuals were analyzed for the frequencies of chromosomal aberrations (dicentrics and centric rings) to estimate absorbed radiation dose. Dose estimates for 21 subjects exceeded 1.0 Gy, and for eight subjects they exceeded 4.0 Gy. Four of the subjects died. After the emergency period, a cytogenetic follow-up of 10 of the highest exposed patients was started. The results suggest that the average disappearance half-time of lymphocytes containing dicentric and centric rings was 130 d, which is shorter than the usually accepted value of 3 y reported in the literature

  3. A synthetic medical and sociological study on twins exposed by atomic bomb, 8

    International Nuclear Information System (INIS)

    Satow, Yukio; Watanabe, Shoji; Kyo, Taiichi


    The relationship between immunoglobulin (IgG, IgA, IgM) levels and the exposure status was examined in 13 enzygotic twin pairs who had been exposed to atomic bomb under the same or different conditions and who had no disease showing changes in immunoglobulin levels. The difference in immunoglobulin levels tended to be smaller between the twins exposed under the same conditions and to be larger between the twins exposed under the different conditions. This should be further studied because there were some exceptions in this study. (Namekawa, K.)

  4. Sensitisation to common allergens and respiratory symptoms in endotoxin exposed workers: a pooled analysis

    NARCIS (Netherlands)

    Basinas, I.|info:eu-repo/dai/nl/313908206; Schlünssen, V.; Heederik, D.|info:eu-repo/dai/nl/072910542; Sigsgaard, T.; Smit, L.A.|info:eu-repo/dai/nl/311470882; Samadi, S.|info:eu-repo/dai/nl/304838551; Omland, O.; Hjort, C.; Madsen, A.M.; Skov, S.; Wouters, I.M.|info:eu-repo/dai/nl/274156652


    OBJECTIVE: To test the hypotheses that current endotoxin exposure is inversely associated with allergic sensitisation and positively associated with non-allergic respiratory diseases in four occupationally exposed populations using a standardised analytical approach. METHODS: Data were pooled from

  5. Pathophysiology and multifactorial etiology of acquired vasospastic disease (Raynaud syndrome) in vibration-exposed workers. (United States)

    Gemne, G


    The article reviews available pathophysiological evidence for a multifactorial etiology of the Raynaud type of peripheral circulation disorder in persons exposed to vibration from handheld tools and discusses the consequences this viewpoint may have for diagnostics, preventive work, and research.

  6. [The adaptive capacities of the cardiovascular system in miners exposed to vibration]. (United States)

    Konevskikh, L A; Oranskiĭ, I E; Makogon, I S


    Diagnostics criteria for work-related adaptation disorders in respect of cardiovascular system factors have been developed; the stages of disadaptation have been characterized through the example of vibration exposed miners working under the conditions of cool microclimate.

  7. Occurrence of zoonotic tuberculosis in occupationally exposed high-risk groups in Peshawar, Pakistan

    Directory of Open Access Journals (Sweden)

    Irfan Khattak


    Conclusion: Zoonotic TB is a significant public health issue among professionally exposed groups in Peshawar, Pakistan, and suggests a need for further detailed investigations of the disease in this and similar areas.


    People are continuously exposed exogenously to varying amounts of chemicals that have been shown to have carcinogenic properties in experimental systems. It has been estimated that exposure to environmental chemical carcinogens in the environment may contribute significantly to t...

  9. Dosimetry of paranasal sinus and mastoid epithelia in radium-exposed humans

    International Nuclear Information System (INIS)

    Schlenker, R.A.


    Dose calculations for 228 Ra and 226 Ra are presented for the sinus and mastoid epithelia and lead to the conclusion that the isotopes are of comparable dosimetric significance for the production of carcinomas in patients exposed to comparable levels

  10. Effects of lead on the visual system of occupationally exposed subjects

    Energy Technology Data Exchange (ETDEWEB)

    Cavalleri, A.; Trimarchi, F.; Gelmi, C.; Baruffini, A.; Minoia, C.; Biscaldi, G.; Gallo, G.


    A quantitative measurement of visual field in mesopic adaptation was performed for 35 workers occupationally exposed to lead and 35 referents matched for age, smoking, and alcohol consumption. The mean level (+/- SD) of lead in blood was 47 +/- 16 microgram/100 ml (2.25 +/- 0.77 mumol/l) (range 21-82 microgram/100 ml (1.01-3.94 mumol/l)). In 10 exposed subjects a central scotoma was found that was not evidenced in any of the referents. A highly significant decrease in visual sensitivity was observed for the exposed subjects a central scotoma was found that was not evidenced in any of the referents. A highly significant decrease in visual sensitivity was observed for the exposed subjects. The results point to damage of central and peripheral optic nerve fibers. In the most severe cases, central vision is preferentially affected, and therefore the results are suggestive of subclinical optic neuropathy.

  11. Drug and Alcohol Exposed Children: Implications for Special Education for Students Identified as Behaviorally Disordered. (United States)

    Bauer, Anne M.


    This article reviews the literature on children prenatally exposed to drugs and alcohol, the potential impact on the educational and social services systems, and implications for programing for children identified as behaviorally disordered. (Author/JDD)

  12. The extent of unwanted infrared photoacoustic signals from polymer sampling tubings exposed to ultraviolet radiation

    NARCIS (Netherlands)

    Bicanic, D.; Solyom, A.; Angeli, G.; Wegh, H.; Postumus, M.; Jalink, H.


    The extent of unwanted photoacoustic (PA) signals due to volatiles released from various polymer tubing materials [transparent, red and black polyethylene (PE), polymer of tetrafluorethylene (PTFE) and copolymer of tetrafluorethylene and hexafluorethylene (FEP)] when exposed to 245 nm radiation was

  13. Cerebrospinal fluid cells and proteins in patients occupationally exposed to organic solvents

    Energy Technology Data Exchange (ETDEWEB)

    Juntunen, J; Taskinen, E; Luisto, M; Iivanainen, M; Nurminen, M


    Cerebrospinal fluid (CSF) cells and proteins were determined for 33 patients exposed to industrial organic solvents. A lymphoid reaction, i.e., a pathologically elevated number or percentage of enlarged lymphoid cells was observed in one-third of the patients, more often in patients with chronic intoxication (40%) than in those currently exposed to organic solvents (32%). An almost significant decrease of small lymphocytes in the CSF was observed among patients who had a past history of chronic solvent intoxication but no recent exposure. No cytological evidence of tissue destruction was found. Signs of slight blood--CSF barrier damage occurred in 5 (23%) of the currently exposed patients, but intrathecal IgG synthesis was not observed. Increased cellular activity in the CSF was also accentuated in principal component analysis. The results suggest slight nonspecific immunoactivation in the central nervous system of subjects exposed to organic solvents.

  14. Exogenous ascorbic acid improves defence responses of sunflower (Helianthus annuus) exposed to multiple stresses. (United States)

    Kaya, Armagan


    Ascorbic acid is an important antioxidant that plays role both on growth and development and also stress response of the plant. The purpose of this study was to determine the effect of ascorbate on physiological and biochemical changes of sunflower that was exposed to multiple stresses. Chlorophyll and carotenoid contents decreased and glutathione, ascorbate and malondialdehyde contents as well as antioxidant enzyme activities increased for sunflower plant that was exposed to 50 mM NaCl and pendimethalin at different concentrations. These changes were found to be more significant in groups simultaneously exposed to both stress factors. While malondialdehyde content decreased, chlorophyll, carotenoid, ascorbate, glutathione contents and antioxidant enzyme activities increased in plants treated exogenously with ascorbate, compared to the untreated samples. According to the findings of our study; compared to individual stress, the effect of stress is more pronounced in sunflower exposed to multiple stresses, and treatment with exogenous ascorbate reduces the negative effects of stress.

  15. Transcription profiling of Drosophila exposed to a levitation magnet for different lengths of time (United States)

    National Aeronautics and Space Administration — Drosophila samples were exposed to the levitation magnet inside a 25mm diameter tubes with 3 ml of yeast-based Drosophila food in the bottom and a chamber of only 5...


    Background: Recent studies examining the inflammatory response in atopic asthma to ozone suggest a release of soluble mediators of inflammation factors that might be related to reactive oxygen species (ROS). Antioxidant could prove useful in subjects exposed to additional oxidati...

  17. A synthetic medical and sociological study of A-bomb exposed twin, 7

    International Nuclear Information System (INIS)

    Watanabe, Shoji; Satow, Yukio; Kyo, Taiichi


    The status of A-bomb exposure and family or relative relationship were investigated in seven twin pairs exposed to A-bomb (14 survivors). The survivors ranged in age between 4 and 24 years when they were exposed to A-bomb. Twins' relationship was comparatively strong. Both of the twins who were exposed to A-bomb tended to be closely connected with each other because of the fearful experience of A-bomb exposure and the subsequent hard social life. Even though one of the pair was not exposed to A-bomb, he (she) was likely to continue to help the other for a long time to restore from the disaster. (Namekawa, K.)

  18. 90 days bioassay in sprague-dawley rats exposed to 20KHz magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sung-Ho [College of Veterinary Medicine, Chonnam National Univ. Kwangju (Korea, Republic of); Song, Ji-Eun; Lee, Yun-Sil [Korea Cancer Center Hospital, Seoul (Korea, Republic of); Pack, Jeong-Ki [ETRI, Daejon (Korea, Republic of); Yoo, Done-SIk [College of Engineering, Daejon (Korea, Republic of)


    Sprague Dawley rats (20 rats/group [10 males, 10 females] in sham and magnetic field exposed groups) were exposed in carrousel irradiator to an 20 KHz magnetic field for 8 hrs/day, 5 days/week, for 90 days. Urine analysis (pH, SG, protein, ketone body, RBC, WBC, glucose, bilirubin, and urobilinogen), blood analysis (WBC, RBC, HGB; henoglubin concentration, HCT; hematocrit, MCV; mean corpuscular volume, MCH; mean corpuscular hemoglobin, MCHC; mean corpuscular hemoglobin concentration, and PLT; platelet or thrombocyte count), blood biochemistry (total protein, blood urea nitrogen, creatinine, glucose, total bilirubin, total cholesterol, aspartate aminotransferase, alanine aminotransferase, alkaline phosphatase, and lactate dehydrogenase), histopathological analysis for organs such as liver, kidney, testis, ovary, spleen, brain, heart, and lung were performed. When compared to the sham control rats, there were no significant differences in above analysis of magnetic field exposed rats. From the results, there were no significant differences between control and exposed fetus.

  19. Individual doses' register of occupationally exposed persons in the Republic of Moldova

    International Nuclear Information System (INIS)

    Hustuc, A.; Chiruta, Iu.


    The storage and processing of the data acquired through different monitoring techniques are of vital importance for controlling the individual doses of the occupationally exposed workers facilitating the determination of exposure pathway and furthering the policy of radiological protection. The use of the data bases for the evidence of the individual doses of the occupationally exposed workers to the ionizing radiation is useful in studies of risks and potential exposure, and in future epidemiological studies. (authors)

  20. Medical status of Marshallese accidentally exposed to 1954 Bravo fallout radiation: January 1988 through December 1991

    Energy Technology Data Exchange (ETDEWEB)

    Howard, J.E.; Heotis, P.M.; Scott, W.A.; Adams, W.H.


    The purpose of this report is to disseminate information concerning the medical status of 253 Marshallese exposed to fallout radiation in 1954. This report discusses the medical care provided and the medical findings for the years 1988-1991. Details of the BRAVO thermonuclear accident that caused the exposure have been published, and a 1955 article in the Journal of the American Medical Association describing the acute medical effects in the exposed population remains a definitive and relevant description of events. Participation in the Marshall Islands Medical Program by the exposed Marshallese is voluntary. In the spring and fall of each year, medical surveillance is provided to exposed and unexposed cohorts. Examinations performed include: a cancer-related examination as defined by the American Society, an annual thyroid examination and thyroid function testing, serum prolactin testing looking for pituitary tumors, annual blood counts to include platelets, and evaluation for paraneoplastic evidence of neoplasms. This report details the medical program, medical findings, and thyroid surgery findings. Deaths (4 exposed and 10 nonexposed) that occurred during the reporting period are discussed. There is a mild but relatively consistent depression of neutrophil, lymphocyte, and platelet concentrations in the blood of the exposed population. This depression appears to be of no clinical significance. Thyroid hypofunction, either clinical or biochemical, has been documented as a consequence of radiation exposure in 14 exposed individuals. Previously, one other exposed person was diagnosed with basal cell carcinoma. During this reporting period, a thyroid nodule was identified in an individual who was in utero during the exposure. Upon pathologic review, the nodule was diagnosed as occult papillary carcinoma.

  1. One-stage explant-implant procedure of exposed porous orbital implants

    DEFF Research Database (Denmark)

    Toft, Peter B; Rasmussen, Marie L Roed; Prause, Jan Ulrik


    Purpose:  To investigate the risks of implant exposure after a combined explant-implant procedure in patients with an exposed porous orbital implant. Methods:  Twenty-four consecutive patients who had a combined explant-implant procedure of an exposed hydroxyapatite (21) or porous polyethylene (3...... at the same procedure in sockets without profound signs of infection. The procedure carries a possible risk of poor motility....

  2. Exposed versus buried intramedullary implants for pediatric forearm fractures: a comparison of complications. (United States)

    Kelly, Brian A; Miller, Patricia; Shore, Benjamin J; Waters, Peter M; Bae, Donald S


    The purpose of this study was to compare the rate of complications between buried and exposed intramedullary implants after fixation of pediatric forearm fractures. A retrospective comparative cohort study of 339 children treated with intramedullary fixation for displaced forearm fractures between 2004 and 2009 was performed. Implants were left exposed in 128 patients (37.8%) and buried beneath the skin in 208 patients (61.4%); 3 patients had buried and exposed hardware (0.9%). Data on demographics, injury, surgical technique, and complications were analyzed. The buried implant group was older (mean 10.3 vs. 8.5 y; P exposed implant group. The buried group had their implants removed later than the exposed group (median 3.5 vs. 1.2 mo; P exposed implants were successfully removed in the office. Complications were seen in 56 patients (16.5%). There were 16 patients (4.7%) with refracture and 12 patients (3.5%) with infection. The buried and exposed implant groups did not differ significantly with respect to refracture (3.1% vs. 7.0%; P = 0.20), infection (3.5% vs. 2.3%; P = 0.66), or overall complications (14.5% vs. 17.2%; P = 0.87). There was also no difference between groups with respect to loss of reduction, nondelayed or delayed union, loss of motion, hypertrophic granuloma, or tendon rupture. Buried implants were also associated with penetration through the skin (3.9%). Injury to the dominant arm and need for open reduction were significant predictors of complication (OR = 1.01; 95% CI, 1.001-1.012; P = 0.02 and OR = 0.51; 95% CI, 0.264-0.974; P = 0.04, respectively). There were no significant differences seen in number of infections, refractures, or overall complications based on whether implants were left exposed or buried beneath the skin after surgery. Level III, therapeutic.

  3. Affect Expression and Self-Regulation Capacities of Infants Exposed In Utero to Psychotropics

    Directory of Open Access Journals (Sweden)

    Pratibha N Reebye


    Full Text Available This study explored the affect expression and self-regulation capacities of eight month old infants exposed in utero to psychotropic medications. This is a continuation of our previous study conducted on the same cohort when infants were three months old. Psychotropics implicated are antidepressant medications: selective serotonin reuptake inhibitors (SSRI, and a benzodiazepine derivative anxiolytic (clonazepam. The three comparison groups were: control (n=23 (infants gestationally non-exposed to psychotropics, SSRI-alone (n=22 (infants exposed to SSRIs only and having mothers who had a primary diagnosis of depressive disorder without having comorbid anxiety disorder, and SSRI+ group (n=15 (infants gestationally exposed to SSRIs and Clonazepam and having mothers that had both clinical depression and anxiety disorder. Thirty-seven participants from the initial cohort were recruited. Using the Parent Child Early Relational Assessment Scale (PCERA, infants were assessed in a dyadic context during free play and a structured task. There were clear significant differences in psychotropic exposed and non-exposed dyads regarding infant negative affect management. Notable findings were that the SSRI+ group mothers showed significant associations with only one infant affect: i.e. infant negative affect. This group of mothers also showed significant associations with infant’s averting and avoiding behaviors. These associations were seen in both free play and structured task situations signifying probable established pattern. SSRI-alone group was similar to control mothers and showed variable associations with infant’s positive, negative and sober moods unlike SSRI+ group. There were no differences in infants’ capacity for self–regulation in psychotropic exposed and non-exposed groups. Increased awareness of these vulnerable subgroups (SSRI-alone and SSRI+ is needed, in order to safeguard these dyads through better support systems and improved

  4. In vitro cell-mediated immunity studies of plutonium-exposed beagle dogs

    International Nuclear Information System (INIS)

    Morris, J.E.; Graham, T.; Park, J.F.


    Mitogen-induced activation was measured in spleen and mesenteric lymph node cell preparations from dogs exposed to a single inhalation exposure of plutonium oxide ( 238 Pu or 239 Pu). Reduced stimulation indices of splenic lymphocytes from exposed animals suggest that a reduction in lymphocyte function has occurred in this tissue. No apparent reduction in mitogen stimulation indices was observed in mesenteric lymph node cultures

  5. A Sink-driven Approach to Detecting Exposed Component Vulnerabilities in Android Apps


    Wu, Daoyuan; Luo, Xiapu; Chang, Rocky K. C.


    Android apps could expose their components for cooperating with other apps. This convenience, however, makes apps susceptible to the exposed component vulnerability (ECV), in which a dangerous API (commonly known as sink) inside its component can be triggered by other (malicious) apps. In the prior works, detecting these ECVs use a set of sinks pertaining to the ECVs under detection. In this paper, we argue that a more comprehensive and effective approach should start by a systematic selectio...

  6. Medical status of Marshallese accidentally exposed to 1954 Bravo fallout radiation: January 1988 through December 1991

    International Nuclear Information System (INIS)

    Howard, J.E.; Heotis, P.M.; Scott, W.A.; Adams, W.H.


    The purpose of this report is to disseminate information concerning the medical status of 253 Marshallese exposed to fallout radiation in 1954. This report discusses the medical care provided and the medical findings for the years 1988-1991. Details of the BRAVO thermonuclear accident that caused the exposure have been published, and a 1955 article in the Journal of the American Medical Association describing the acute medical effects in the exposed population remains a definitive and relevant description of events. Participation in the Marshall Islands Medical Program by the exposed Marshallese is voluntary. In the spring and fall of each year, medical surveillance is provided to exposed and unexposed cohorts. Examinations performed include: a cancer-related examination as defined by the American Society, an annual thyroid examination and thyroid function testing, serum prolactin testing looking for pituitary tumors, annual blood counts to include platelets, and evaluation for paraneoplastic evidence of neoplasms. This report details the medical program, medical findings, and thyroid surgery findings. Deaths (4 exposed and 10 nonexposed) that occurred during the reporting period are discussed. There is a mild but relatively consistent depression of neutrophil, lymphocyte, and platelet concentrations in the blood of the exposed population. This depression appears to be of no clinical significance. Thyroid hypofunction, either clinical or biochemical, has been documented as a consequence of radiation exposure in 14 exposed individuals. Previously, one other exposed person was diagnosed with basal cell carcinoma. During this reporting period, a thyroid nodule was identified in an individual who was in utero during the exposure. Upon pathologic review, the nodule was diagnosed as occult papillary carcinoma

  7. Environmental impact of heavy metals on the blood cells in professionally exposed workers


    Velickova, Nevenka


    Aims of the study is to explain and research the effects of the heavy metals (lead, zinc and cadmium) on erythrocytes and leukocytes in miners with different work experience or exposure. The results and conclusions are made based on a three-year period of continuous testing on 120 miners, as professionally exposed workers. We confirmed that the miners long been professionally exposed to heavy metals, in the blood have an increased content of heavy metals (lead, zinc and cadmium) and they ha...

  8. Study of behavior of concrete and cement based composite materials exposed to high temperatures


    Bodnárová, L.; Horák, D.; Válek, J.; Hela, R.; Sitek, L. (Libor)


    The paper describes possibilities of observation of behaviour of concrete and cement based composite material exposed to high temperatures. Nowadays, for large-scale tests of behaviour of concrete exposed to high temperatures, testing devices of certified fire testing stations in the Czech Republic and surrounding states are used. These tests are quite expensive. For experimental verification of smaller test specimens, a testing device was built at the Technical University in Brno, wher...

  9. Mitochondrial DNA damage and oxidative damage in HL-60 cells exposed to 900 MHz radiofrequency fields

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yulong; Zong, Lin; Gao, Zhen [School of Public Health, Soochow University, Suzhou, Jiangsu Province (China); Zhu, Shunxing [Laboratory Animal Center, Nantong University, Nantong, Jiangsu Province (China); Tong, Jian [School of Public Health, Soochow University, Suzhou, Jiangsu Province (China); Cao, Yi, E-mail: [School of Public Health, Soochow University, Suzhou, Jiangsu Province (China)


    Highlights: • Increased reactive oxygen species. • Decreased mitochondrial transcription Factor A and polymerase gamma. • Decreased mitochondrial transcripts (ND1 and 16S) and mtDNA copy number. • Increased 8-hydroxy-2′deoxyguanosine. • Decreased adenosine triphosphate. - Abstract: HL-60 cells, derived from human promyelocytic leukemia, were exposed to continuous wave 900 MHz radiofrequency fields (RF) at 120 μW/cm{sup 2} power intensity for 4 h/day for 5 consecutive days to examine whether such exposure is capable damaging the mitochondrial DNA (mtDNA) mediated through the production of reactive oxygen species (ROS). In addition, the effect of RF exposure was examined on 8-hydroxy-2′-dexoyguanosine (8-OHdG) which is a biomarker for oxidative damage and on the mitochondrial synthesis of adenosine triphosphate (ATP) which is the energy required for cellular functions. The results indicated a significant increase in ROS and significant decreases in mitochondrial transcription factor A, mtDNA polymerase gamma, mtDNA transcripts and mtDNA copy number in RF-exposed cells compared with those in sham-exposed control cells. In addition, there was a significant increase in 8-OHdG and a significant decrease in ATP in RF-exposed cells. The response in positive control cells exposed to gamma radiation (GR, which is also known to induce ROS) was similar to those in RF-exposed cells. Thus, the overall data indicated that RF exposure was capable of inducing mtDNA damage mediated through ROS pathway which also induced oxidative damage. Prior-treatment of RF- and GR-exposed the cells with melatonin, a well-known free radical scavenger, reversed the effects observed in RF-exposed cells.

  10. Durability of fibre reinforced concrete structures exposed to combined mechanical and environmental load

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan De Place; Hansen, Kurt Kielsgaard


    The main conclusions from a research project on durability of cracked fibre reinforced concrete structures exposed to chlorides, water or freeze-thaw are presented. The effect of fibres and cracks on the durability of concrete is studied.......The main conclusions from a research project on durability of cracked fibre reinforced concrete structures exposed to chlorides, water or freeze-thaw are presented. The effect of fibres and cracks on the durability of concrete is studied....

  11. Laboratory results of some biological measures in workers exposed to lead

    Energy Technology Data Exchange (ETDEWEB)

    Secchi, G.C.; Alessio, L.


    Erthrocyte ALA-dehydratase (ALAD) activity and blood lead values were studied in different groups of subjects not occupationally exposed to lead and compared with values for exposed workers. The results lead to the conclusion that measurement of ALAD activity is more useful in evaluating possible exposure of general population groups to minimal quantities of lead than in the surveillance of workers in the lead industries.

  12. Evidence for alteration of the membrane-bound ribosomes in Micrococcus luteus cells exposed to lead

    Energy Technology Data Exchange (ETDEWEB)

    Barrow, W; Himmel, M; Squire, P G; Tornabene, T G


    Micrococcus luteus cells exposed to Pb(NO/sub 3/)/sub 2/ contained cytosol ribosomal particles and disaggregated membranal ribosomal particles as determined by ultracentrifugation and spectral studies. Approximately 60% of the membrane ribosome fraction from lead exposed cells had a sedimentation value of 8.4S. Cytosol ribosome from lead exposed cells as well as membranal and cytosol ribosomes from control cells were comparable by their contents of predominantly the 70S type with the 50S and 100S present in relatively small amounts. The lead content of the 8.4S components was more than 200 times higher than the components with higher sedimentation coefficients from lead exposed cells and approximately 650 times more than that of control cell ribosomes. The cells exposed to lead, however, showed no adverse effects from the lead in respect to their growth rates and cellular yields. These results indicate that lead is interacting only at specific sites of the membrane and is inducing events initiated only in strategic cellular regions. These data further substantiate that subtle changes do occur in lead exposed cells that show no obvious effects. It is assumed that these minor alterations are, in toto, biologically significant. 24 references, 2 figures, 1 table.

  13. Increased lung function decline in blue-collar workers exposed to welding fumes. (United States)

    Thaon, Isabelle; Demange, Valérie; Herin, Fabrice; Touranchet, Annie; Paris, Christophe


    There is no consensus at the present time about the effect of welding on lung function decline. This study compared lung function decline between blue-collar workers exposed and not exposed to welding fumes in a French longitudinal cohort of 21,238 subjects aged 37 to 52 years at inclusion. Medical data, occupation, sector of activity, and spirometry were recorded twice by occupational physicians in 1990 and 1995. A job-exposure matrix was used to identify 503 male blue-collar workers exposed to welding fumes and 709 control subjects and to define the weekly duration of exposure to welding fumes. Baseline lung function parameters were higher in workers exposed to welding fumes than in control subjects. After a 5-year follow-up, welding-fume exposure was associated with a nonsignificant decline in FVC (P = .06) and FEV(1) (P = .07) after adjustment for age, pack-years, BMI, and baseline value of the parameter. A significant accelerated decline in FEV(1) (P = .046) was also observed in never smokers exposed to welding fumes. An “exposure-response” relationship was observed between FEV(1) decline and weekly duration of exposure to welding fumes in nonsmokers but not in smokers. Blue-collar workers exposed to welding fumes showed accelerated decline in lung function, which, in nonsmokers, was related to weekly duration of exposure.

  14. Preference for safflower oil in rats exposed to a cold environment under free-feeding conditions. (United States)

    Saitoh, Masaji; Ishii, Toshiaki; Takewaki, Tadashi; Nishimura, Masakazu


    There are several benefits to a high-fat diet for animals exposed to cold, including improved tolerance to severe cold conditions and increased survival rates in cold environments. It is therefore of interest to examine whether animals exposed to cold will selectively consume lipids. We examined the intake of safflower oil (SO) by rats exposed to cold (4 +/- 2 degrees C) under a feeding condition in which the rats were given free access to SO. Rats exposed to cold consumed more SO than those housed at 25 +/- 2 degrees C. This finding suggests that rats prefer SO in a cold environment. There was no significant difference in the ratio of calories of SO ingested to that of matter (standard laboratory chow plus SO) ingested between rats exposed to cold and those at 25 +/- 2 degrees C. The high SO intake also affected cold tolerance and metabolite kinetics in the rats. Factors that affected the SO intake of rats exposed to cold are also discussed.

  15. Life satisfaction and school performance of children exposed to classic and cyber peer bullying. (United States)

    Bilić, Vesna; Flander, Gordana Buljan; Rafajac, Branko


    This paper analyses the relationship between the exposure of school children to various forms of peer bullying (classic/cyber) and their life satisfaction in the domain of school, family, friends and school performance. The sample included 562 children from rural and urban areas of Croatia who were attending the seventh and the eighth grade of primary school. Results show that children were more often exposed to classic forms of peer bullying, especially verbal, and then physical bullying. On the other hand, cyber bullying most often comprises harassment in forums, blogs, chats or social networks, then on the web, by e-mail and mobile phone. Almost half of the examinees knew the identity of the bully, while a minority believes that bullies are the same ones who also physically abuse them at school. We found that children exposed to all forms of both classic and cyber bullying, unlike their peers who do not have such experience, show less satisfaction with friends, while those exposed to physical and cyber bullying show dissatisfaction with their family, too. However no statistically significant difference was found in their satisfaction with school. Children exposed to physical bullying showed poorer school performance, poorer achievement in Croatian and math, while children exposed to verbal and cyber bullying and children who were not exposed to such forms of bullying showed no differences in their school achievement.

  16. Developmental toxicity in flounder embryos exposed to crude oils derived from different geographical regions. (United States)

    Jung, Jee-Hyun; Lee, Eun-Hee; Choi, Kwang-Min; Yim, Un Hyuk; Ha, Sung Yong; An, Joon Geon; Kim, Moonkoo


    Crude oils from distinct geographical regions have distinct chemical compositions, and, as a result, their toxicity may be different. However, developmental toxicity of crude oils derived from different geographical regions has not been extensively characterized. In this study, flounder embryos were separately exposed to effluents contaminated by three crude oils including: Basrah Light (BLO), Pyrenees (PCO), and Sakhalin Vityaz (SVO), in addition to a processed fuel oil (MFO-380), to measure developmental toxicity and for gene expressions. Each oil possessed a distinct chemical composition. Edema defect was highest in embryos exposed to PCO and MFO-380 that both have a greater fraction of three-ring PAHs (33% and 22%, respectively) compared to BLO and SVO. Observed caudal fin defects were higher in embryos exposed to SVO and MFO-380, which are both dominated by naphthalenes (81% and 52%, respectively). CYP1A gene expressions were also highest in embryos exposed to SVO and MFO-380. Higher incidence of cardiotoxicity and lower nkx 2.5 expression were detected in embryos exposed to PCO. Unique gene expression profiles were observed in embryos exposed to crude oils with distinct compositions. This study demonstrates that crude oils of different geographical origins with different compositional characteristics induce developmental toxicity to different degrees. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Artificial stone dust-induced functional and inflammatory abnormalities in exposed workers monitored quantitatively by biometrics. (United States)

    Ophir, Noa; Shai, Amir Bar; Alkalay, Yifat; Israeli, Shani; Korenstein, Rafi; Kramer, Mordechai R; Fireman, Elizabeth


    The manufacture of kitchen and bath countertops in Israel is based mainly on artificial stone that contains 93% silica as natural quartz, and ∼3500 workers are involved in cutting and processing it. Artificial stone produces high concentrations of silica dust. Exposure to crystalline silica may cause silicosis, an irreversible lung disease. Our aim was to screen exposed workers by quantitative biometric monitoring of functional and inflammatory parameters. 68 exposed artificial stone workers were compared to 48 nonexposed individuals (controls). Exposed workers filled in questionnaires, and all participants underwent pulmonary function tests and induced sputum analyses. Silica was quantitated by a Niton XL3 X-ray fluorescence spectrometer. Pulmonary function test results of exposed workers were significantly lower and induced sputa showed significantly higher neutrophilic inflammation compared to controls; both processes were slowed down by the use of protective measures in the workplace. Particle size distribution in induced sputum samples of exposed workers was similar to that of artificial stone dust, which contained aluminium, zirconium and titanium in addition to silica. In conclusion, the quantitation of biometric parameters is useful for monitoring workers exposed to artificial stone in order to avoid deterioration over time.

  18. Dental health of young children prenatally exposed to buprenorphine. A concern of child neglect? (United States)

    Kivistö, K; Alapulli, H; Tupola, S; Alaluusua, S; Kivitie-Kallio, S


    To study the oral health and dental neglect of prenatally buprenorphine-exposed 3-year-old children. The study consisted of 51 children who as newborns tested positive for buprenorphine in a urine screen. The control group comprised 68 children previously unexposed to narcotics. The dentist examined the children and interviewed their guardians. Buprenorphine-exposed children exhibited significantly more early childhood caries than did the control group. Caries indices, the number of decayed, missing and filled teeth or tooth surfaces and decayed teeth were greater in the buprenorphine-exposed children than the control children (p = 0.004, p = 0.004, p = 0.001, respectively). In the buprenorphine group, more children showed visible plaque (p = 0.003) and fewer children were caries-free (p = 0.009) than in the control group. The control children's teeth were also brushed more often than the buprenorphine-exposed children's teeth (p = 0.001) and the parents were more involved in their children's tooth brushing than were those in the buprenorphine-exposed group (p = 0.035). More caries and dental neglect were found in buprenorphine-exposed children than in controls. These findings highlight the importance of routine dental appointments, caries screening and preventive care for children in substance-abusing families.

  19. Mechanical and Microstructural Evaluations of Lightweight Aggregate Geopolymer Concrete before and after Exposed to Elevated Temperatures. (United States)

    Abdulkareem, Omar A; Abdullah, Mohd Mustafa Al Bakri; Hussin, Kamarudin; Ismail, Khairul Nizar; Binhussain, Mohammed


    This paper presents the mechanical and microstructural characteristics of a lightweight aggregate geopolymer concrete (LWAGC) synthesized by the alkali-activation of a fly ash source (FA) before and after being exposed to elevated temperatures, ranging from 100 to 800 °C. The results show that the LWAGC unexposed to the elevated temperatures possesses a good strength-to-weight ratio compared with other LWAGCs available in the published literature. The unexposed LWAGC also shows an excellent strength development versus aging times, up to 365 days. For the exposed LWAGC to the elevated temperatures of 100 to 800 °C, the results illustrate that the concretes gain compressive strength after being exposed to elevated temperatures of 100, 200 and 300 °C. Afterward, the strength of the LWAGC started to deteriorate and decrease after being exposed to elevated temperatures of 400 °C, and up to 800 °C. Based on the mechanical strength results of the exposed LWAGCs to elevated temperatures of 100 °C to 800 °C, the relationship between the exposure temperature and the obtained residual compressive strength is statistically analyzed and achieved. In addition, the microstructure investigation of the unexposed LWAGC shows a good bonding between aggregate and mortar at the interface transition zone (ITZ). However, this bonding is subjected to deterioration as the LWAGC is exposed to elevated temperatures of 400, 600 and 800 °C by increasing the microcrack content and swelling of the unreacted silicates.

  20. Effect of lead exposure on the immune response of some occupationally exposed individuals

    International Nuclear Information System (INIS)

    Mishra, Kamla Prasad; Singh, Vijay Kumar; Rani, Reena; Yadav, Virendra Singh; Chandran, Vinod; Srivastava, Satya Prakash; Seth, Prahlad Kishore


    Lead is a ubiquitous pollutant in the industrial environment, which poses serious threats to human health. In the past 20 years increasing attention has been paid to the effects of lead exposure on health. This toxic metal alters the immune response of animals as well as humans. To study the immunological effects of occupational exposure to lead, we examined lymphocyte proliferation, natural killer (NK) cell cytotoxicity and interferon-γ production with peripheral blood mononuclear cells (PBMCs) of individuals occupationally exposed to lead. We selected three different groups of individuals exposed to lead: three-wheeler drivers (30), battery workers (34) and silver jewelery makers (20); and unexposed healthy volunteers (30) as control for comparison. Our results indicate that though lymphocyte proliferation to phytohaemagglutinin (PHA) is inhibited in lead exposed individuals as compared with unexposed volunteers, there is no correlation between inhibition of lymphocyte proliferation and blood lead level. NK cell cytotoxicity remains unaffected in individuals exposed to lead as compared with controls. On the other hand, we observed that interferon-γ (IFN-γ) was significantly elevated in T cell mitogen, PHA, stimulated PBMCs culture supernatant of lead exposed individuals. We found significant positive correlation between blood lead levels and IFN-γ produced in culture supernatant on stimulation with PHA. In brief, this study demonstrates that lead can affect the immune response of the occupationally exposed individuals such as three-wheeler drivers, battery reconditioning workers and silver jewelery makers

  1. Intracellular free calcium concentration and calcium transport in human erythrocytes of lead-exposed workers

    International Nuclear Information System (INIS)

    Quintanar-Escorza, M.A.; Gonzalez-Martinez, M.T.; Navarro, L.; Maldonado, M.; Arevalo, B.; Calderon-Salinas, J.V.


    Erythrocytes are the route of lead distribution to organs and tissues. The effect of lead on calcium homeostasis in human erythrocytes and other excitable cells is not known. In the present work we studied the effect of lead intoxication on the uptake and efflux (measured as (Ca 2+ -Mg 2+ )-ATPase activity) of calcium were studied in erythrocytes obtained from lead-exposed workers. Blood samples were taken from 15 workers exposed to lead (blood lead concentration 74.4 ± 21.9 μg/dl) and 15 non-exposed workers (9.9 ± 2 μg/dl). In erythrocytes of lead-exposed workers, the intracellular free calcium was 79 ± 13 nM, a significantly higher concentration (ANOVA, P 2+ -Mg 2+ )-ATPase activity. Lipid peroxidation was 1.7-fold higher in erythrocytes of lead-exposed workers as compared with control. The alteration on calcium equilibrium in erythrocytes is discussed in light of the toxicological effects in lead-exposed workers

  2. [Cognitive impairments in persons exposed to radiation during the period of prenatal development]. (United States)

    Burtovaya, E Yu; Kantina, T E; Belova, M V; Akleyev, A V


    To assess the cognitive status in persons exposed to ionizing radiation in prenatal period. The study included in-utero exposed people (n = 77), and the comparison group (n = 73), which consisted of people who lived in the territories of the Chelyabinsk Oblast that were not radioactive. The following methods were used: clinical, clinical-psychological (Mini-Mental State Examination (MMSE), the WAIS test, the proverb interpretation task, neurophysiological (EEG) methods, laboratory-based methods (cholesterol, high and low-density lipoproteins, triglycerides, cortisol, melatonin), and methods of statistical data processing. The number of people with non-psychotic mental disorders with the prevalence of organic mental disorders (cognitive and asthenic) was significantly higher among in-utero exposed subjects. A neurophysiological study revealed more severe changes in the bioelectric brain activity with the presence of pathological and theta-rhythms in exposed persons. The clinical-psychological study revealed a significant decrease in the analytic/synthetic ability in exposed people and significantly lower level of the general and verbal IQ. These changes were accompanied by higher levels of cortisol and melatonin which led to the activation and tension of the adaptation mechanisms in in-utero exposed subjects.

  3. EXPOSE-E: an ESA astrobiology mission 1.5 years in space. (United States)

    Rabbow, Elke; Rettberg, Petra; Barczyk, Simon; Bohmeier, Maria; Parpart, André; Panitz, Corinna; Horneck, Gerda; von Heise-Rotenburg, Ralf; Hoppenbrouwers, Tom; Willnecker, Rainer; Baglioni, Pietro; Demets, René; Dettmann, Jan; Reitz, Guenther


    The multi-user facility EXPOSE-E was designed by the European Space Agency to enable astrobiology research in space (low-Earth orbit). On 7 February 2008, EXPOSE-E was carried to the International Space Station (ISS) on the European Technology Exposure Facility (EuTEF) platform in the cargo bay of Space Shuttle STS-122 Atlantis. The facility was installed at the starboard cone of the Columbus module by extravehicular activity, where it remained in space for 1.5 years. EXPOSE-E was returned to Earth with STS-128 Discovery on 12 September 2009 for subsequent sample analysis. EXPOSE-E provided accommodation in three exposure trays for a variety of astrobiological test samples that were exposed to selected space conditions: either to space vacuum, solar electromagnetic radiation at >110 nm and cosmic radiation (trays 1 and 3) or to simulated martian surface conditions (tray 2). Data on UV radiation, cosmic radiation, and temperature were measured every 10 s and downlinked by telemetry. A parallel mission ground reference (MGR) experiment was performed on ground with a parallel set of hardware and samples under simulated space conditions. EXPOSE-E performed a successful 1.5-year mission in space.

  4. [Croatian and international regulations on the protection and rights of workers exposed to asbestos at work]. (United States)

    Zavalić, Marija; Macan, Jelena


    New regulations on the protection and rights of workers occupationally exposed to asbestos were introduced in Croatia in 2007 and 2008. They have been harmonised with the European Union (EU) and International Labour Organization (ILO) regulations, and make a step forward in safety at work, health protection, social rights, and pension schemes for Croatian workers occupationally exposed to asbestos. The 2007 Croatian regulation on the protection of workers from the risks related to exposure to asbestos at work defines and describes activities in which workers can be occupationally exposed to asbestos, defines the threshold value of asbestos in the air at work, defines valid methods for measurement of asbestos concentrations in the air, and establishes measures to reduce asbestos exposure at work or protect the exposed workers. Croatian law regulating obligatory health surveillance of workers occupationally exposed to asbestos from year 2007 defines activities and competent authorities to implement health surveillance of workers occupationally exposed to asbestos and to diagnose occupational diseases related to asbestos. This law also defines "occupational exposure to asbestos", and "occupational asbestos-related diseases", including asbestosis (pulmonary asbestos-related fibrosis), pleural asbestos-related disorders (plaques, pleural thickening, and benign effusion), lung and bronchial cancer, and malignant mesothelioma of serous membranes. These regulations have been harmonised with ILO, Directive 2003/18/EC amending Council Directive 83/477/EEC on the protection of workers from the risks related to exposure to asbestos at work, and with the Commission Recommendation 2003/670/EC concerning the European schedule of occupational diseases. The 2008 Croatian regulation on conditions of health surveillance, diagnostic procedures and criteria for confirmation of occupational asbestos-related diseases "defines the terms and the content of medical examination of workers

  5. Factors protecting against the development of adjustment difficulties in young adults exposed to childhood sexual abuse. (United States)

    Lynskey, M T; Fergusson, D M


    The aims of this study were to identify the factors which discriminated young people exposed to childhood sexual abuse (CSA) who developed psychiatric disorder or adjustment difficulties in young adulthood from those young people exposed to CSA who did not develop psychiatric disorder or adjustment difficulties by age 18. Data were gathered on a birth cohort of 1,025 New Zealand children studied from birth to the age of 18 on (a) exposure to CSA; (b) patterns of psychiatric disorder and adjustment difficulties at age 18 years; (c) factors that may have influenced responses to CSA including characteristics of the abuse, parental bonding, parental characteristics, and adolescent peer affiliations. Just over 10% of the cohort reported CSA. Those reporting CSA were at increased risks of a range of difficulties at age 18 (depression, anxiety, conduct disorder, alcohol abuse/dependence, other substance abuse/dependence, post sexual abuse trauma, attempted suicide). However, not all of those exposed to CSA developed difficulties and approximately a quarter of those exposed to CSA did not meet criteria for any adjustment difficulty. Further analysis suggested that the extent of adjustment difficulties in those exposed to CSA was influenced by two additional factors: (a) the extent of affiliations with delinquent or substance using peers in adolescence; and (b) the extent of paternal care or support in childhood. The findings of this study suggest that while young people exposed to CSA are at increased risks of psychiatric disorder and adjustment difficulties in young adulthood, not all individuals exposed to CSA will develop adjustment difficulties. Important factors protecting against the development of adjustment difficulties in young people experiencing CSA appear to be the nature and quality of peer and family relationships.

  6. Attention bias in earthquake-exposed survivors: an event-related potential study. (United States)

    Zhang, Yan; Kong, Fanchang; Han, Li; Najam Ul Hasan, Abbasi; Chen, Hong


    The Chinese Wenchuan earthquake, which happened on the 28th of May in 2008, may leave deep invisible scars in individuals. China has a large number of children and adolescents, who tend to be most vulnerable because they are in an early stage of human development and possible post-traumatic psychological distress may have a life-long consequence. Trauma survivors without post-traumatic stress disorder (PTSD) have received little attention in previous studies, especially in event-related potential (ERP) studies. We compared the attention bias to threat stimuli between the earthquake-exposed group and the control group in a masked version of the dot probe task. The target probe presented at the same space location consistent with earthquake-related words was the congruent trial, while in the space location of neutral words was the incongruent trial. Thirteen earthquake-exposed middle school students without PTSD and 13 matched controls were included in this investigation. The earthquake-exposed group showed significantly faster RTs to congruent trials than to incongruent trials. The earthquake-exposed group produced significantly shorter C1 and P1 latencies and larger C1, P1 and P2 amplitudes than the control group. In particular, enhanced P1 amplitude to threat stimuli was observed in the earthquake-exposed group. These findings are in agreement with the prediction that earthquake-exposed survivors have an attention bias to threat stimuli. The traumatic event had a much greater effect on earthquake-exposed survivors even if they showed no PTSD symptoms than individuals in the controls. These results will provide neurobiological evidences for effective intervention and prevention to post-traumatic mental problems. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Hospital morphine preparation for abstinence syndrome in newborns exposed to buprenorphine or methadone. (United States)

    Colombini, Nathalie; Elias, Riad; Busuttil, Muriel; Dubuc, Myriam; Einaudi, Marie-Ange; Bues-Charbit, Martine


    This study was undertaken to evaluate the adequacy of a hospital formulated oral morphine preparation for management of neonatal abstinence syndrome (NAS) and to compare clinical features in infants exposed to methadone or buprenorphine in utero. Between October 1998 and October 2004 all infants born to mothers treated with buprenorphine or methadone during pregnancy were enrolled into this prospective study. Morphine hydrochloride solution (0.2 mg/ml) was prepared without preservatives under a flow laminar air box (class 100). Morphine solution: quantitative and qualitative HPLC analysis and microbiological study at regular intervals during storage at 4 degrees C for 6 months. Maternal characteristics: age, opiate dose during pregnancy. Neonatal characteristics: gestational age at delivery, birth weight, Lipsitz scores. Morphine dose: daily morphine dose, maximum morphine dose, duration of NAS, and duration of treatment required to achieve stable Lipsitz scores below 4. Kruskal-Wallis test for comparison of median values. Microbiological and HPLC analysis showed that the morphine preparation remained stable for 6 months at 4 degrees C. Nine methadone-exposed infants and 13 buprenorphine-exposed infants were included in the study. All infants presented NAS requiring treatment with the morphine solution. Lipsitz scores at birth were significantly different in the methadone and buprenorphine groups (P methadone group required significantly higher doses of morphine preparation than the buprenorphine group during the first 38 days of treatment (P methadone-exposed infants (range 6-24 h) and within 48 h after birth in buprenorphine-exposed infants (range 24-168 h). Due to the possibility of delayed onset of NAS up to 7 days, infants born to mothers treated with buprenorphine should be kept in the hospital for an appropriate surveillance period. Treatment time was significantly longer (45 vs. 28 days) and the mean morphine doses were higher (1.7 fold) in methadone-exposed

  8. Cytogenetic Follow-up Study of Population Occupationally Exposed to Nonionizing Radiation

    International Nuclear Information System (INIS)

    Garaj-Vrhovac, V.; Kasuba, V.; Vojvodic, S.


    The aim of this investigation was to analyse the results of a four year follow- up study of chromosome aberrations in a population occupationally exposed to microwave radiation. The study included a group of 30 healthy volunteers - radar technicians occupationally exposed to microwave radiation and a group of 30 healthy controls from the general population. The average duration of employment of the exposed subjects was 16 years. The chromosome aberrations assay was carried out on 48 h culture of lymphocytes. Microwave power density was measured with Raham model 4A (General Microwave Corporation, Farmingdale, NY) at different workplaces. The measurements of electromagnetic field power density distribution at different workplaces show that during an ordinary workday the examinees stay in zones with power density below 5 mW/cm 2 with a frequency range of 1250-1350 MHz. The chromosomal type of aberrations in the exposed group during the 4-year follow up study was predominantly higher than in the control group. The total percentage of chromosome aberrations for the exposed group in the first year of the study was 2.36%, in the second 1.43%, in the third 2.88%, and in the fourth year 2.60%, while for the control group was 1.39%. In every year of investigation in exposed group manifested dicentric chromosomes, while in last two years ring chromosome also detected. Mutagenic changes in the somatic cells detected in exposed subjects pointed to the fact that these cellular damages can be related to continuous occupational exposure to microwave radiation. (author)

  9. Differential pattern of deposition of nanoparticles in the airways of exposed workers

    Energy Technology Data Exchange (ETDEWEB)

    Fireman, Elizabeth, E-mail: [Tel Aviv University, Laboratory of Pulmonary and Allergic Diseases (Israel); Edelheit, Rinat [Tel Aviv University, Department of Occupational and Environmental Health School of Public Health, Sackler Faculty of Medicine (Israel); Stark, Moshe [Tel Aviv University, Laboratory of Pulmonary and Allergic Diseases (Israel); Shai, Amir Bar [Tel Aviv University, Pulmonology Department, Tel-Aviv Sourasky Medical Center affiliated to the Sackler Faculty of Medicine (Israel)


    Ultrafine particles (UFP) have been postulated to significantly contribute to the adverse health effects associated with exposure to particulate matter (PM). Due to their extremely small size (aerodynamic diameter <100 nm), UFP are able to deposit deep within the lung after inhalation and evade many mechanisms responsible for the clearance of larger particles. There is a lack of biologically relevant personal exposure metrics for exposure to occupational- and environmental-related micro- and nano-sized PM. The aim of the present study is to assess UFP in induced sputum (IS) and exhaled breath condensate (EBC) as possible biomarkers for assessing lung function impairment. Sputum induction and EBC testing were performed by conventional methods. UFP particles were assessed with the NanoSight LM20 (NanoSight Ltd, London, UK). The subjects included 35 exposed and 25 non-exposed workers. There were no group differences in pulmonary function test results and differential cell counts, but 63.6% of the exposed subjects had a higher percentage of neutrophils (OR3.28 p = 0.03) compared to the non-exposed subjects. The exposed subjects had higher percentages of UFP between 10 and 50 nm (69.45 ± 18.70 vs 60.11 ± 17.52 for the non-exposed group, p = 0.004). No differences were found in the IS samples. Years of exposure correlated positively to UFP content (r = 0.342 p = 0.01) and macrophage content (r = −0.327 p = 0.03). The percentage of small fraction of UFP in EBC, but not IS, is higher in exposed workers, and EBC may be a sensitive biomarker to assess exposure to nanoparticles.

  10. Induction of adaptive response in human blood lymphocytes exposed to radiofrequency radiation. (United States)

    Sannino, Anna; Sarti, Maurizio; Reddy, Siddharth B; Prihoda, Thomas J; Vijayalaxmi; Scarfì, Maria Rosaria


    The incidence of micronuclei was evaluated to assess the induction of an adaptive response to non-ionizing radiofrequency (RF) radiation in peripheral blood lymphocytes collected from five different human volunteers. After stimulation with phytohemagglutinin for 24 h, the cells were exposed to an adaptive dose of 900 MHz RF radiation used for mobile communications (at a peak specific absorption rate of 10 W/kg) for 20 h and then challenged with a single genotoxic dose of mitomycin C (100 ng/ml) at 48 h. Lymphocytes were collected at 72 h to examine the frequency of micronuclei in cytokinesis-blocked binucleated cells. Cells collected from four donors exhibited the induction of adaptive response (i.e., responders). Lymphocytes that were pre-exposed to 900 MHz RF radiation had a significantly decreased incidence of micronuclei induced by the challenge dose of mitomycin C compared to those that were not pre-exposed to 900 MHz RF radiation. These preliminary results suggested that the adaptive response can be induced in cells exposed to non-ionizing radiation. A similar phenomenon has been reported in cells as well as in animals exposed to ionizing radiation in several earlier studies. However, induction of adaptive response was not observed in the remaining donor (i.e., non-responder). The incidence of micronuclei induced by the challenge dose of mitomycin C was not significantly different between the cells that were pre-exposed and unexposed to 900 MHz RF radiation. Thus the overall data indicated the existence of heterogeneity in the induction of an adaptive response between individuals exposed to RF radiation and showed that the less time-consuming micronucleus assay can be used to determine whether an individual is a responder or non-responder.

  11. Magnetic resonance imaging used for the evaluation of water presence in wood plastic composite boards exposed to exterior conditions (United States)

    Marek Gnatowski; Rebecca Ibach; Mathew Leung; Grace Sun


    Two wood plastic composite (WPC) boards, one experimental and one commercial, were exposed to exterior conditions and evaluated non-destructively using a clinical magnetic resonance imaging (MRI) unit for moisture content (MC) and distribution. The experimental board was exposed in Vancouver, British Columbia, for more than 8 years, and the commercial board was exposed...

  12. 'Blueberry' Exposed (United States)


    This mosaic of five images taken by the microscopic imager on the Mars Exploration Rover Opportunity on sol 87 shows the hole drilled by the rover's rock abrasion tool into the rock dubbed 'Pilbara.' A sliced 'blueberry,' or spherule, which is darker and harder than the rest of the rock, can be seen near the center of the hole. The rock abrasion process left a pile of rock powder around the side of the hole, and to a lesser degree, inside the hole. The hole is 7.2 millimeters (about 0.28 inches) deep and 4.5 centimeters (about 1.8 inches) in diameter. Because the original images of this hole had areas of bright sunlight as well as shadow, the images making up this mosaic have been arranged to hide as much of the sunlit area as possible. The white spot is one area that could not be covered by other images. It is possible to stretch the image so that features in this white spot are visible, but this makes the rest of the mosaic harder to view. The bright streaks on the bottom part of the hole are most likely reflections from various parts of the robotic arm. The geometric and brightness seams have been corrected in this image.

  13. Exposing diversity

    DEFF Research Database (Denmark)

    Jakobsen, Helle Nordentoft; Nørtoft, Kamilla Pernille Johansen

    on the findings from a pilot project in which we combine approaches from different areas of the visual research field, more specifically visual ethnography and professional development studies. We show two 5 minutes long video narratives to three interdisciplinary focus groups in a nursing home setting...... with elements from literary theory in which the video narratives can be looked on as textual structures with gaps. The meeting between the text and the reader/viewer and how these gaps are filled depends on the reader’s personal and professional competences and preferences in the sense making process....... The findings show that the participants interpret the video narratives very differently and that the negotiation of meaning in filling the gaps initiates collaborative learning....

  14. Blood Pressure of Jordanian Workers Chronically Exposed to Noise in Industrial Plants

    Directory of Open Access Journals (Sweden)

    Saed Nserat


    Full Text Available Background: Occupational studies investigating the association between blood pressure and noise exposure are almost lacking in the Eastern Mediterranean Region countries. Objective: To determine the association between occupational exposure to high level of noise and blood pressure among a group of workers in Jordan. Methods: All workers who had been exposing to noise for at least 3 years in 3 plants in Madaba governorate in Jordan were included in this cross-sectional study. A structured questionnaire was used to collect data. The occupational noise level was measured with a portable calibrated sound meter. Results: We studied 191 male workers, of whom 145 (75.9% were exposed to a noise level higher than the permissible limit of 85 dBA. The mean systolic blood pressure (SBP and diastolic blood pressure (DBP and the prevalence of hypertension were significantly higher among those exposed to higher noise level. In multivariate analysis, workers exposed to high level of noise had a significantly higher odds of hypertension compared to those exposed to noise level lower than the permissible limit (OR 4.7, 95% CI 1.6 to 13.8. The odds of hypertension increased by 17% (95% CI 10% to 30% for each dB increase in noise intensity. Conclusion: Exposure to high level of noise is associated with elevated blood pressure.

  15. Metabolic signature of sun exposed skin suggests catabolic pathway overweighs anabolic pathway.

    Directory of Open Access Journals (Sweden)

    Manpreet Randhawa

    Full Text Available Skin chronically exposed to sun results in phenotypic changes referred as photoaging. This aspect of aging has been studied extensively through genomic and proteomic tools. Metabolites, the end product are generated as a result of biochemical reactions are often studied as a culmination of complex interplay of gene and protein expression. In this study, we focused exclusively on the metabolome to study effects from sun-exposed and sun-protected skin sites from 25 human subjects. We generated a highly accurate metabolomic signature for the skin that is exposed to sun. Biochemical pathway analysis from this data set showed that sun-exposed skin resides under high oxidative stress and the chains of reactions to produce these metabolites are inclined toward catabolism rather than anabolism. These catabolic activities persuade the skin cells to generate metabolites through the salvage pathway instead of de novo synthesis pathways. Metabolomic profile suggests catabolic pathways and reactive oxygen species operate in a feed forward fashion to alter the biology of sun exposed skin.

  16. Metabolism of tritium uptake due to handling of metal surfaces exposed to tritiated hydrogen gas

    International Nuclear Information System (INIS)

    Johnson, J.R.; Peterman, B.F.


    Hairless rats were exposed to tritium by rubbing HT contaminated stainless steel planchets on them. The pattern of tritium excretion in the urine (n=4), shows the OBT (organically bound tritium) retention curve to be approximated by the sum of 2 exponential curves, one with a half-life of 0.4 days and another with a half-life of 1.4 days. The retention of HTO fit a single exponential curve with a half-life of 3.1 days. Exposed skin, unexposed skin, liver, muscle and blood (n=6) were assayed for HBO, and free HTO. Highest activity was found in the exposed skin, other organs with high activity are the unexposed skin and liver. Examination of the exposed skin showed HTO to be concentrated in the uppermost layers. The distribution of OBT was similar but was incorporated at a faster rate. The basal layer is exposed to a tritium concentration between 70-90% of that of the surface. The two macromolecule fractions with the highest amount of radioactivity were lipid and insoluble protein (mainly collagen)

  17. Visual selective attention is impaired in children prenatally exposed to opioid agonist medication. (United States)

    Konijnenberg, Carolien; Melinder, Annika


    To examine whether prenatal exposure to opioid agonist medication is associated with visual selective attention and general attention problems in early childhood. Twenty-two children (mean age = 52.17 months, SD = 1.81) prenatally exposed to methadone, 9 children (mean age = 52.41 months, SD = 1.42) prenatally exposed to buprenorphine and 25 nonexposed comparison children (mean age = 51.44 months, SD = 1.31) were tested. Visual selective attention was measured with a Tobii 1750 Eye Tracker using a spatial negative priming paradigm. Attention problems were measured using the Child Behavior Checklist. The comparison group demonstrated a larger spatial negative priming effect (mean = 23.50, SD = 45.50) than the exposed group [mean = -6.84, SD = 86.39, F(1,50) = 5.91, p = 0.019, η(2) = 0.11]. No difference in reported attention problems was found [F(1,51) = 1.63, p = 0.21, η(2) = 0.03]. Neonatal abstinence syndrome and prenatal exposure to marijuana were found to predict slower saccade latencies in the exposed group (b = 54.55, SE = 23.56, p = 0.03 and b = 88.86, SE = 32.07, p = 0.01, respectively). Although exposed children did not appear to have attention deficits in daily life, lower performance on the SNP task indicates subtle alteration in the attention system. © 2014 S. Karger AG, Basel.

  18. Medical status of Marshallese accidentally exposed to 1954 Bravo fallout radiation: January 1980-December 1982

    International Nuclear Information System (INIS)

    Adams, W.H.; Harper, J.A.; Rittmaster, R.S.; Heotis, P.M.; Scott, W.A.


    This report updates, for 1980 through 1982, the results of continuing medical surveillance of a Marshallese population accidentally exposed to radioactive fallout in March 1954. The originally exposed Marshallese population comprised 64 persons on Rongelap Atoll who each received, on the average, an estimated 190 rads of absorbed external gamma radiation, 18 on Ailingnae Atoll who received 110 rads, and 159 on Utirik who received 11 rads. There were, in addition, 3 persons in utero on Rongelap, 1 person in utero on Ailingnae, and 8 persons in utero on Utirik who are considered exposed. The recipients of primary medical care include exposed and comparison populations as well as a rather large number of additional beneficiaries who are seen on a humanitarian basis of practical need and resource availability. In recent years, about 1400 people have been seen annually. This report, however, deals with four clearly defined groups: the remaining individuals who were exposed to radioactive fallout on Rongelap, Ailingnae, and Utirik in 1954 (including those in utero), and a comparison population of individuals from Rongelap who were unexposed. The number of persons now in each exposure category are 51, 12, 116, and 137, respectively. 100 references, 4 figures, 5 tables

  19. Comparing genotoxic signatures in cord blood cells from neonates exposed in utero to zidovudine or tenofovir. (United States)

    Vivanti, Alexandre; Soheili, Tayebeh S; Cuccuini, Wendy; Luce, Sonia; Mandelbrot, Laurent; Lechenadec, Jerome; Cordier, Anne-Gael; Azria, Elie; Soulier, Jean; Cavazzana, Marina; Blanche, Stéphane; André-Schmutz, Isabelle


    Zidovudine and tenofovir are the two main nucleos(t)ide analogs used to prevent mother-to-child transmission of HIV. In vitro, both drugs bind to and integrate into human DNA and inhibit telomerase. The objective of the present study was to assess the genotoxic effects of either zidovudine or tenofovir-based combination therapies on cord blood cells in newborns exposed in utero. We compared the aneuploid rate and the gene expression profiles in cord blood samples from newborns exposed either to zidovudine or tenofovir-based combination therapies during pregnancy and from unexposed controls (n = 8, 9, and 8, respectively). The aneuploidy rate was measured on the cord blood T-cell karyotype. Gene expression profiles of cord blood T cells and hematopoietic stem and progenitor cells were determined with microarrays, analyzed in a gene set enrichment analysis and confirmed by real-time quantitative PCRs. Aneuploidy was more frequent in the zidovudine-exposed group (26.3%) than in the tenofovir-exposed group (14.2%) or in controls (13.3%; P < 0.05 for both). The transcription of genes involved in DNA repair, telomere maintenance, nucleotide metabolism, DNA/RNA synthesis, and the cell cycle was deregulated in samples from both the zidovudine and the tenofovir-exposed groups. Although tenofovir has a lower clastogenic impact than zidovudine, gene expression profiling showed that both drugs alter the transcription of DNA repair and telomere maintenance genes.

  20. Changes in some Hematological Parameters and Thyroid Hormones in Rats Exposed to Pulsed Electromagnetic Field

    International Nuclear Information System (INIS)

    EL-Abiad, N.M.; Marzook, E.A.; EI-Aragi, G.M.


    In the present study pulsed electromagnetic spectrum was used to evaluate the effect of exposure on some biochemical and hematological parameters in male albino rats. Three groups of rats (10 each) were exposed to 10, 15, 20 pulses of electromagnetic spectrum 3 times per week for 3 weeks, the unexposed group was considered as the control group. At the end of experiment, serum levels of thyroid hormones triiodothryronine and thyroxine (T 3 ,T 4 ) and some hematological parameters were estimated. The hematological studies revealed that exposure to electromagnetic spectrum induced significant reduction in red blood cell count(RBC),and also in hemoglobin concentration(Hb), while reticulocytic count(Ret.) was elevated in the three exposed groups, platelets count was increased only on the second exposed group, while leukocytic count (WBC's), mean corpuscular volume (MCV), mean corpuscular hemoglobin (MGH), mean corpuscular hemoglobin concentration (MCHC) were not affected, lymphocytic count was decreased only on the second exposed group, the impairment of thyroid functions was noticed by elevation of T 3 and T 4 in the three exposed groups

  1. Evaluation of Dynamic Disulphide/Thiol Homeostasis in Silica Exposed Workers

    Directory of Open Access Journals (Sweden)

    Meşide Gündüzöz


    Full Text Available Background: Oxidative stress is implicated as one of the main molecular mechanism underlying silicosis. Aims: In this study, our aim was to asses the redox status in occupationally silica-exposed workers, by evaluating the dynamic thiol-disulphide homeostasis. Study Design: Case-control study. Methods: Thirty-six male workers occupationally exposed to silica particles and 30 healthy volunteers, working as office workers were included to the study. Posteroanterior chest radiographs and pulmonary function tests of both groups were evaluated. Also serum thiol disulphide levels were measured using the spectrophotometric method described by Erel and Neşelioğlu. Results: Among the 36 workers that underwent pulmonary function tests 6 (17% had obstructive, 7 (19% had restrictive, 6 (17% had obstructive and restrictive signs whereas 17 (47% had no signs. The mean PFTs results of silica-exposed workers were significantly lower than control subjects. The serum disulphide levels of silica-exposed workers were significantly higher than control subjects (23.84±5.89 μmol/L and 21.18±3.44 μmol/L, respectively p=0.02. Conclusion: The serum disulphide levels, a biomarker of oxidative stress, are found to be higher in silica-exposed workers

  2. Medical status of Marshallese accidentally exposed to 1954 Bravo fallout radiation: January 1980-December 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adams, W.H.; Harper, J.A.; Rittmaster, R.S.; Heotis, P.M.; Scott, W.A.


    This report updates, for 1980 through 1982, the results of continuing medical surveillance of a Marshallese population accidentally exposed to radioactive fallout in March 1954. The originally exposed Marshallese population comprised 64 persons on Rongelap Atoll who each received, on the average, an estimated 190 rads of absorbed external gamma radiation, 18 on Ailingnae Atoll who received 110 rads, and 159 on Utirik who received 11 rads. There were, in addition, 3 persons in utero on Rongelap, 1 person in utero on Ailingnae, and 8 persons in utero on Utirik who are considered exposed. The recipients of primary medical care include exposed and comparison populations as well as a rather large number of additional beneficiaries who are seen on a humanitarian basis of practical need and resource availability. In recent years, about 1400 people have been seen annually. This report, however, deals with four clearly defined groups: the remaining individuals who were exposed to radioactive fallout on Rongelap, Ailingnae, and Utirik in 1954 (including those in utero), and a comparison population of individuals from Rongelap who were unexposed. The number of persons now in each exposure category are 51, 12, 116, and 137, respectively. 100 references, 4 figures, 5 tables. (ACR)

  3. Inventory of MRI applications and workers exposed to MRI-related electromagnetic fields in the Netherlands

    Energy Technology Data Exchange (ETDEWEB)

    Schaap, Kristel; Christopher-De Vries, Yvette; Slottje, Pauline; Kromhout, Hans, E-mail:


    Objective: This study aims to characterise and quantify the population that is occupationally exposed to electromagnetic fields (EMF) from magnetic resonance imaging (MRI) devices and to identify factors that determine the probability and type of exposure. Materials and methods: A questionnaire survey was used to collect information about scanners, procedures, historical developments and employees working with or near MRI scanners in clinical and research MRI departments in the Netherlands. Results: Data were obtained from 145 MRI departments. A rapid increase in the use of MRI and field strength of the scanners was observed and quantified. The strongest magnets were employed by academic hospitals and research departments. Approximately 7000 individuals were reported to be working inside an MRI scanner room and were thus considered to have high probability of occupational exposure to static magnetic fields (SMF). Fifty-four per cent was exposed to SMF at least one day per month. The largest occupationally exposed group were radiographers (n ∼ 1700). Nine per cent of the 7000 involved workers were regularly present inside a scanner room during image acquisition, when exposure to additional types of EMF is considered a possibility. This practice was most prevalent among workers involved in scanning animals. Conclusion: The data illustrate recent trends and historical developments in magnetic resonance imaging and provide an extensive characterisation of the occupationally exposed population. A considerable number of workers are potentially exposed to MRI-related EMF. Type and frequency of potential exposure depend on the job performed, as well as the type of workplace.

  4. Liver function in patients exposed to a toluene in a hydrocarbon processing plant

    International Nuclear Information System (INIS)

    Sanchez, E; Fernandez D'Pool, J.


    Since the hepatotoxic role of toluene in exposed workers from the petroleum and petrochemical industries chronically exposed to low concentration has no been entirely dilucidated, this transversal study was undertaken in order to clarify the situation in the local industries. A group of 33 non-exposed men workers of such industries (group control, aged 33.0 +/- 4.88 years) were compared with 33 toluene-exposed men (aged 35.0 +/- 9.33 years) from the related industries, with a minimal of 6 months exposition time to toluene and without liver disease history. In addition to a complete occupational diseases medical history, each subject was tested by both a venous blood sample (to determine prothrombin, total and fractioned bilirubin, total and fractioned proteins, liver enzymes and cholesterol) and urine sample (hippuric acid). Also the environmental concentration of toluene in working areas was determined by gas chromatography, which was below the recommended standard levels in working areas. Although the analyzed parameters were in the normal range, it was observed that those workers with known alcohol ingestion and toluene exposition had several abnormalities. The results of this study confirm that toluene may have a synergistic hepatotoxic effect in toluene-exposed workers that are alcohol consumers. The alcohol in considered as a confounding factor and it is not possible to rule out in the etiology of hepatic changes detected in the study

  5. Fracture behaviour of the 14Cr ODS steel exposed to helium and liquid lead (United States)

    Hojna, Anna; Di Gabriele, Fosca; Hadraba, Hynek; Husak, Roman; Kubena, Ivo; Rozumova, Lucia; Bublikova, Petra; Kalivodova, Jana; Matejicek, Jiri


    This work describes the fracture behaviour of the 14Cr ODS steel produced by mechanical alloying process, after high temperature exposures. Small specimens were exposed to helium gas in a furnace at 720 °C for 500 h. Another set of specimens was exposed to flowing liquid lead in the COLONRI II loop at 650 °C for 1000 h. All specimens were tested for the impact and tensile behaviour. The impact test results are compared to other sets of specimens in the as received state and after isothermal annealing at 650 °C for 1000 h. The impact curves of the exposed materials showed positive shifts on the transition temperature. While the upper shelf value did not change in the Pb exposed ODS steel, it significantly increased in the He exposed one. The differences are discussed in terms of surface and subsurface microscopy observation. The embrittlement can be explained as the effect of a slight change in the grain boundary and size distribution combined with the depletion of sub-surface region from alloying elements forming oxide scale on the surface.

  6. Histomorphometric Evaluation of the Small Coronary Arteries in Rats Exposed to Industrial Noise

    Directory of Open Access Journals (Sweden)

    Ana Lousinha


    Full Text Available Morphological changes induced by industrial noise (IN have been experimentally observed in several organs. Histological observations of the coronary arteries showed prominent perivascular tissue and fibrosis among IN-exposed rats. The effects on the small arteries are unknown. Objective: To evaluate the histomorphometric changes induced by IN on rat heart small arteries. Methods: Twenty Wistar rats exposed to IN during a maximum period of seven months and 20 age-matched controls were studied. Hearts were transversely sectioned from ventricular apex to atria and a mid-ventricular fragment was selected for analysis. The histological images were obtained with an optical microscope using 400× magnifications. A total of 634 arterial vessels (298 IN-exposed and 336 controls were selected. The mean lumen-to-vessel wall (L/W and mean vessel wall-to-perivascular tissue (W/P ratios were calculated using image J software. Results: There were no differences between exposed and control animals in their L/W ratios (p = 0.687 and time variations in this ratio were non-significant (p = 0.110. In contrast, exposed animals showed lower W/P ratios than control animals (p < 0.001, with significant time variations (p = 0.004. Conclusions: Industrial noise induced an increase in the perivascular tissue of rat small coronary arteries, with significant development of periarterial fibrosis.

  7. Mercury-induced motor and sensory neurotoxicity: systematic review of workers currently exposed to mercury vapor. (United States)

    Fields, Cheryl A; Borak, Jonathan; Louis, Elan D


    The neurotoxicity of elemental mercury (Hg 0 ) is well-recognized, but it is uncertain whether and for how long neurotoxicity persists; among studies that evaluated previously exposed workers, only one examined workers during and also years after exposure ceased. The aim of this review is to document the type, frequency, and dose-relatedness of objective neurological effects in currently exposed mercury workers and thereby provide first approximations of the effects one would have expected in previously exposed workers evaluated during exposure. We systematically reviewed studies of neurotoxicity in currently exposed mercury workers identified by searching MEDLINE (1950-2015), government reports, textbook chapters, and references cited therein; dental cohorts were not included. Outcomes on physical examination (PE), neurobehavioral (NB) tests, and electrophysiological studies were extracted and evaluated for consistency and dose-relatedness. Forty-five eligible studies were identified, comprising over 3000 workers chronically exposed to a range of Hg 0 concentrations (0.002-1.7 mg/m 3 ). Effects that demonstrated consistency across studies and increased frequency across urine mercury levels (200 μg/L, while NB testing is more appropriate for those with lower U Hg levels. They also provide benchmarks to which findings in workers with historical exposure can be compared.

  8. Cochlear condition and olivocochlear system of gas station attendants exposed to organic solvents

    Directory of Open Access Journals (Sweden)

    Tochetto, Tania Maria


    Full Text Available Introduction: Organic solvents have been increasingly studied due to its ototoxic action. Objective: Evaluate the conditions of outer hair cells and olivocochlear system in individuals exposed to organic solvents. Method: This is a prospective study. 78 gas station attendants exposed to organic solvents had been evaluated from three gas stations from Santa Maria city, Rio Grande do Sul (RS. After applying the inclusion criteria, the sample was constituted by 24 individuals. The procedures used on the evaluation were audiological anamnesis, Transient otoacoustic emissions (TEOAES and research for the suppressive effect of TEOAES. A group control (GC compounded by 23 individuals was compared to individuals exposed and non-exposed individuals. The data collection has been done in the room of Speech Therapy of Workers Health Reference Center of Santa Maria. Results: The TEOAES presence was major in the left ear in both groups; the average relation of TEOAES signal/noise in both ears was greater in GE; the TEOAES suppressive effect in the right ear was higher in the individual of GE (62,5% and in the left ear was superior in GC (86,96%, with statistically significant difference. The median sign/noise ratio of TEOAES, according to the frequency range, it was higher in GC in three frequencies ranges in the right ear and one in the left ear. Conclusion: It was not found signs of alteration on the outer hair cells neither on the olivocochlear medial system in the individuals exposed to organic solvents.

  9. B-cell infiltration in the respiratory mucosa of turkeys exposed to subtype C avian metapneumovirus. (United States)

    Cha, Ra Mi; Khatri, Mahesh; Sharma, Jagdev M


    Turkeys exposed to avian metapneumovirus (aMPV) subtype C showed extensive lymphoid cell infiltrations in the nasal turbinates of the upper respiratory tract. The cellular infiltration occurred after the first virus exposure but not after re-exposure. Quantitation of the relative proportions of mucosal immunoglobulin (Ig)A+, IgG+, and IgM+ cells in controls and virus-exposed turkeys revealed that at 7 days after the first virus exposure, when mucosal infiltration was well pronounced, there was a significant increase (P < 0.05) in the numbers of infiltrating IgA+ but not of IgG+ and IgM+ cells. After the second virus exposure, although the overall numbers of mucosal lymphoid cells were similar in the virus-exposed and control turkeys, the relative proportions of IgA+ and IgG+ cells were significantly higher in the virus-exposed turkeys (P < 0.05) than in controls. Furthermore, elevated levels of aMPV-specific IgA were detected in the nasal secretions and the bile of virus-exposed birds after the second but not after the first virus exposure. These results suggest, for the first time, the possible involvement of local mucosal immunoglobulins in the pathogenesis of aMPV in turkeys.

  10. Cytogenetic monitoring of hospital workers exposed to low-level ionizing radiation

    International Nuclear Information System (INIS)

    Bigatti, P.; Lamberti, L.; Ardito, G.; Armellino, F.


    In the present study the cytogenetic effects in hospital workers exposed to low-level radiation were evaluated. Samples of peripheral blood were collected from 63 subjects working in radiodiagnostics and from 30 subjects, working in the same hospitals, who were used as controls. A higher number of cells with chromosome-type aberrations (CA) was observed in the exposed workers vs. the controls and the difference was statistically significant (p<0.05). No correlation was, on the contrary, found between CA and years of exposure. A significant difference was observed in the incidence of cells with CA between smokers and non-smokers, but in the control group only. In contrast, in the workers exposed to ionizing radiation, the frequency of cells with CA was very similar in smokers and non-smokers. 13 refs.; 4 tabs

  11. Contamination of persons occupationally exposed to natural radioactivity in a coal fired power plant

    International Nuclear Information System (INIS)

    Bauman, A.; Horvat, D.


    Contamination of occupationally exposed subjects with natural radioactivity in a coal fired power plant at levels of 500 mrem/year was detected. The level of 210 Pb in urine varied from 2.29-14.47 pCi/l. These values were arrived at after subtracting a blank value of 1.05 pCi 210 Pb obtained from a control group. Structural chromosomal aberrations, completely missing in the control group, were detected in the exposed subjects. Approximately 6-10% of the metaphases of occupationally exposed subjects were found to have aberrations which were probably radiation induced. These included symmetrical and asymmetrical exchanges and numerical aberrations. In the control aroup aberrations were found in 1.4-4% of the metaphases, but these were only deletions. (H.K.)

  12. Earth's youngest exposed granite and its tectonic implications: the 10-0.8 Ma Kurobegawa Granite. (United States)

    Ito, Hisatoshi; Yamada, Ryuji; Tamura, Akihiro; Arai, Shoji; Horie, Kenji; Hokada, Tomokazu


    Although the quest for Earth's oldest rock is of great importance, identifying the youngest exposed pluton on Earth is also of interest. A pluton is a body of intrusive igneous rock that crystallized from slowly cooling magma at depths of several kilometers beneath the surface of the Earth. Therefore, the youngest exposed pluton represents the most recent tectonic uplift and highest exhumation. The youngest exposed pluton reported to date is the Takidani Granodiorite (~ 1.4 Ma) in the Hida Mountain Range of central Japan. Using LA-ICP-MS and SHRIMP U-Pb zircon dating methods, this study demonstrates that the Kurobegawa Granite, also situated in the Hida Mountain Range, is as young as ~ 0.8 Ma. In addition, data indicate multiple intrusion episodes in this pluton since 10 Ma with a ~ 2-million-year period of quiescence; hence, a future intrusion event is likely within 1 million years.

  13. Monitoring of genotoxic effects in lymphocytes of people exposed to pesticides

    International Nuclear Information System (INIS)

    Panek, A.; Marcos, R.; Cebulska-Wasilewska, A.


    The aim of this study was to assess the potential genotoxic risk of occupational exposure to pesticides. The DNA damage and the repair capacities of lymphocytes, in four groups of the people of various countries were assessed by the use of single cell gel electrophoresis (SCGE) also known as the Comet assay. The results from the analysis performed in the Spanish group are presented in this paper. Statistical analysis of the results shows a slightly higher level of the DNA damage in the untreated lymphocytes of donors from the group exposed to pesticides; however, only for donors below 30 years old are these differences significant (p<0.05). Although, comparison of the efficiency of the UV-C induced dimmers excision process did not indicate differences between exposed and referent groups, though lymphocytes for donors exposed to pesticides have shown a statistically lower repair rate (p<0.01) than lymphocytes from the unexposed group. (author)

  14. Temperature thresholds for surface blistering of platinum and stainless steel exposed to curium-242 alpha radiations

    International Nuclear Information System (INIS)

    McDonell, W.R.; Dillich, S.


    Implantation of helium in materials exposed to alpha-emitting radionuclides such as 242 Cm causes surface blistering at elevated temperatures. The temperature thresholds for such blistering are of practical importance to the selection of suitable container materials for radionuclides, and are of fundamental interest with regard to the mechanisms of helium blistering of materials in radiation environments. The purpose of this investigation was to establish temperature thresholds for surface blistering of platinum and stainless-steel container materials by post-irradiation heating of specimens exposed at room temperature to alpha particles from an external 242 Cm source. These thresholds were compared with (1) the analogous temperature thresholds for surface blistering of materials exposed to external beams of accelerator helium ions, and (2) thresholds for swelling and grain-boundary cracking of materials in which helium is generated internally by (n,α) reactions during reactor exposures

  15. Composite Materials With Uncured Epoxy Matrix Exposed in Stratosphere During NASA Stratospheric Balloon Flight (United States)

    Kondyurin, Alexey; Kondyurina, Irina; Bilek, Marcela; de Groh, Kim K.


    A cassette of uncured composite materials with epoxy resin matrixes was exposed in the stratosphere (40 km altitude) over three days. Temperature variations of -76 to 32.5C and pressure up to 2.1 torr were recorded during flight. An analysis of the chemical structure of the composites showed, that the polymer matrix exposed in the stratosphere becomes crosslinked, while the ground control materials react by way of polymerization reaction of epoxy groups. The space irradiations are considered to be responsible for crosslinking of the uncured polymers exposed in the stratosphere. The composites were cured on Earth after landing. Analysis of the cured composites showed that the polymer matrix remains active under stratospheric conditions. The results can be used for predicting curing processes of polymer composites in a free space environment during an orbital space flight.

  16. Health status of grandchildren of subjects occupationally exposed to chronic radiation. Communication 4. Congenital developmental defects

    International Nuclear Information System (INIS)

    Petrushkina, N.P.; Musatkova, O.B.


    The purpose of this study was to analyze the incidence and structure of cogenital developmental defects in the grandchildren of subjects occupationally exposed to chronic external gamma-irradiation. For 830 children only grandfather was exposed, for 259 only grandmother, and for 468 grandfather and grandmother. The mean equivalent doses for gonads by the moment of conception of future parents of the cohort examined ranged from 17.3 to 145.3 sSv. The incidence and structure of congenital developmental defects in 1557 grandchildren of occupationally exposed subjects differed from that in controls. Multifactorial analysis failed to establish the effect of grandparents' and parents' exposure on the development of diseases in the progeny. Factors other than radiation proved to be significant. 13 refs.; 1 tab

  17. Natural history of disease in atomic bomb exposed twins in Hiroshima

    International Nuclear Information System (INIS)

    Satow, Yukio; Ohmae, Kiyokazu; Okamoto, Naomasa; Abe, Tsutomu; Watanabe, Shoji


    The subjects of this study are mainly pairs of monozygotic twins, one of whom was exposed to the atomic bomb and the other not exposed, and the natural history of the diseases of these twins was analyzed to find out genetic and environmental factors of the diseases and some biological effect of the atomic bomb exposure or other. In this study, 13 pairs of monozygotic and 5 pairs of dizygotic twins and other 34 cases of non-twins were examined by means of heart and lung X-ray films and electrocardiograms. The results suggest that most of the monozygotic twins show the similar findings of chest X-ray films, though their electrocardiograms have a tendency to deviate to the left in the QRS axis. These findings will not be enough to clear up the relation between the atomic bomb exposed and the abnormal electrocardiograms. (author)

  18. Response of solvent-exposed printers and unexposed controls to six-hour toluene exposure

    DEFF Research Database (Denmark)

    Bælum, Jesper; Andersen, I B; Lundqvist, G R


    of intoxication, and irritation of the eyes, nose and throat. Furthermore, the subjects exposed to toluene showed decreased manual dexterity, decreased color discrimination, and decreased accuracy in visual perception. There was no significant difference in the effects of toluene on printers compared to those......The acute effects of toluene were studied in 43 male printers and 43 control subjects matched according to sex, age, educational level, and smoking habits. The mean age of the subjects was 36 (range 29-50) years. The printers had been exposed to solvents for 9 to 25 years during employment at flexo...... and rotogravure printing plants, while the controls had no history of solvent exposure. Each subject was exposed once in a climate chamber to either 100 ppm of toluene or clean air for 6.5 h preceded by a 1-h acclimatization period. The effects of toluene were measured from subjective votes with linear analogue...

  19. Epidemiological study of recent death risk of Nagasaki A-bomb survivors exposed at close range

    International Nuclear Information System (INIS)

    Ishii, Keiichiro; Mine, Mariko; Okumura, Yutaka.


    To elucidate the hormetic effect on health of human exposed with very low-dose ionizing radiation, we preliminary investigate the epidemiological study of Nagasaki A-bomb survivors. The major results are as follows; (1) Nagasaki A-bomb survivors exposed with 2-18 cGy are investigated, and the epidemiological data-base of Nagasaki A-bomb survivors are updated by these new data. (2) An applicability of the expanded new data-base to epidemiological analysis is investigated. Based on this investigation, the theme of epidemiological study to elucidate the hormetic effect on human health are discussed. (3) Effects of A-bomb dose on risk of total death cause, cancer death and non-cancer death are analysed by epidemiological method. The relative frequency of non-cancer death cause on male survivors exposed with 50-99 cGy is decreased relative to unexposed controls. (author)

  20. Development Enamel Defects in Children Prenatally Exposed to Anti-Epileptic Drugs

    DEFF Research Database (Denmark)

    Jacobsen, Pernille Endrup; Henriksen, Tine Brink; Haubek, Dorte


    Objective Some anti-epileptic drugs (AED) have well-known teratogenic effects. The aim of the present study was to elucidate the effect of prenatal exposure to AED and the risk of enamel defects in the primary and permanent dentition. Methods A total of 38 exposed and 129 non-exposed children, 6......–10 years of age, were recruited from the Aarhus Birth Cohort and the Department of Neurology, Viborg Regional Hospital, Denmark. Medication during pregnancy was confirmed by the Danish Prescription Database. All children had their teeth examined and outcomes in terms of enamel opacities and enamel...... hypoplasia were recorded. Results Children prenatally exposed to AED have an increased prevalence of enamel hypoplasia (11% vs. 4%, odds ratio (OR) = 3.6 [95% confidence interval (CI): 0.9 to 15.4]), diffuse opacities (18% vs. 7%, OR = 3.0; [95% CI: 1.0 to 8.7, p3) white opacities (18...

  1. Disruption of male reproductive behavior in threespine stickleback asterosteus aculeatus exposed to 17β-estradiol

    International Nuclear Information System (INIS)

    Wibe, Asa Espmark; Rosenqvist, Gunilla; Jenssen, Bjoern Munro


    In past years we have witnessed decreased reproductive capacity in many wildlife species due to exposure to chemicals with endocrine-disrupting properties. In this laboratory experiment male three spine sticklebacks asterosteus aculeatus exposed to 17β-estradiol (2.0 μg/g) dispersed in peanut oil, on days 1, 7, 14, and 21, showed impaired paternal care compared to control fish that were exposed to peanut oil only. There were no differences between the two groups in number of males that built nests or in courtship displays. However, exposed males started nest building significantly later than control males. This study suggests that some but not all essential traits of male reproductive behavior may be altered as a result of exposure to 17β-estradiol. To reveal harmful effects of chemicals with suggested reproductive-disrupting properties it is thus important to take a wide variety of variables related to reproductive behavior into consideration

  2. Germline mutations in people descendants occupationally exposed to ionizing radiation from Cesium 137

    International Nuclear Information System (INIS)

    Silva, Juliana Ferreira da


    The radiological accident in Goiania in 1987, resulted in a serious episode of human contamination, animal, plant and environmental were exposed to Cesium 137 chloride ( 137 CsCl) that caused contamination and accidental and occupational exposure to ionizing radiation. Ionizing radiation is one of the environmental components that causes most cellular stress in complex organisms. Exposure to ionizing radiation induces breaks in nucleic acids, especially, DNA double and single strand breaks. Chromosomal microarray analysis is an important tool for the detection and microdeletion and microduplications in the genomes. In this study we proposed to analyze the effect of exposure to RI on the formation of CNVs in an exposed human population occupationally to ionizing radiation from Cesium 137 during the accident in Goiania. The exposed group consisted of 07 families, of which at least one parent was occupationally exposed to ionizing radiation from Cesium 137, including a total of 25 individuals, do not know the absorbed dose of the military who were occupationally exposed to ionizing radiation. 11 families with a group of individuals not exposed to IR was used as control were used including a total of 33 individuals with no history of exposure to RI. The genotyping microarray was conducted in CytoScan HD system (Affymetrix®) without then analyzes was performed in ChAS® software. The statistical tests used were: Shapiro-Wilk, Mann- Whitney U, Spearman correlation, discriminant function analysis, binomial test, χ 2 test. All analyzes were performed using the statistical package SPSS 21.0, with a significance level of 5% (p <0.05). The frequency of CNVs were estimated loss / generation, gain / generation and burden / generation, representing 3,9 x 10 -5 , 6,8 x 10 -6 and 4,6 x 10 -5 respectively for the exposed group. For the control group, the frequencies were 2,1 x 10 -5 , 5,9 x 10 -6 and 3,1 x 10 -5 respectively. Thus, the frequency of CNVs showed statistically

  3. Histomorphological patterns in osseous rests exposed at fire; Patrones histomorfologicos en restos oseos expuestos al fuego

    Energy Technology Data Exchange (ETDEWEB)

    Medina, C.; Tiesler, V. [Facultad de Ciencias Antropologicas, UADY, 97000 Merida, Yucatan (Mexico); Oliva, A.I.; Quintana, P. [CINVESTAV, IPN Unidad Merida, Depto. Fisica Aplicada, 97310 Merida (Mexico)


    Histomorphology as part of morphological research studies bony structure on the tissue level. Its methods are applied in this investigation to evaluate histomorphological impact patterns in heat-exposed bony material, particularly color changes, fissure patterns, volumetric reduction, and changes in the size of Haversian canals. These variables were evaluated in exposed thin sections of porcine long bones, obtained during two experimental series. The first one was conducted under stable thermal conditions in a furnace by measuring heat impact in stepped time (I to S hours) and temperature intervals (200 to 800 C). During a second experimental phase, bony samples were exposed to direct fire in defined time and heat intervals. The treated specimens were then sectioned and microscopically scrutinized. The results presented here were designed to offer new analytical, measurable standards in the investigation of forms of heat exposition of the human body, applicable in forensics and the study of ancient Maya posthumous body treatments. (Author)

  4. Diagnostic tests in Raynaud's phenomena in workers exposed to vibration: a comparative study

    DEFF Research Database (Denmark)

    Olsen, N


    Four objective tests to evaluate Raynaud's phenomena (RP) in workers exposed to handarm vibrations were applied on 23 exposed men with RP (vibration induced white finger 18, primary Raynaud's phenomenon 5), 56 exposed men without RP, and 15 male controls. Finger systolic blood pressure was measured...... greater than 0.20). The results indicate that a finger colour test may be as valuable as a FSP(0) test for diagnostic purposes. FSP(A) only indicates if a cold response is exaggerated and does not diagnose RP. The pressure measurements may further be of guidance in evaluating preventive measures...... by a cuff and strain gauge technique after combined body cooling and finger cooling during five minute ischaemia to 30 degrees, 15 degrees, and 6 degrees C. An attack of RP was detected as a zero pressure, FSP(0) test, whereas a pressure, reduced to a value below the normal 95% confidence limit at 6 degrees...

  5. Atomic friction at exposed and buried graphite step edges: Experiments and simulations

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Zhijiang; Martini, Ashlie, E-mail: [School of Engineering, University of California Merced, 5200 N. Lake Road, Merced, California 95343 (United States)


    The surfaces of layered materials such as graphite exhibit step edges that affect friction. Step edges can be exposed, where the step occurs at the outmost layer, or buried, where the step is underneath another layer of material. Here, we study friction at exposed and buried step edges on graphite using an atomic force microscope (AFM) and complementary molecular dynamics simulations of the AFM tip apex. Exposed and buried steps exhibit distinct friction behavior, and the friction on either step is affected by the direction of sliding, i.e., moving up or down the step, and the bluntness of the tip. These trends are analyzing in terms of the trajectory of the AFM tip as it moves over the step, which is a convolution of the topography of the surface and the tip shape.

  6. Atomic friction at exposed and buried graphite step edges: Experiments and simulations

    International Nuclear Information System (INIS)

    Ye, Zhijiang; Martini, Ashlie


    The surfaces of layered materials such as graphite exhibit step edges that affect friction. Step edges can be exposed, where the step occurs at the outmost layer, or buried, where the step is underneath another layer of material. Here, we study friction at exposed and buried step edges on graphite using an atomic force microscope (AFM) and complementary molecular dynamics simulations of the AFM tip apex. Exposed and buried steps exhibit distinct friction behavior, and the friction on either step is affected by the direction of sliding, i.e., moving up or down the step, and the bluntness of the tip. These trends are analyzing in terms of the trajectory of the AFM tip as it moves over the step, which is a convolution of the topography of the surface and the tip shape

  7. High chromosomal instability in workers occupationally exposed to solvents and paint removers. (United States)

    Villalba-Campos, Mónica; Chuaire-Noack, Lilian; Sánchez-Corredor, Magda Carolina; Rondón-Lagos, Milena


    Painters are exposed to an extensive variety of harmful substances like aromatic hydrocarbons used as solvents and paint removers, some of which have shown clastogenic activity. These substances constitute a complex mixture of chemicals which contain well-known genotoxicants, such as Benzene, Toluene and Xylene. Thus, chronic occupational exposure to such substances may be considered to possess genotoxic risk. In Colombia the information available around the genotoxic damage (Chromosomal and DNA damage) in car paint shop workers is limited and the knowledge of this damage could contribute not only to a better understanding of the carcinogenic effect of this kind of substances but also could be used as biomarkers of occupational exposure to genotoxic agents. In this study, the genotoxic effect of aromatic hydrocarbons was assessed in peripheral blood lymphocytes of 24 workers occupationally exposed and 24 unexposed donors, by using Cytogenetic analysis and comet assay. A high frequency of Chromosomal alterations was found in the exposed group in comparison with those observed in the unexposed group. Among the total of CAs observed in the exposed group, fragilities were most frequently found (100 %), followed by chromosomal breaks (58 %), structural (41.2 %) and numerical chromosomal alterations (21 %). Numerical chromosomal alterations, fragilities and chromosomal breaks showed significant differences between exposed and unexposed groups. Among the fragilities, fra(9)(q12) was the most frequently observed. DNA damage index was also significantly higher in the exposed group compared to the unexposed group (p car paint shops workers and are also indicative of high chromosomal instability. The high frequency of both Chromosomal Alterations and DNA Damage Index observed in this study indicates an urgent need of intervention not only to prevent the increased risk of developing cancer but also to the application of strict health control and motivation to the use of

  8. Late and latent effects of atomic bomb on chromosomes in the exposed population

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, R; Kamada, N [Hiroshima Univ. (Japan). Research Inst. for Nuclear Medicine and Biology


    Cytogenetic changes of exposed individuals, and the diseases and cytogenetic changes of the F/sub 1/ were discussed. The subjects exposed within 0.5 km. from the hypocenter revealed chromosomal aberration of the bone marrow in 83 per cent and those within 0.5 to 1.0 km. from the hypocenter revealed it in 47 per cent. The aberration was mostly the stable type, and was frequent in deletion, balanced-type translocation, unbalanced-type translocation, and inversion, in the order named. The number of abnormal clone varied with year. The chromosomes of the lymphocytes in the peripheral blood also showed high rate of stable type aberration, and the chromosomes were also aberrant in the fibroblasts of the keloid lesion. However, there were no abnormalities in the spermatogonium. Thirty seven subjects of F/sub 1/ group included 13 subjects whose father had been exposed, 19 subjects whose mother had been exposed, and 5 subjects whose both parents had been exposed. The diseases seen in the F/sub 1/ subjects were hematonosis in 28 subjects, autoimmune diseases in 5 subjects, and hypertension and lymphadenitis in 4 cases. Acute myelogenic leukemia (AML) showed normal chromosomes in all the 3 cases, the acute lymphatic leukemia (ALL), showed abnormal clones in 2 of 3 cases. Chronic myelogenic leukemia (CML) revealed abnormal chromosomes in all the 3 cases. The cytogenetic changes of abnormal clone in the F/sub 1/ of non-exposed were 60 per cent in AML, 57 per cent, in ALL and 100 per cent in CML.

  9. Monitoring the genetic health of persons in Goiania accidentally exposed to ionizing radiation from caesium-137

    International Nuclear Information System (INIS)

    Da Cruz, A.D.; Glickman, B.W.


    This work describes the long term genetic monitoring of the Goiania population exposed to ionizing radiation from 137 Cs, using cytogenetic and molecular endpoints. Cytogenetically, micronucleus frequencies differentiated groups exposed to different levels of radiation. Two molecular methods were employed: 1) the hprt clonal assay, involving in vitro selection of 6-thioguanine-resistant hprt mutant clones which were characterized at the molecular level using RT-PCR and genomic analysis. Ionizing radiation exposure initially elevated hprt mutation frequency which gradually diminished, so that no significant increase was observed four and a half years after original exposure. The spectrum of hprt mutations recovered from ten individuals exposed to relatively high doses of radiation revealed a fourfold increase in the frequency of A:T → G:C transitions. The increase is consistent with the effects of ionizing radiation in prokaryotes and lower eukaryotes. Additionally, a twofold increase in the frequency of deletions was observed which may reflect radiation induced DNA strand breakage; 2) determination of microsatellite instability using fluorescent PCR and genomic DNA from mononuclear cells. The frequency distributions of somatic microsatellite alterations in exposed and non-exposed populations were not different. Our assay lacked sensitivity to discriminate between spontaneous and induced microsatellite instability and therefore, is not suitable for population monitoring. Finally, we estimated the risk associated with radiation exposure for the exposed Goiania population. The estimated genetic risk of dominant disorders in the first post-exposure generation was increased nearly twenty-fourfold. The risk of carcinogenesis was increased by a factor of 1.5. (author)

  10. Possible cause for altered spatial cognition of prepubescent rats exposed to chronic radiofrequency electromagnetic radiation. (United States)

    Narayanan, Sareesh Naduvil; Kumar, Raju Suresh; Karun, Kalesh M; Nayak, Satheesha B; Bhat, P Gopalakrishna


    The effects of chronic and repeated radiofrequency electromagnetic radiation (RFEMR) exposure on spatial cognition and hippocampal architecture were investigated in prepubescent rats. Four weeks old male Wistar rats were exposed to RF-EMR (900 MHz; SAR-1.15 W/kg with peak power density of 146.60 μW/cm(2)) for 1 h/day, for 28 days. Followed by this, spatial cognition was evaluated by Morris water maze test. To evaluate the hippocampal morphology; H&E staining, cresyl violet staining, and Golgi-Cox staining were performed on hippocampal sections. CA3 pyramidal neuron morphology and surviving neuron count (in CA3 region) were studied using H&E and cresyl violet stained sections. Dendritic arborization pattern of CA3 pyramidal neuron was investigated by concentric circle method. Progressive learning abilities were found to be decreased in RF-EMR exposed rats. Memory retention test performed 24 h after the last training revealed minor spatial memory deficit in RF-EMR exposed group. However, RF-EMR exposed rats exhibited poor spatial memory retention when tested 48 h after the final trial. Hirano bodies and Granulovacuolar bodies were absent in the CA3 pyramidal neurons of different groups studied. Nevertheless, RF-EMR exposure affected the viable cell count in dorsal hippocampal CA3 region. RF-EMR exposure influenced dendritic arborization pattern of both apical and basal dendritic trees in RF-EMR exposed rats. Structural changes found in the hippocampus of RF-EMR exposed rats could be one of the possible reasons for altered cognition.

  11. Cytogenetic monitoring of personnel occupationally exposed to microwave radiation of GEM radar

    International Nuclear Information System (INIS)

    Garaj-Vrhovac, Vera; Gajski, Goran; Brumen, Vlatka


    In the present study we analyzed and followed-up on the DNA damaging effects of microwave radiation of GEM radar equipment within microwave field of 10 μW/cm 2 to 10 mW/cm 2 in personnel occupationally exposed to frequency range of 1.5 GHz to 10.9 GHz. The single cell gel electrophoresis (SCGE)/comet assay as a tool for the bio monitoring of individuals accidentally, environmentally or occupationally exposed to physical or chemical agents was used to evaluate possible genotoxic effect on peripheral human blood lymphocytes. The comet assay is a method that allows efficient determination of single strand breaks (SSB) and double-strand breaks (DSB), as well as alkali-labile sites in the DNA of single cells. The comet assay was carried out under alkaline conditions. We measured the baseline comet assay effect in whole blood samples. Parameter of the comet assay was studied in workers occupationally exposed to microwave radiation of GEM radar and in corresponding unexposed control subjects. It was found that in the subjects who were occupationally exposed to microwave radiation, the levels of DNA damage increased compare to control group and showed interindividual variations. As a measure of DNA damage tail length was used, calculated from the centre of the head and presented in micrometers (μm). Mean value of exposed group was 13.54±1.44 as opposed to control mean value that was 13.15±1.39. Differences between mean tail lengths were statistically significant (P<0.05, ANOVA). The results of this study indicate that individuals occupationally exposed to microwave frequency of GEM radar equipment may experience an increased genotoxic risk, emphasizing the importance of individual bio monitoring, limiting exposure and radiation safety programs. (author)

  12. Clinical course of brain stroke in the persons exposed to ionizing radiation under the production conditions

    International Nuclear Information System (INIS)

    Bouchmanov, A.


    The purpose was to study the risk factors and clinical course of brain strokes in professionally exposed workers being employed in plutonium production in comparison with a control group. The method and materials of study -clinical supervision and clinical database creation on 162 cases of brain stroke (128 males and 34 females) developed among professionally exposed workers. Age of patient varied from 21 to 68 years (in average -51.6 y.). The control group consisted of patients with the same diagnosis, worked on the same enterprise, but non-exposed to radiation. Data on the totally accumulated dose of external gamma radiation were received on the base of the individual dosimeters (from 0.1 cSv to 52 cSv, in average about 13 cSv); the plutonium-239 body content was estimated accordingly to the level of urine radionuclide excretion (from 0.4 kBq to 1.6 kBq, in average about 0.33 kBq). Muscle's hypertinsion and pathological great-toe reflexes in paretic legs and hands, hemianopsia, impressive and ataxic aphasia prevailed in the patients with ischemic brain strokes in system of internal carotid artery, exposed to radiation. The changes of muscle's tension, ataxia and nystagmus were marked more often in the professionals with ischemic brain strokes in system of vertebrobasilar artery. The illness proceeded more easy and with smaller frequency of frustration of consciousness and algesthesia, irrespective of a type ischemic brain strokes in the people exposed to ionizing radiation, than in patients of non-irradiated group. It was found that the arterial hypertension appeared to be the main risk factor for the brain stroke in both groups of patients (in 81.48% and 91.15% of cases). There was no marked differences in significance of risk factors and in main clinical parameters of various types of ischemic brain strokes among the patients professionally exposed to radiation in comparison with a control group. (author)

  13. Chest pain in rubber chemical workers exposed to carbon disulphide and methaemoglobin formers

    Energy Technology Data Exchange (ETDEWEB)

    Oliver, L.C.; Weber, R.P.


    A cross sectional prevalence study of chest pain in 94 rubber chemical workers exposed to carbon disulfide (CS2) and methemoglobin forming aromatic amines was carried out. The purpose of the study was to determine whether the prevalence of chest pain or coronary heart disease (CHD), or both, in exposed individuals exceeded that of a group of non-exposed individuals from the same plant. Cardiovascular, smoking, and occupational histories were obtained. Blood pressure, height, weight, serum cholesterol, and fasting blood glucose were measured. Resting electrocardiograms (ECGs) were obtained on all study participants, as were exercise stress tests on selected exposed individuals. Matching eliminated important known risk factors for coronary artery disease. Both chest pain and angina were significantly related to exposure, controlling for age and cigarette smoking. This association was not dependent on duration of exposure as defined by 10 or more years of employment in the department of interest. CHD as defined by angina, a history of myocardial infarction, or a coronary ECG or a combination of these occurred more frequently among exposed workers. The number of abnormal ECGs in the exposed group was twice that in the control group, but the difference was not statistically significant. Age rather than exposure appeared to be the important variable associated with raised blood pressure. Neither biological measures of exposure nor ECGs showed an acute effect of workplace exposures on the myocardium. Possible additive or multiplicative effects of individual chemical agents could not be evaluated. Appropriate modification of medical surveillance of rubber chemical workers with exposure to CS2 and aromatic amines is warranted.

  14. Hearing loss in workers exposed to epoxy adhesives and noise: a cross-sectional study. (United States)

    Yang, Hsiao-Yu; Shie, Ruei-Hao; Chen, Pau-Chung


    Epoxy adhesives contain organic solvents and are widely used in industry. The hazardous effects of epoxy adhesives remain unclear. The objective of this study was to investigate the risk of hearing loss among workers exposed to epoxy adhesives and noise. Cross-sectional study. For this cross-sectional study, we recruited 182 stone workers who were exposed to both epoxy adhesives and noise, 89 stone workers who were exposed to noise only, and 43 workers from the administrative staff who had not been exposed to adhesives or noise. We obtained demographic data, occupational history and medical history through face-to-face interviews and arranged physical examinations and pure-tone audiometric tests. We also conducted walk-through surveys in the stone industry. A total of 40 representative noise assessments were conducted in 15 workplaces. Air sampling was conducted at 40 workplaces, and volatile organic compounds were analysed using the Environmental Protection Agency (EPA) TO-15 method. The mean sound pressure level was 87.7 dBA (SD 9.9). The prevalence of noise-induced hearing loss was considerably increased in the stone workers exposed to epoxy adhesives (42%) compared with the stone workers who were not exposed to epoxy adhesives (21%) and the administrative staff group (9.3%). A multivariate logistic regression analysis revealed that exposure to epoxy adhesives significantly increased the risk of hearing loss between 2 and 6 kHz after adjusting for age. Significant interactions between epoxy adhesives and noise and hearing impairment were observed at 3, 4 and 6 kHz. Epoxy adhesives exacerbate hearing impairment in noisy environments, with the main impacts occurring in the middle and high frequencies. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to

  15. Effect of acetaminophen administration to rats chronically exposed to depleted uranium

    International Nuclear Information System (INIS)

    Gueguen, Y.; Grandcolas, L.; Baudelin, C.; Grison, S.; Tissandie, E.; Jourdain, J.R.; Paquet, F.; Voisin, P.; Aigueperse, J.; Gourmelon, P.; Souidi, M.


    The extensive use of depleted uranium (DU) in both civilian and military applications results in the increase of the number of human beings exposed to this compound. We previously found that DU chronic exposure induces the expression of CYP enzymes involved in the metabolism of xenobiotics (drugs). In order to evaluate the consequences of these changes on the metabolism of a drug, rats chronically exposed to DU (40 mg/l) were treated by acetaminophen (APAP, 400 mg/kg) at the end of the 9-month contamination. Acetaminophen is considered as a safe drug within the therapeutic range but in the case of overdose or in sensitive animals, hepatotoxicity and nephrotoxicity could occur. In the present work, plasma concentration of APAP was higher in the DU group compared to the non-contaminated group. In addition, administration of APAP to the DU-exposed rats increased plasma ALT (p < 0.01) and AST (p < 0.05) more rapidly than in the control group. Nevertheless, no histological alteration of the liver was observed but renal injury characterized by incomplete proximal tubular cell necrosis was higher for the DU-exposed rats. Moreover, in the kidney, CYP2E1 gene expression, an important CYP responsible for APAP bioactivation and toxicity, is increased (p < 0.01) in the DU-exposed group compared to the control group. In the liver, CYP's activities were decreased between control and DU-exposed rats. These results could explain the worse elimination of APAP in the plasma and confirm our hypothesis of a modification of the drug metabolism following a DU chronic contamination

  16. Effects of Circadian Disruption on Methamphetamine Consumption in Methamphetamine-Exposed Rats (United States)

    Doyle, Susan E.; Feng, Hanting; Garber, Garrett; Menaker, Michael; Lynch, Wendy J.


    Rationale A substantial number of clinical studies indicate associations between sleep abnormalities and drug abuse; however, the role played by the circadian system in the development of addiction is largely unknown. Objective The aim of this study was to examine the effects of experimentally induced chronic jet lag on methamphetamine consumption in a rat model of methamphetamine drinking. Methods Male Sprague-Dawley rats (n=32) were housed in running wheel cages in a 12:12 light:dark cycle. One group of rats (n=16) was given two weeks of forced methamphetamine consumption (0.01% in drinking water; meth pre-exposed) while a second group (n=16, not pre-exposed) received water only. This was followed by a two week abstinence period during which half of the animals from each group were exposed to 4 consecutive 6-hr advancing phase shifts of the light:dark cycle, while the other half remained on the original light:dark cycle. Methamphetamine consumption was assessed in all rats following the deprivation period using a two-bottle choice paradigm. Results Methamphetamine consumption was initially lower in methamphetamine pre-exposed vs. not pre-exposed rats. However, during the second week following abstinence, consumption was significantly higher in phase shifted rats of the methamphetamine pre-exposed group compared to all other groups. Conclusions These data reveal an effect of circadian rhythm disturbance on methamphetamine consumption, and suggest that dysregulation of the circadian system be considered in the etiology of relapse and addiction. PMID:25543849

  17. Late and latent effects of atomic bomb on chromosomes in the exposed population

    International Nuclear Information System (INIS)

    Tanaka, Ryuji; Kamada, Nanao


    Cytogenetic changes of exposed individuals, and the diseases and cytogenetic changes of the F 1 were discussed. The subjects exposed within 0.5 km. from the hypocenter revealed chromosomal aberration of the bone marrow in 83 per cent and those within 0.5 to 1.0 km. from the hypocenter revealed it in 47 per cent. The aberration was mostly the stable type, and was frequent in deletion, balanced-type translocation, unbalanced-type translocation, and inversion, in the order named. The number of abnormal clone varied with year. The chromosomes of the lymphocytes in the peripheral blood also showed high rate of stable type aberration, and the chromosomes were also aberrant in the fibroblasts of the keloid lesion. However, there were no abnormalities in the spermatogonium. Thirty seven subjects of F 1 group included 13 subjects whose father had been exposed, 19 subjects whose mother had been exposed, and 5 subjects whose both parents had been exposed. The diseases seen in the F 1 subjects were hematonosis in 28 subjects, autoimmune diseases in 5 subjects, and hypertension and lymphadenitis in 4 cases. Acute myelogenic leukemia (AML) showed normal chromosomes in all the 3 cases, the acute lymphatic leukemia (ALL), showed abnormal clones in 2 of 3 cases. Chronic myelogenic leukemia (CML) revealed abnormal chromosomes in all the 3 cases. The cytogenetic changes of abnormal clone in the F 1 of non-exposed were 60 per cent in AML, 57 per cent, in ALL and 100 per cent in CML. (Mukohata, S.)

  18. Abnormal emotional learning in a rat model of autism exposed to valproic acid in utero

    Directory of Open Access Journals (Sweden)

    Anwesha eBanerjee


    Full Text Available Autism Spectrum Disorders (ASD are complex neurodevelopmental disorders characterized by repetitive behavior and impaired social communication and interactions. Apart from these core symptoms, a significant number of ASD individuals display higher levels of anxiety and some ASD individuals exhibit impaired emotional learning. We therefore sought to further examine anxiety and emotional learning in an environmentally induced animal model of ASD that utilizes the administration of the known teratogen, valproic acid (VPA during gestation. Specifically we exposed dams to one of two different doses of VPA (500 and 600 mg/kg or vehicle on day 12.5 of gestation and examined the resultant progeny. Our data indicate that animals exposed to VPA in utero exhibit enhanced anxiety in the open field test and normal object recognition memory compared to control animals. Animals exposed to 500 mg/kg of VPA displayed normal acquisition of auditory fear conditioning, and exhibited reduced extinction of fear memory and normal litter survival rates as compared to control animals. We observed that animals exposed to 600 mg/kg of VPA exhibited a significant reduction in the acquisition of fear conditioning, a significant reduction in social interaction and a significant reduction in litter survival rates as compared to control animals. VPA (600 mg/kg exposed animals exhibited similar shock sensitivity and hearing as compared to control animals indicating the fear conditioning deficit observed in these animals was not likely due to sensory deficits, but rather due to deficits in learning or memory retrieval. In conclusion, considering that progeny from dams exposed to rather similar doses of VPA exhibit striking differences in emotional learning, the VPA model may serve as a useful tool to explore the molecular and cellular mechanisms that contribute to not only ASD, but also emotional learning.

  19. Dynamic Metabolic Disruption in Rats Perinatally Exposed to Low Doses of Bisphenol-A.

    Directory of Open Access Journals (Sweden)

    Marie Tremblay-Franco

    Full Text Available Along with the well-established effects on fertility and fecundity, perinatal exposure to endocrine disrupting chemicals, and notably to xeno-estrogens, is strongly suspected of modulating general metabolism. The metabolism of a perinatally exposed individual may be durably altered leading to a higher susceptibility of developing metabolic disorders such as obesity and diabetes; however, experimental designs involving the long term study of these dynamic changes in the metabolome raise novel challenges. 1H-NMR-based metabolomics was applied to study the effects of bisphenol-A (BPA, 0; 0.25; 2.5, 25 and 250 μg/kg BW/day in rats exposed perinatally. Serum and liver samples of exposed animals were analyzed on days 21, 50, 90, 140 and 200 in order to explore whether maternal exposure to BPA alters metabolism. Partial Least Squares-Discriminant Analysis (PLS-DA was independently applied to each time point, demonstrating a significant pair-wise discrimination for liver as well as serum samples at all time-points, and highlighting unequivocal metabolic shifts in rats perinatally exposed to BPA, including those exposed to lower doses. In BPA exposed animals, metabolism of glucose, lactate and fatty acids was modified over time. To further explore dynamic variation, ANOVA-Simultaneous Component Analysis (A-SCA was used to separate data into blocks corresponding to the different sources of variation (Time, Dose and Time*Dose interaction. A-SCA enabled the demonstration of a dynamic, time/age dependent shift of serum metabolome throughout the rats' lifetimes. Variables responsible for the discrimination between groups clearly indicate that BPA modulates energy metabolism, and suggest alterations of neurotransmitter signaling, the latter finding being compatible with the neurodevelopmental effect of this xenoestrogen. In conclusion, long lasting metabolic effects of BPA could be characterized over 200 days, despite physiological (and thus metabolic changes

  20. Monitoring the genetic health of persons in Goiania accidentally exposed to ionizing radiation from caesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Da Cruz, A D; Glickman, B W [Centre for Environmental Health, Department of Biology, University of Victoria, Victoria, BC (Canada)


    This work describes the long term genetic monitoring of the Goiania population exposed to ionizing radiation from {sup 137}Cs, using cytogenetic and molecular endpoints. Cytogenetically, micronucleus frequencies differentiated groups exposed to different levels of radiation. Two molecular methods were employed: (1) the hprt clonal assay, involving in vitro selection of 6-thioguanine-resistant hprt mutant clones which were characterized at the molecular level using RT-PCR and genomic analysis. Ionizing radiation exposure initially elevated hprt mutation frequency which gradually diminished, so that no significant increase was observed four and a half years after original exposure. The spectrum of hprt mutations recovered from ten individuals exposed to relatively high doses of radiation revealed a fourfold increase in the frequency of A:T {yields} G:C transitions. The increase is consistent with the effects of ionizing radiation in prokaryotes and lower eukaryotes. Additionally, a twofold increase in the frequency of deletions was observed which may reflect radiation induced DNA strand breakage; (2) determination of microsatellite instability using fluorescent PCR and genomic DNA from mononuclear cells. The frequency distributions of somatic microsatellite alterations in exposed and non-exposed populations were not different. Our assay lacked sensitivity to discriminate between spontaneous and induced microsatellite instability and therefore, is not suitable for population monitoring. Finally, we estimated the risk associated with radiation exposure for the exposed Goiania population. The estimated genetic risk of dominant disorders in the first post-exposure generation was increased nearly twenty-fourfold. The risk of carcinogenesis was increased by a factor of 1.5. (author)

  1. Gene expression profile in bone marrow and hematopoietic stem cells in mice exposed to inhaled benzene

    International Nuclear Information System (INIS)

    Faiola, Brenda; Fuller, Elizabeth S.; Wong, Victoria A.; Recio, Leslie


    Acute myeloid leukemia and chronic lymphocytic leukemia are associated with benzene exposure. In mice, benzene induces chromosomal breaks as a primary mode of genotoxicity in the bone marrow (BM). Benzene-induced DNA lesions can lead to changes in hematopoietic stem cells (HSC) that give rise to leukemic clones. To gain insight into the mechanism of benzene-induced leukemia, we investigated the DNA damage repair and response pathways in total bone marrow and bone marrow fractions enriched for HSC from male 129/SvJ mice exposed to benzene by inhalation. Mice exposed to 100 ppm benzene for 6 h per day, 5 days per week for 2 week showed significant hematotoxicity and genotoxicity compared to air-exposed control mice. Benzene exposure did not alter the level of apoptosis in BM or the percentage of HSC in BM. RNA isolated from total BM cells and the enriched HSC fractions from benzene-exposed and air-exposed mice was used for microarray analysis and quantitative real-time RT-PCR. Interestingly, mRNA levels of DNA repair genes representing distinct repair pathways were largely unaffected by benzene exposure, whereas altered mRNA expression of various apoptosis, cell cycle, and growth control genes was observed in samples from benzene-exposed mice. Differences in gene expression profiles were observed between total BM and HSC. Notably, p21 mRNA was highly induced in BM but was not altered in HSC following benzene exposure. The gene expression pattern suggests that HSC isolated immediately following a 2 weeks exposure to 100 ppm benzene were not actively proliferating. Understanding the toxicogenomic profile of the specific target cell population involved in the development of benzene-associated diseases may lead to a better understanding of the mechanism of benzene-induced leukemia and may identify important interindividual and tissue susceptibility factors

  2. Study on the immunity state of mouse exposed to mobile phone radiation during embryonic phase

    International Nuclear Information System (INIS)

    Pei Yinhui; Gao Hui


    Objective: To study the effect of mobile phone radiation on mouse which exposed to radiation during embryonic phase. Methods: Pregnant mice were exposed to mobile phone radiation. The mice's netrophile phage percentage and spleen lymphocyte transformation rate were detected respectively 2 months after birth. Results: The netrophile phage percentage of experimental mice was seemly the same as that of control group, and there was no significant difference (P>0.05), but the spleen transformation rate showed the diverse trend. Conclusion: The specific cellular immunity of mice, which ex- posed to mobile phone radiation during embryonic phase, was seen to be in a state of decreasement. (authors)

  3. Findings of thyroid ultrasonography in patients with hypothyroidism exposed to ionizing radiation due to Chernobyl accident

    International Nuclear Information System (INIS)

    Grid'ko, O.M.


    Comparative analysis of the findings of clinical and ultrasound study of the thyroid gland in 403 participants of the accident clean-up irradiated in the 'iodine' period and 57 patients with hypothyroidism (of them, 46 were exposed to radiation in the 'iodine' period and 11 in 'non-iodine' one) was carried out. The disease dynamics was investigated in 81 patients with acute radiation sickness. The structural changes suggest different ways of hypothyroidism development in the exposed persons and manifest themselves in two main clinical forms of the disease, atrophic and hypertrophic ones

  4. Studies of chromosomal aberrations in occupationally coal exposed population (coal cutters)

    International Nuclear Information System (INIS)

    Vijender Reddy, V.; Rudrama Devi, K.


    A detailed study was carried out among the 235 coal mine workers (coal cutters) and 215 unexposed individuals (controls) on cytogenetic effect of coal in peripheral blood lymphocytes. The frequencies of chromosomal aberrations were studied in exposed coal mine workers as well as in the control groups . The confounding factors like smoking drinking and combination of both were taken into account. There was a significant increase in the total number of aberrations among exposed population subjected to different habits like smoking and alcoholism compared to that of the controls. (author). 14 refs., 1 tab

  5. Dynamics of extra-genital pathology formation in exposed to radiation women of the reproductive age

    International Nuclear Information System (INIS)

    Apsalikov, K.N.; Gusev, B.I.; Pivina, L.M.; Kenzhina, L.B.; Ryzhenkova, O.N.; Mansarina, A.E.; Bajbusinov, O.N.


    The paper presents an extra-genital sickness rate analysis in exposed women of reproductive age that live on territories adjacent to the Semipalatinsk test site, for the period from 1963 to 2000. The average dose of women exposed to radiation is more than 0.5 Sv. Significant exceeding of age-specific standardized factor for the period from 1963 to 1990 was found. Among nosologic classes, representing exceeding of age-specific standardized factors in women of reproductive age, there were revealed diseases of blood circulation system, blood and hematopoietic organs, endocrine system, nervous system and sense organs. (author)

  6. Study of External Radiation Expose Dose on Hands of Nuclear Medicine Workers

    International Nuclear Information System (INIS)

    Park, Jun Chul; Pyo, Sung Jae


    The aims of this study are to assess external radiation exposed doses of body and hands of nuclear medicine workers who handle radiation sources, and to measure radiation exposed doses of the hands induced by a whole body bone scan with high frequency and handling a radioactive sources like 99m Tc-HDP and 18 F-FDG in the PET/CT examination. Skillful workers, who directly dispense and inject from radiation sources, were asked to wear a TLD on the chest and ring finger. Then, radiation exposed dose and duration exposed from daily radiation sources for each section were measured by using a pocket dosimeter for the accumulated external doses and the absorbed dose to the hands. In the survey of four medical institutions in Incheon Metropolitan City, only one of four institutions has a radiation dosimeter for local area like hands. Most of institutions uses radiation shielding devices for the purpose of protecting the body trunk, not local area. Even some institutions were revealed not to use such a shielding device. The exposed doses on the hands of nuclear medicine workers who directly handles radioactive sources were approximately twice as much as those on the body. The radiation exposure level for each section of the whole body bone scan with high frequency and that of the PET/CT examination showed that radiation doses were revealed in decreasing order of synthesis of radioactive medicine and installation to a dispensing container, dispensing, administering and transferring. Furthermore, there were statistically significant differences of radiation exposure doses of the hands before and after wearing a syringe shielder in administration of a radioactive sources. In this study, although it did not reach the permissible effective dose for nuclear medicine, the occupational workers were exposed by relatively higher dose level than the non-occupational workers. Therefore, the workers, who closely exposed to radioactive sources should be in compliance with safety

  7. Characterization of a alpha particle detector CR-39 exposed to a source of radium

    International Nuclear Information System (INIS)

    Maino, Leandro Marcondes


    In this project, the main goal is the characterization of a alpha particle detector CR-39 exposed to a source of radio. Three detectors were exposed to a source of radium and then chemically treated for different periods. This way, we could analyze these samples and collect the information needed to verify that at least one of the chemical attack, there has been a separation of the energies alpha particles incident with distinct peaks, thus characterizing the CR-39 as alpha spectrometer in the range 2.5 to 6.3 MeV . (author)

  8. Investigating early stages of biocorrosion with XPS: AISI 304 stainless steel exposed to Burkholderia species (United States)

    Johansson, Leena-Sisko; Saastamoinen, Tuomas


    We have investigated the interactions of an exopolymer-producing bacteria, Burkholderia sp. with polished AISI 304 stainless steel substrates using X-ray photoelectron spectroscopy (XPS). Steel coupons were exposed to the pure bacteria culture in a specially designed flowcell for 6 h during which the experiment was monitored in situ with an optical microscope. XPS results verified the formation of biofilm containing extracellular polymer on all the samples exposed to bacteria. Sputter results indicated that some ions needed for metabolic processes were trapped within the biofilm. Changes in the relative Fe concentration and Fe 2p peak shape indicated that also iron had accumulated into the biofilm.

  9. XPS response in the corrosion products analysis for copper exposed at clean air environment

    International Nuclear Information System (INIS)

    Mariaca, L.; Morcillo, M.; Feliu Jr, S.; Gonzalez, J.A.


    In this work is presented the obtained response for superficial analysis technique by X-ray photoelectron spectroscopy (XPS or ESCA), to determine the corrosion products formed during the copper exposure at environment without pollutants (clean air) at 50, 70 and 90 % of relative humidity at 35 Centigrade. One of the copper corrosion products most knew is Cu 2 O. This oxide is formed instantly to be exposed the copper at air. However in function of the exposure time and the relative humidity at it is exposed, the Cu 2 O oxide is transformed at Cu O and Cu(OH) 2 (Author)

  10. Endocrine disrupting effects in rats perinatally exposed to a dietary relevant mixture of phytoestrogens

    DEFF Research Database (Denmark)

    Boberg, Julie; Mandrup, Karen; Jacobsen, Pernille Rosenskjold


    Dietary phytoestrogens may prevent certain human diseases, but endocrine activity has been reported in animal studies. Sprague-Dawley rats were exposed perinatally to a 1-, 10- or 100-fold “high human dietary intake” mixture of 12 phytoestrogens consisting of mainly the lignan secoisolarici resinol...... genes in testis and prostate were unaffected. Decreased serum estradiol was seen in genistein-exposed dams. This study indicated adverse effects at high intake levels in rats, but does not provide evidence for risk of phytoestrogen-mediated endocrine disruption at normal human dietary consumption levels...

  11. Expression of advanced glycation end-products on sun-exposed and non-exposed cutaneous sites during the ageing process in humans. (United States)

    Crisan, Maria; Taulescu, Marian; Crisan, Diana; Cosgarea, Rodica; Parvu, Alina; Cãtoi, Cornel; Drugan, Tudor


    The glycation process is involved in both the intrinsic (individual, genetic) and extrinsic (ultraviolet light, polution and lifestyle) aging processes, and can be quantified at the epidermal or dermal level by histological, immunohistochemical (IHC), or imagistic methods. Our study is focused on a histological and immunohistological comparison of sun-protected regions versus sun-exposed regions from different age groups of skin phototype III subjects, related to the aging process. Skin samples collected from non-protected and UV protected regions of four experimental groups with different ages, were studied using histology and IHC methods for AGE-CML [N(epsilon)-(carboxymethyl)lysine]. A semi-quantitative assessment of the CML expression in the microvascular endothelium and dermal fibroblasts was performed. The Pearson one-way ANOVA was used to compare data between the groups. In the dermis of sun-exposed skin, the number and the intensity of CML positive cells in both fibroblasts and endothelial cells (p<0.05) was higher compared to sun-protected skin, and was significantly increased in older patients. The sun-exposed areas had a more than 10% higher AGE-CML score than the protected areas. No statistically significant correlation was observed between the histological score and the IHC expression of CML. We concluded that in healthy integument, the accumulation of final glycation products increases with age and is amplified by ultraviolet exposure. The study provides new knowledge on differences of AGE-CML between age groups and protected and unprotected areas and emphasizes that endothelium and perivascular area are most affected, justifying combined topical and systemic therapies.

  12. Expression of advanced glycation end-products on sun-exposed and non-exposed cutaneous sites during the ageing process in humans.

    Directory of Open Access Journals (Sweden)

    Maria Crisan

    Full Text Available The glycation process is involved in both the intrinsic (individual, genetic and extrinsic (ultraviolet light, polution and lifestyle aging processes, and can be quantified at the epidermal or dermal level by histological, immunohistochemical (IHC, or imagistic methods. Our study is focused on a histological and immunohistological comparison of sun-protected regions versus sun-exposed regions from different age groups of skin phototype III subjects, related to the aging process. Skin samples collected from non-protected and UV protected regions of four experimental groups with different ages, were studied using histology and IHC methods for AGE-CML [N(epsilon-(carboxymethyllysine]. A semi-quantitative assessment of the CML expression in the microvascular endothelium and dermal fibroblasts was performed. The Pearson one-way ANOVA was used to compare data between the groups. In the dermis of sun-exposed skin, the number and the intensity of CML positive cells in both fibroblasts and endothelial cells (p<0.05 was higher compared to sun-protected skin, and was significantly increased in older patients. The sun-exposed areas had a more than 10% higher AGE-CML score than the protected areas. No statistically significant correlation was observed between the histological score and the IHC expression of CML. We concluded that in healthy integument, the accumulation of final glycation products increases with age and is amplified by ultraviolet exposure. The study provides new knowledge on differences of AGE-CML between age groups and protected and unprotected areas and emphasizes that endothelium and perivascular area are most affected, justifying combined topical and systemic therapies.

  13. Attenuation of the cortisol response to stress in female rainbow trout chronically exposed to dietary selenomethionine

    Energy Technology Data Exchange (ETDEWEB)

    Wiseman, Steve, E-mail: [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Thomas, Jith K.; McPhee, Landon; Hursky, Olesya; Raine, Jason C. [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Pietrock, Michael [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Department of Veterinary Biomedical Sciences, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Giesy, John P. [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Department of Veterinary Biomedical Sciences, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Department of Zoology, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (Hong Kong); School of Biological Sciences, University of Hong Kong, Hong Kong (Hong Kong); Department of Zoology, Center for Integrative Toxicology, Michigan State University, East Lansing, MI 48824 (United States); State Key Laboratory of Pollution Control and Resource Reuse and School of the Environment, Nanjing University, Nanjing (China); Hecker, Markus [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); School of Environment and Sustainability, University of Saskatchewan, Saskatoon, SK, S7N 5CB (Canada); Janz, David M. [Toxicology Centre, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada); Department of Veterinary Biomedical Sciences, University of Saskatchewan, Saskatoon, SK, S7N 5B3 (Canada)


    Highlights: Trout exposed to Se-Met had greater concentration of cortisol compared to controls. Transcript abundance of mc2r was greater in trout exposed to Se-Met. Trout exposed to Se-Met had a reduced cortisol response to a handling stressor. Cortisone concentration was greater in Se-Met exposed trout post-handling stressor. - Abstract: Selenomethionine (Se-Met) is the major dietary form of selenium (Se). While Se is a required nutrient, it can also influence the physiological stress response because it stimulates greater concentrations of cortisol in blood plasma of exposed fish. However, little is known about the effects of exposure to Se on the ability to cope with a secondary stressor. In the current study, female rainbow trout were exposed to an environmentally relevant dietary concentration (8.47 mg Se/kg dry mass (dm)) of Se-Met for 126 d, after which time fish were subjected to a 3-min handling stressor and sampled at 2 h and 24 h post-stressor exposure. Concentrations of cortisol, cortisone, glucose, and lactate in blood plasma and concentrations of glycogen and triglycerides in liver and muscle were determined. Abundances of transcripts of proteins involved in corticosteroidogenesis were determined using quantitative RT-PCR. Concentrations of cortisol were significantly greater in blood plasma of trout exposed to Se-Met, relative to control trout sampled prior to the handling stressor. A typical response of cortisol to the handling stressor was observed in the control trout. However, trout exposed to Se-Met were unable to mount a cortisol response to the handling stressor. Concentrations of cortisone, the inactive metabolite of cortisol, were significantly greater following the handling stressor in trout exposed to Se-Met. In trout exposed to Se-Met, transcript abundance of melanocortin 2 receptor (mc2r) and peripheral benzodiazepine receptor (pbr) were greater, which is consistent with the conclusion that synthesis of cortisol was greater. However

  14. Attenuation of the cortisol response to stress in female rainbow trout chronically exposed to dietary selenomethionine

    International Nuclear Information System (INIS)

    Wiseman, Steve; Thomas, Jith K.; McPhee, Landon; Hursky, Olesya; Raine, Jason C.; Pietrock, Michael; Giesy, John P.; Hecker, Markus; Janz, David M.


    Highlights: Trout exposed to Se-Met had greater concentration of cortisol compared to controls. Transcript abundance of mc2r was greater in trout exposed to Se-Met. Trout exposed to Se-Met had a reduced cortisol response to a handling stressor. Cortisone concentration was greater in Se-Met exposed trout post-handling stressor. - Abstract: Selenomethionine (Se-Met) is the major dietary form of selenium (Se). While Se is a required nutrient, it can also influence the physiological stress response because it stimulates greater concentrations of cortisol in blood plasma of exposed fish. However, little is known about the effects of exposure to Se on the ability to cope with a secondary stressor. In the current study, female rainbow trout were exposed to an environmentally relevant dietary concentration (8.47 mg Se/kg dry mass (dm)) of Se-Met for 126 d, after which time fish were subjected to a 3-min handling stressor and sampled at 2 h and 24 h post-stressor exposure. Concentrations of cortisol, cortisone, glucose, and lactate in blood plasma and concentrations of glycogen and triglycerides in liver and muscle were determined. Abundances of transcripts of proteins involved in corticosteroidogenesis were determined using quantitative RT-PCR. Concentrations of cortisol were significantly greater in blood plasma of trout exposed to Se-Met, relative to control trout sampled prior to the handling stressor. A typical response of cortisol to the handling stressor was observed in the control trout. However, trout exposed to Se-Met were unable to mount a cortisol response to the handling stressor. Concentrations of cortisone, the inactive metabolite of cortisol, were significantly greater following the handling stressor in trout exposed to Se-Met. In trout exposed to Se-Met, transcript abundance of melanocortin 2 receptor (mc2r) and peripheral benzodiazepine receptor (pbr) were greater, which is consistent with the conclusion that synthesis of cortisol was greater. However

  15. Protein (Viridiplantae): 928250 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  16. Protein (Viridiplantae): 145355221 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4609 distinct from photosynthetic electron transfer catalyst, CYC6, partial Ostreococcus lucimarinus CCE9901 RDLERNGVATKEDISNLIERGKGKMPGYGESCAPKGACTFGARLDAEEIDALATYVLDRAAVDW ...

  17. Protein (Viridiplantae): 578117 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  18. Biochemical Changes in the Serum and Liver of albino rats exposed ...

    African Journals Online (AJOL)

    Biochemical changes in the serum and liver of albino rats chronically exposed to rats administered 5gk-1 , 7.5gk-1 and 15gk-1 of gasoline , kerosine and crude petroleum(bonny light) respectively were studied. The petroleum samples were administered intraperitoneally and the biochemical changes in the rat serum and the ...


    DETERMINATION OF URINARY TRIVALENT ARSENICALS (MMAsIII and DMAsIII) IN INDIVIDUALS CHRONICALLY EXPOSED TO ARSENIC. L. M. Del Razo1, M. Styblo2, W. R. Cullen3, and D.J. Thomas4. 1Toxicology Section, Cinvestav-IPN, Mexico, D.F., 2Univ. North Carolina, Chapel Hill, NC; 3Uni...

  20. Two pests overlap: Drosophila suzukii (Diptera: Drosophilidae) use of fruit exposed to Halyomorpha halys (Hemiptera: Pentatomidae) (United States)

    Spotted wing drosophila, Drosophila suzukii (Matsumura) (Diptera: Drosophilidae), and brown marmorated stink bug, Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) are global economic pests. Both pests may co-occur on small fruits, and we investigated whether fruit recently exposed to H. halys woul...